Login| Sign Up| Help| Contact|

Patent Searching and Data


Matches 1 - 50 out of 172,451

Document Document Title
WO/2018/071488A1
A hemostatic product that includes a fibrinogen mixture, a thrombin mixture and a biologically tolerable liquid. The fibrinogen mixture includes fibrinogen and at least one fibrinogen stabilizer. The thrombin mixture includes thrombin an...  
WO/2018/071663A1
RNA is a prefered composition for delivering genes to target cells for inducing genome editing. While RNA-guided DNA nucleases and their guide-RNA molecules can be easily delivered to a cell as RNA, a donor template is normally delivered...  
WO/2018/069694A1
The present invention relates to a method for determining whether a patient is likely to benefit from treatment with a therapeutic formulation, the method comprising the steps of: (a) determining the concentration of corticotropin releas...  
WO/2018/069597A1
The present invention relates to a combination of a first antibiotic compound, Colistin, and a second antibiotic compound, selected from among Sulfadiazine and fusidic acid, for use in therapeutic treatment against pathogenic enterobacte...  
WO/2018/071741A1
The invention provides sulfoxyalkyl organonitro and related compounds, compositions containing such compounds, and methods for using such compounds and compositions to treat medical disorders, such as a neurodegenerative disorder, autoim...  
WO/2018/071709A1
Polypeptides derived from fibronectin are presented that are neutrophil elastase-resistant and can bind to growth factors and/or enhance growth factor activity. These polypeptides are useful for enhancing wound healing in a patient.  
WO/2018/071814A1
The invention provides for methods of treating alcohol abuse disorder.  
WO/2018/070521A1
In one embodiment, the present invention addresses the problem of: providing an agent for inhibiting a lectin pathway and an alternative pathway; and others. In one embodiment, the present invention relates to: a fusion polypeptide conta...  
WO/2018/071295A1
Provided are compositions and methods for production of anti-inflammatory cytokines, growth factors, or chemokines. Provided are nucleic acids (e.g., expression vectors) that include an NFκB inflammation response element operably linked...  
WO/2018/071493A1
A novel receptor for GDF15 was identified (GFRAL), as well as the use of this receptor in the identification or screening of GDF15 agonists or antagonists. These agonist or antagonist compounds may be used to either potentiate or suppres...  
WO/2018/068120A1
The present invention relates to the fields of chemistry, pharmacy, biotechnology and medicine. More particularly, the present invention describes: a compound; the use of said compound; a synthetic intermediate in the preparation of comp...  
WO/2018/070069A1
The present invention provides a medicine comprising: a Toll-like receptor agonist; and LAG-3 protein, a variant thereof, or a derivative thereof.  
WO/2018/070850A1
According to an aspect, provided are: a guide RNA; a vector comprising the same; a composition for removing a nucleic acid sequence encoding a KRAS polypeptide in the genome of a cell, containing the same; a composition for preventing or...  
WO/2018/071640A1
The invention relates to a peptide of formula (I) R1-Wm-Xn-AA1-AA2-AA3-Yp-Zq-R2, cosmetic or pharmaceutical compositions comprising same and its use, for example, in the reduction of lipid accumulation in the skin, the treatment of cellu...  
WO/2018/069873A1
The present invention provides for collagen and collagen like peptide based hydrogels, corneal implants, filler glue and uses thereof. The invention represents an advancement in the field of hydrogels, corneal implants, filler glue based...  
WO/2018/071506A1
Disclosed herein is a composition for disaggregating biofilms comprising a plurality of enzymes; a calcium salt that prevents activity inhibition in the enzymes; a surfactant; and a pH adjusting additive. Disclosed herein is a method com...  
WO/2018/068758A1
Disclosed is the medical use of an anti-c Met antibody-cytotoxic drug conjugate. In particular, disclosed are an anti-c-Met antibody, an antigen-binding fragment of c-Met, a chimeric antibody and humanized antibody comprising the anti-c-...  
WO/2018/071668A1
A method of treating a subject having a cancer comprising administering a tumor suppressor therapy, such as a TUSC2 therapy, in conjunction with an immune checkpoint inhibitor. Kits and reagents for use in cancer therapy are also provided.  
WO/2018/068670A1
Provided are the use of a peptide comprising an amino acid sequence YEKLLDTEI or a functional variant thereof, or a pharmaceutical composition comprising the peptide in the preparation of a drug for preventing, alleviating or treating pa...  
WO/2018/069885A1
Provided are methods of selecting a treatment for a cancer in a subject in need thereof, by analyzing activity of Yes associated protein 1 (YAP) in cancer cells of the subject, and methods of treating cancer using a therapeutically effec...  
WO/2018/069442A1
Provided herewith are peptide dual agonists of at least the GIPR (glucose-dependent insulinotropic polypeptide receptor) and the GLP2R (glucagon-like peptide-2 receptor), and their use for treatment of bone disorders such as osteoporosis.  
WO/2018/068757A1
New anticancer and anti-obesity agents based on the cyclic peptide compounds are disclosed, and its preparation and application method for treating cancer and obesity diseases are also disclosed.  
WO/2018/069640A2
The present invention relates in particular to polyclonal antibodies directed against peptides, particularly derivatives of the propeptide of sequence QDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFPRGGRWRR (SEQ ID NO 1). The present invention also...  
WO/2018/069409A1
It is described a composition comprising lyophilized rhAnnexin V-128 suitable for the preparation of 99mTc-rhAnnexin V-128 formulations suitable for intravenous administration.  
WO/2018/071892A1
Methods and compositions for improving the specificity of genome-editing nucleases (e.g., RNA-guided CRISPR-Cas nucleases or engineered zinc finger nucleases) and customizable DNA-binding domain fusion proteins (e.g., RNA-guided dead-Cas...  
WO/2018/071911A1
This disclosure relates to nanoparticles comprising a surface molecule that binds or blocks PD-L1. In certain embodiments, the disclosure relates to methods of using peptides or nanoparticles disclosed herein for the treatment of cancer....  
WO/2018/069764A1
Provided are peptide nucleic acid derivatives targeting a part of the human HIF-1α pre-mRNA. The peptide nucleic acid derivatives potently induce exon skipping to yield splice variants of HIF-1α mRNA in cells, and are useful to treat i...  
WO/2018/068766A1
Disclosed are an optimised chimeric antigen receptor, a gene and a recombinant expression vector thereof, an engineered CD19-targeted T cell, and an application thereof. The chimeric antigen receptor is made up of CD19ScFv, the hinge dom...  
WO/2018/071576A1
Methods are disclosed for treating a subject with a solid tumor. The methods can include administering to the subject a therapeutically effective amount of (1) a CD300f inhibitor, (2) dendritic cells comprising an inactivated gene encodi...  
WO/2018/071849A2
The present invention encompasses engineered meganucleases which recognize and cleave a recognition sequence within an open reading frame (ORF) of the genome of at least two genotypes of the Hepatitis B virus (HBV). The present invention...  
WO/2018/071058A1
Embodiments of the disclosure concern methods and compositions for delivering therapeutic, diagnostic or interventional moieties, such as complex and simple entities such as biologies, including at least cells, for example. The methods e...  
WO/2018/071848A1
A conventional agricultural "cuber" machine was modified to transform fibrous, low density cellulosic biomass into a mechanically stable form suitable for use as a feed stock to a bulk flow torrefier process without requiring the additio...  
WO/2018/068347A1
Provided are recombinant plasmids containing the heterodimeric snake venom protein Agkisacutacin A chain gene and Agkisacutacin B chain gene, respectively, cell strains containing the recombinant plasmids, and a method for expressing the...  
WO/2018/069641A1
The present invention relates to new peptides derived from the neurotensin receptor 3 (NTSR3), and to their use, particularly in the treatment of various diseases, especially depression.  
WO/2018/070390A1
The purpose of the present invention is to provide a pharmaceutical composition and the like used for treating or preventing angiogenic diseases. This pharmaceutical composition is a combination of a monoclonal antibody or antigen-bindin...  
WO/2018/071767A1
Disclosed herein, are antibody-polymer-drug conjugates. The conjugate comprises a targeting moiety, one or more polymers, and one or more therapeutic agents. Also described herein, are compositions comprising the conjugates, methods of t...  
WO/2018/068135A1
The present description relates to methods for delivering polypeptide cargos from an extracellular space to the cytosol and/or nucleus of a target eukaryotic cell. The methods involve contacting the cell with the polypeptide cargo in the...  
WO/2018/069557A1
The invention relates to a dietary complement composition comprising: a) at least one agent that promotes the synthesis of ATP and/or creatine phosphate; b) at least one antioxidant for reducing or eliminating free radicals in at least o...  
WO/2018/071864A1
This invention provides compositions comprising at least one protein nanoparticle comprising a protein and a stealth polymer. In certain embodiments, the nanoparticle further comprises a therapeutic agent, such as a miRNA and/or siRNA. I...  
WO/2018/068119A1
The present invention relates to the fields of chemistry, pharmacy, biotechnology and medicine. More particularly, the present invention describes: the use of a peptide compound for preparing an anticonvulsant drug; an anticonvulsant pha...  
WO/2018/068770A1
Disclosed are a GLP-1-mimicking pharmaceutical composition for treating type 2 diabetes and a preparation method thereof, wherein the pharmaceutical composition contains polyethylene gylcol loxenatide, a physiologically acceptable buffer...  
WO/2018/069926A1
The present invention relates to the field of preservation of functional pancreatic islet (beta-cells) and treatment of diabetes, providing improved dosage regimen of AAT administration to Type 1 Diabetes Mellitus (T1DM) patients, partic...  
WO/2018/071623A2
Compositions that specifically cleave target sequences in Flavivirus, for example Zika virus include a Clustered Regularly Interspaced Short Palindromic Repeat (CRISPR) associated endonuclease, a guide RNA sequence complementary to a tar...  
WO/2018/065028A1
Present invention relates to a composition for use in the treatment of an individual suffering from a condition necessitating new bone formation. The present invention further relates to osteoconductive carriers that have been provided w...  
WO/2018/067545A1
Compositions and methods are disclosed herein to deliver and anchor nanoscale drug carriers into the extracellular matrix (ECM) of tissues, such as degenerating cartilage or tumor margins, and to provide local and sustained release of dr...  
WO/2018/067361A1
This disclosure relates to synthetic ligands for detecting PD-L1 in a sample or subject. The ligand can be labeled with a variety of detectable labels allowing of visualization and quantification. The ligand provides an alternative PD-L1...  
WO/2018/067999A1
Described herein are methods of electroporation that can include the steps of contacting a cell that is responsive to an EphA2 receptor ligand with an amount of an EphA2 receptor ligand and applying high-frequency irreversible electropor...  
WO/2018/066545A1
Provided is a drug that can decompose a target intracellular protein specifically and is effective for the prevention or treatment of diseases associated with the target protein. An SNIPER compound produced by linking a specific IAP liga...  
WO/2018/067217A2
A pharmaceutical composition for treating an ophthalmic disease in a subject includes a peptide and a pharmaceutically acceptable excipient, wherein the peptide contains the sequence of SEQ ID NO: 1 : S-X-X-A-X-Q/H-X-X-X-X-l/V-l-X-R, whe...  
WO/2018/065563A1
The present invention relates to immunogenic polypeptide fragments of a human Arginase protein. The fragments are in particular useful for the treatment or prevention of cancer.  

Matches 1 - 50 out of 172,451