Login| Sign Up| Help| Contact|

Patent Searching and Data

Matches 501 - 550 out of 119,648

Document Document Title
The invention relates to diseases, disorders and conditions of the brain, and agents for treatment of the same.  
A method of treating a host of neuromuscular, neurodegenerative, developmental, autoimmune and metabolic diseases/disorders related to aging, such as traumatic injury, stroke, Huntington's disease, Epilepsy, Multiple Sclerosis (MS), Lupu...  
The present invention is concerned with an oral pharmaceutical dosage form comprising hydromorphone or a pharmaceutically acceptable salt thereof and naloxone or a pharmaceutically acceptable salt thereof for use in the treatment of pain...  
The invention relates to a peptide comprising the amino acid sequence LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues, and to methods for the use of this peptide in the tr...  
The present invention relates to the use of morphine-6-glucoronide as a medicine to neonates admitted to the neonatal intensive care unit.  
The present invention provides a composition containing honey, bee pollen, royal jelly, and propolis, wherein the honey content is 70 mass% to less than 100 mass% of the total composition, the bee pollen is more than 0% and 10 mass% or l...  
The present invention provides a method with which it is possible to directly induce nervous system cells efficiently and in a short amount of time. Because the method is easy to scale up and is not affected by the characteristics or bac...  
Provided is a prophylactic or therapeutic drug for diseases involving Nav1.7, more specifically diseases such as neuropathic pain, nociceptive pain, inflammatory pain, small-fiber neuropathy, erythromelalgia, paroxysmal extreme pain diso...  
The present invention relates to a solid pharmaceutical dosage forms and methods for preparing the solid pharmaceutical dosage form that contains fingolimod or its pharmaceutically acceptable salts, conjugates or complexes thereof. The s...  
The invention relates to Cebranopadol or a physiologically acceptable salt thereof for use in the treatment or the prevention of pain and/or opioid drug dependence in a subject with impaired hepatic and/or renal function.  
A supplement includes plant-derived phosphatidylserine in a physiologically beneficial amount and at least one plant-based concentrate or extract which promotes a melatonergic benefit.  
The invention relates to 3α-ethynyl, 3β-hydroxy, 5α-pregnan-20-oxime or a pharmaceutically acceptable salt thereof, which compounds and/or salts are useful as modulators of the mammal brain excitability via the gamma-5 aminobutyric ac...  
The present invention relates to a diphenyl derivative and uses thereof, the diphenyl derivative having the structure as indicated in formula (I) defined in the description. The uses refer to the uses of the diphenyl derivative, pharmace...  
Described herein are compounds that modulate the activity of CRAC channels, methods of making such compounds, pharmaceutical compositions, and medicaments containing such compounds, and methods of using such compounds in the treatment of...  
Methods for individualized therapy of arthritic pain using a non-steroidal anti-inflammatory drug (COX-2 inhibitor). Said methods comprise basing COX-2 inhibitor dose on each patient's pharmacokinetic response to said COX-2 inhibitor.  
Disclosed are uses of 3,3',5,5'-tetraisopropyl-4,4'-diphenol, pharmaceutical salts thereof, esterification products thereof, or solvates thereof in the preparation of medicines for the prevention and treatment of cerebral ischemia.  
Disclosed herein a pharmaceutical composition comprising aprepitant or a pharmaceutically acceptable salt thereof; at least one hydrocarbon derivative selected from among a fatty acid of 14 to 18 carbon atoms, and a fatty alcohol of 14 t...  
The present invention relates to granulates of Dimethyl fumarate comprising of gastro resistant or enteric polymers and other excipients. The invention also relates to novel oral dosage forms of Dimethyl fumarate comprising an admixture ...  
The present invention relates to the compositions, formulations and methods of treating fatty liver disorders, such as non-alcoholic fatty liver disease (NAFLD) and non¬ alcoholic steatohepatitis (NASH) and their sequelae by administrat...  
The present invention is directed to cinnoline derivatives of formula (I) pharmaceutical compositions containing them and their use in the treatment of disorders and conditions mediated by the CB-1 receptor; more particularly, use in the...  
The present invention relates to derivatives of dehydroabietic acid useful in treatment ofcardiac arrhythmiaor a hyperexcitablity disease, such as epilepsy or pain, by extracellularly acting on the voltage sensitive domain (VSD) to open ...  
The present invention provides polypeptides and their variants and derivatives which modulate GABAA receptor function at nanomolar quantities by binding to the α+/β- subunit interface, as well as methods of making and using the same. T...  
The present invention relates to derivatives of dehydroabietic acid useful in treatment ofcardiac arrhythmiaor a hyperexcitablity disease, such as epilepsy or pain, by extracellularly acting on the voltage sensitive domain (VSD) to open ...  
This invention provides methods of treating motor disorder side effects associated with the administration of levodopa to a subject having Parkinson's disease, by administering eltoprazine or a pharmaceutically acceptable acid addition s...  
The present invention provides AAV capsid proteins comprising a modification in the amino acid sequence and virus capsids and virus vectors comprising the modified AAV capsid protein. The invention also provides methods of administering ...  
The present invention relates to a diphenyl derivative and uses thereof, the diphenyl derivative having the structure as indicated in formula (I) defined in the description. The uses refer to the uses of the diphenyl derivative, pharmace...  
A therapeutic agent for progressive demyelinating immune disease containing, as an active ingredient thereof, a substance for suppressing or inhibiting signal transduction initiated by the PAR1 receptor.  
The disclosure provides novel methods of treating neuromuscular or neurologic disease, for example, Amyotrophic lateral sclerosis (ALS), through reducing GABAergic and Glycinergic inhibitory neurotransmitter activity overstimulation. Pha...  
Described herein are compounds that modulate the activity of CRAC channels, methods of making such compounds, pharmaceutical compositions, and medicaments containing such compounds, and methods of using such compounds in the treatment of...  
The present invention provides: a furoxan compound having a fluorine atom as a substituent group on the ring structure thereof; and a novel nitric oxide donor using said compound. The present invention is a fluorofuroxan compound represe...  
The present invention relates to a benzofuroxan oxide histone deacetylase inhibitor, and a preparation method therefor and uses thereof. The compound has a structure represented by a formula I or I', a tautomer II represented by the form...  
Disclosed herein a pharmaceutical composition comprising aprepitant or a pharmaceutically acceptable salt thereof; at least one hydrocarbon derivative selected from among a fatty acid of 14 to 18 carbon atoms, and a fatty alcohol of 14 t...  
Provided herein are compounds useful for improving mRNA splicing in a cell. Exemplary compounds provided herein are useful for improving mRNA splicing in genes comprising at least one exon ending in the nucleotide sequence CAA. Methods f...  
The invention relates to heterocyclic angiotensin II type 2 (AT2) receptor antagonists of formula (I), and pharmaceutically acceptable salts thereof, ((I) in which all of the variables are as defined in the specification, pharmaceutical ...  
Provided is a drug the active ingredient of which is a compound having antagonistic activity against EP4 receptor in the prevention and/or treatment of disease attributed to activation of EP4 receptor. The compound represented by general...  
Disclosed are: a medicinal composition, a cosmetic, a food and a drink each comprising a porous ceramic, said porous ceramic being obtained by subjecting a starting material, which contains (1) titanium and (2) at least one member select...  
The presently disclosed subject matter provides methods for treating and diagnosing neurological diseases or disorders using intranasal administration of glutamate carboxypeptidase II (GCP-II) inhibitors in a subject. Methods for imaging...  
A method for extracting stilbene compounds comprises the following steps: grinding a medicinal material rich in stilbene compounds such as rheum officinale; extracting the medicinal material with a herbal blitzkrieg extractor for one to ...  
This disclosure relates to compounds of formula (I) or a pharmaceutically acceptable salt thereof: in which m, p, A, Ar1, Ar2, Ar3, R1, R2, and R3 are defined in the specification. The compounds of formula (I) can be used as CGRP antagon...  
Compositions including an odd chain fatty acid, and salts and derivatives thereof, and methods for metabolic syndrome treatment and prophylaxis are provided, including compositions and methods for treating diabetes, obesity, hyperferriti...  
The present invention is directed to the compound (1S)-2-acetyl-1-(4-chloro-2-methoxyphenyl)-5-fluoro-1,2,3,9- tetrahydrospiro[ß-carboline-4,1'-cyclopropane] represented by the formula. This compound, when compared to conventionally-kno...  
The invention relates to the pharmaceutical or non-pharmaceutical use of an effective amount of spirulina and/or of an extract/extracts of spirulina for improving the bioavailability of orally administered curcumin in humans or animals. ...  
Disclosed are magnesium-containing oxytocin peptide formulations or compositions comprising an oxytocin peptide and a magnesium salt that produces synergistic analgesia when used in treating pain. Also disclosed are methods for the treat...  
The presently disclosed subject matter provides methods for treating and diagnosing neurological diseases or disorders using intranasal administration of glutamate carboxypeptidase II (GCP-II) inhibitors in a subject. Methods for imaging...  
The present invention relates to selective Histone deacetylase 6 (HDAC6) inhibitors and compositions containing the same. Methods of treating diseases and conditions wherein inhibition of HDAC6 provides a benefit, like a cell proliferati...  
The medicinal composition and cosmetic according to the present disclosure each comprise an iPS cell culture supernatant that is obtained by culturing iPS cells. The present disclosure also provides: a method for producing the aforesaid ...  
The composition for treating a neurodegenerative disease according to the present disclosure comprises an iPS cell culture supernatant that is obtained by culturing iPS cells. The present disclosure also provides: a method for producing ...  
Provided is a production method of a thiazole derivative represented by the formula (I), which has an adenosine A2A receptor antagonistic action and is useful as a therapeutic agent for, for example, Parkinson's disease, sleep disorder, ...  
The invention relates to a novel creatine derivative, the carboxylic biacyl creatine derivative of formula (I) and pharmaceutically acceptable salts thereof, methods of synthesis and the use thereof in the treatment of pathologies due to...  
Pharmaceutical composition for the treatment of proteinopathies comprising products which are able to stimulate growth or inhibition of at least one of Odoribacter, Oscillospira, Dehalobacterium, Alistipes, Parabacteroides, Lactobacillus...  

Matches 501 - 550 out of 119,648