| Document |
Document Title |
|
WO/2023/160654A1 |
The present invention relates to the field of molecular vaccinology. Provided in the present invention is a recombinant multicomponent SARS-CoV-2 trimeric protein vaccine capable of inducing a broad-spectrum neutralizing activity. Recomb...
|
|
WO/2023/161443A1 |
The present invention concerns novel peptides targeting the interaction between Kindlin-1 and β-integrin, and pharmaceutical compositions comprising these peptides. The invention also relates to these peptides and compositions for use i...
|
|
WO/2023/160260A1 |
Disclosed in the present invention are a CD7-CAR-T cell, and a preparation method therefor and the use thereof, wherein the CD7-CAR-T cell contains an antibody targeting a CD7 antigen or an antigen-binding fragment thereof, and the antib...
|
|
WO/2023/155318A1 |
Provided are a broad-spectrum anti-SARS-CoV-2 lipopeptide, a preparation method therefor, a virus membrane fusion inhibitor comprising the lipopeptide, and use of the lipopeptide in the preparation of a pharmaceutical composition for pre...
|
|
WO/2023/158836A1 |
The present disclosure provides engineered CD47 proteins and uses thereof. Also disclosed are polynucleotides encoding the engineered CD47 protein, vectors comprising the polynucleotides, cells comprising the engineered proteins and/or t...
|
|
WO/2023/155918A1 |
The present disclosure provides a VEGF-binding molecule and a pharmaceutical use thereof. In particular, the present disclosure relates to a VEGF-binding molecule, a nucleic acid encoding the VEGF-binding molecule, a vector comprising th...
|
|
WO/2023/155876A1 |
A mycotoxin magnetic chemiluminescence immunoassay kit based on a bifunctional fusion protein, and an application thereof. The kit comprises streptavidin magnetic particles, a biotin-labeled mycotoxin antigen, a mycotoxin standard soluti...
|
|
WO/2023/155925A1 |
This disclosure provides anti-5T4 antibodies, variants thereof and humanized versions. The newly disclosed antibodies exhibited high affinity to the 5T4 protein and can be used to treat cancers.
|
|
WO/2023/159247A1 |
Compositions and methods are provided for modulating the activity of cells using engineered receptors, polynucleotide encoded engineered receptors, and gene therapy vectors comprising polynucleotides encoding engineered receptors. These ...
|
|
WO/2023/155901A1 |
Provided are mutant cytidine deaminases and related molecules useful for conducting base editing with reduced or no off-target mutations and with improved editing site precision. The mutant catalytic domain of the mouse APOBEC3 protein i...
|
|
WO/2023/155926A1 |
Provided are CD40 agonist antibodies which have greatly higher CD40 activation activity in the presence of concurrent tumor-associated antigen (TAA) binding than without such concurrent binding. Such TAA-dependent CD40 agonism results in...
|
|
WO/2023/154948A1 |
The disclosure relates to the manufacture of a recombinant fusion protein composed of the full- length extracellular domain (soluble) of human receptor tyrosine kinase ephrin type-B receptor 4 (sEphB4) AND human serum albumin (HSA) and r...
|
|
WO/2023/153442A1 |
Provided is a masked antibody having better performance than conventional masked antibodies. A molecule that binds to a target antigen, the molecule comprising the following part [a], part [b], and part [c]. Part [a]: A part that binds...
|
|
WO/2023/151446A1 |
Disclosed in the present invention is a betacoronavirus fusion recombinant protein comprising an RBD region of an S protein of the novel coronavirus COVID-19 and comprising a COVID19-SF5 fragment; the amino acid sequence of the COVID19-S...
|
|
WO/2023/151346A1 |
The present invention provides construction and application of a novel bispecific chimeric antigen receptor (CAR), and relates to the technical field of immunotherapy. The CAR provided by the present invention comprises an antigen-bindin...
|
|
WO/2023/151661A1 |
The present disclosure relates to an immunoconjugate and the use thereof. In particular, the present disclosure relates to an immunoconjugate comprising a PD-1 antibody or an antigen-binding fragment thereof and IL-2, and the use of the ...
|
|
WO/2023/151425A1 |
Disclosed in the present invention are a CD52-targeting chimeric antigen receptor (CAR) and an application thereof. A T cell expressing the CD52-targeting CAR is constructed. It is proved that the CAR-T cell can be effectively amplified ...
|
|
WO/2023/149555A1 |
Provided is a T cell production method that comprises a step (1) for culturing a 3D cell aggregate containing cells that can be differentiated into T cells and stromal cells expressing notch ligands derived from pluripotent stem cells. A...
|
|
WO/2023/150623A2 |
Nucleic acid constructs and compositions that allow insertion of a multidomain therapeutic protein (e.g., GAA fusion protein) coding sequence into a target genomic locus such as an endogenous ALB locus and/or expression of the multidomai...
|
|
WO/2023/148275A1 |
The present invention relates to cyclic peptides useful as epitope tags, and compositions thereof. Furthermore, the invention is directed to methods of their use in complex formation.
|
|
WO/2023/149443A1 |
The present invention relates to a pharmaceutical composition for blood cell recovery after allogeneic cord blood transplant, the pharmaceutical composition containing romiplostim as an active ingredient. The pharmaceutical composition i...
|
|
WO/2023/146791A1 |
Disclosed herein are novel synthetic peptides and their uses in the delivery of active agents (e.g., nucleic acids) in vitro or in vivo. The present disclosure thus provides a covalent peptide/nucleic acid complex useful in such uses. Th...
|
|
WO/2023/143534A1 |
Disclosed are an antibody specifically recognizing 4-1BB, a preparation method therefor and use thereof. The antibody comprises a heavy chain variable region and a light chain variable region. The heavy chain variable region comprises HC...
|
|
WO/2023/143619A1 |
Provided are a neutralizing blocking agent for blocking infection of a cell by a virus, a preparation method therefor and a use thereof. The neutralizing blocking agent comprises a first functional area G and a second functional area S t...
|
|
WO/2023/141724A1 |
There are provided polypeptides that include an Activin receptor type IIB (ActRIIB) ectodomain (ECD) variant. In some embodiments, a polypeptide of the disclosure includes an ActRIIB-ECD variant fused to an Fc domain moiety. The disclosu...
|
|
WO/2023/143396A1 |
The present invention relates to a high-transdermal-absorption peptide and I-type recombinant collagen constructed by means of repetitions of the peptide. The high-transdermal-absorption I-type recombinant collagen of the present inventi...
|
|
WO/2023/143273A1 |
Provided is a novel antibody construct ZHBody. The antibody construct comprises, in an amino-to-carboxyl order, a first domain and a second domain. The first domain is an antibody or an antigen-binding fragment that does not comprise an ...
|
|
WO/2023/141713A1 |
The present disclosure provides fusion proteins with a multifunctional biologic design for programmed target engagement. In certain embodiments, the fusion proteins described herein provide for concurrent T cell and target antigen engage...
|
|
WO/2023/143454A1 |
The present disclosure provides a conjugate of a nucleic acid or derivative thereof and a sortase. The present disclosure also provides a conjugate of a nucleic acid or derivative thereof and a cell, and a method of preparing such a conj...
|
|
WO/2023/142449A1 |
Disclosed is a broad-spectrum antibacterial peptide CA-1 having an amino acid sequence of GLLSVLGSVAKHVLPHVVPVIAEHLWKKLFKK-NH2. The broad-spectrum antibacterial peptide is obtained by modifying, by means of a rational molecular design in...
|
|
WO/2023/142109A1 |
The present application relates to a fusion protein, comprising: a transferrin-binding protein, and a growth hormone or a functionally active fragment thereof. The transferrin-binding protein comprises a polypeptide, or an antibody or an...
|
|
WO/2023/145961A1 |
Provided is an IGF1R CAR-T cell that is expected to be effective against tumors that express IGF1R. Provided is a polynucleotide that encodes a chimeric antigen receptor (CAR) protein having a target-binding domain that binds to the insu...
|
|
WO/2023/143463A1 |
The present disclosure relates to a fusion protein including Annexin A5 and one or more cell-penetrating peptides. The fusion protein can be used for treating hemorrhage, vascular injury, blood-brain barrier damage and inflammatory-relat...
|
|
WO/2023/143525A1 |
B domain and Z domain mutants of a protein A, and an application thereof. Specifically, provided is an isolated polypeptide, which is selected from: (1) a polypeptide having a substitution mutation at one or more positions selected from ...
|
|
WO/2023/143464A1 |
The present disclosure provides a fusion protein including Annexin A5 and one or more cell-penetrating peptides. The fusion protein can be used for treating autoimmune disease.
|
|
WO/2023/142786A1 |
Provided is an immunogenic composition comprising a recombinant peptide and protein. The recombinant peptide and protein comprise a coronavirus antigen and immunogen, for example, an S protein peptide of a SARS-CoV-2 coronavirus beta (B....
|
|
WO/2023/143395A1 |
The present invention relates to an I-type recombinant collagen with high transdermal absorbability, and the use thereof. The human I-type recombinant collagen with high transdermal absorbability of the present invention is composed of m...
|
|
WO/2023/141932A1 |
The present disclosure provides a conjugate of a nucleic acid or derivative thereof and a sortase. The present disclosure also provides a conjugate of a nucleic acid or derivative thereof and a cell, and a method of preparing such a conj...
|
|
WO/2023/143043A1 |
Disclosed in the present invention is fusion protein Tau-4R, which can be recombined into Escherichia coli to achieve the fusion expression. It is confirmed by means of experiments that the tau protein prepared by the strain may be used ...
|
|
WO/2023/142635A1 |
Provided are an α1β1 integrin-dependent enhancement CAR-macrophage, a preparation method therefor and use thereof. The CAR-macrophage comprises an α1β1 integrin transmembrane region, an intracellular signal regulatory motif, an FcγR...
|
|
WO/2023/141856A1 |
Provided in the present application are a CD3-targeting multispecific antibody and the use thereof.
|
|
WO/2023/146654A1 |
This disclosure relates to engineered PD-1 variants, and methods of use thereof.
|
|
WO/2023/143497A1 |
The present invention provides a chimeric antigen receptor having two or more antigen-binding moieties or antigen-binding fragments thereof. By means of dimerization of the chimeric antigen receptor mediated by a hinge region and a trans...
|
|
WO/2023/143308A1 |
The present invention relates to a bifunctional molecule formed by fusion of a PD1 antibody and interleukin 2. The bifunctional molecule comprises a heterodimer composed of a first monomer and a second monomer as follows: (1) a first mon...
|
|
WO/2023/143470A1 |
The present invention relates to the field of biotechnology. Disclosed are a bifunctional fusion protein, a method for preparing same, and use thereof. The bifunctional fusion protein comprises a VEGF antagonist fragment and a TGF-β ant...
|
|
WO/2023/138668A1 |
The present invention relates to a stable macromolecular type I recombinant collagen and a use thereof. The macromolecular type I recombinant collagen of the present invention is formed by performing multiple repetitions by using a short...
|
|
WO/2023/141044A1 |
Disclosed herein are formulations of small molecule GIP/GLP-1 dual receptor agonists and uses thereof.
|
|
WO/2023/138579A1 |
Disclosed are an anti-B7-H7 antibody or an antigen-binding fragment thereof, a preparation method therefor and the use thereof. The antibody comprises VL and/or VH; the VL comprises CDRs or mutations thereof: LCDR1, LCDR2 and LCDR3 as sh...
|
|
WO/2023/141480A1 |
Described herein is a cell comprising a feedback circuit. In some embodiment, the circuit may comprise: (a) a first polypeptide that is activated by an external stimulus and, downstream from the first polypeptide: (b) a target protein an...
|
|
WO/2023/138334A1 |
Provided is a recombinant novel coronavirus protein, comprising at least two artificially-constructed non-natural RBD fragments; a recombinant vaccine using same as a target antigen has the capacity for broad-spectrum protection across e...
|
