Login| Sign Up| Help| Contact|

Patent Searching and Data


Matches 1 - 50 out of 22,808

Document Document Title
WO/2019/029129A1
A dual-specificity hybrid protein for IL-17 and TNF-α, and a preparation method and uses thereof. The present dual-specificity hybrid protein for IL-17 and TNF-α is a dimer respectively comprising three structural function areas, said ...  
WO/2019/029351A1
Disclosed herein is a pharmaceutical kit for treating cancers. The present pharmaceutical kit comprises an agent and an engineered natural killer cell. The agent is capable of increasing a tumor-associated antigen expression in cancer ce...  
WO/2019/024707A1
Metal nanoparticles are directly synthesized on polymers comprising a plurality of thiol groups to form compositions useful as electron microscopy tags.  
WO/2019/028051A1
Chimeric antigen receptors containing CD19/CD20 or CD20/CD19 antigen binding domains are disclosed. Nucleic acids, recombinant expression vectors, host cells, antigen binding fragments, and pharmaceutical compositions, relating to the ch...  
WO/2019/026082A1
A recombinant protein, including: (a) alpha subunit of an FAD-GDH; and (b) a minimal cytochrome c peptide is provided. Additionally, an electrode coupled to a recombinant protein, the recombinant protein made of: (a) a cofactor of a redo...  
WO/2019/026920A1
Provided is a method for presenting a cyclic peptide, which has a chemically crosslinked structure for forming an intramolecular cyclic structure, on a protein having a loop structure, said method comprising substituting the chemically c...  
WO/2019/024150A1
Provided in the present invention are a transcription factor composition comprising transcription factors ELL, AFF and CRTC. A mammalian protein expression system may be obtained by co-transfecting an expression vector comprising a gene ...  
WO/2019/025432A1
The present invention provides a peptide of formula (I) or a pharmaceutical salt thereof wherein "m", "n", "p", and "q" represent integers and are selected from 0 and 1; and "r" is comprised from 1 to 10; a linker birradical of formula (...  
WO/2019/028125A1
This disclosure relates to bispecific antibodies or antigen-binding fragments thereof, wherein the bispecific antibodies or antigen-binding fragments thereof specifically bind to two different antigens with different binding affinities.  
WO/2019/024379A1
Provided are a fusion protein and a preparation method therefor. The fusion protein can improve in-vitro translation efficiency. A constitutive or inducible promoter (for example, pKlPGK1) is inserted in front of eIF4G in the fusion prot...  
WO/2019/028336A1
Provided herein are compositions, systems, kits, and methods for expressing a peptide of interest, such as Apolipoprotein H (ApoH), also known as β2-glycoprotein I (β2GPI), at increased levels using a non-ApoH signal peptide (e.g., a s...  
WO/2019/024081A1
The present invention provides an RVD having recognition preference for and different binding properties to 5mC, 5hmC, and 6mA, an isolated DNA-binding polypeptide comprising a TALE repeat domain containing the RVD, a fusion protein, a p...  
WO/2019/027465A1
Provided herein are methods and compositions for the treatment of melanoma using anti-tumor immune cells treated with a PTD-MYC fusion protein (e.g., an HIV TAT-MYC fusion protein).  
WO/2019/023812A1
A fusion protein comprises: an antigen comprising at least a first and a second antibody-binding epitope; and an antibody or fragment thereof specific for at least the first antigen epitope; wherein binding of the antibody or fragment th...  
WO/2019/023811A1
A fusion protein comprises a nanocage monomer; and an antibody or fragment thereof linked to the nanocage monomer, the antibody or fragment thereof comprising a first member of a binding pair; wherein a plurality of the fusion proteins s...  
WO/2019/020088A1
Provided in the present invention are a chimeric antigen receptor targeting mesothelin and the use thereof. The chimeric antigen receptor provided by the present invention, from the N-terminus to the C-terminus, successively comprises a ...  
WO/2019/023164A1
Provided herein are compositions and methods for inducing protein function. For example, in some embodiments, provided herein are compositions and methods for pharmacological induction of protein function.  
WO/2019/020087A1
The present invention relates to a chimeric antigen receptor-modified T cell targeting Muc1 and the use thereof. In particular, the chimeric antigen receptor provided by the present invention, from the N-terminus to the C-terminus, succe...  
WO/2019/020599A1
The invention relates to a multi-epitope fusion protein as well as to its use as calibrator and/or control in an in vitro diagnostics immunoassay for detecting HCV core antigen. The multi-epitope fusion protein comprises two to six diffe...  
WO/2019/016801A1
Compounds and compositions comprised of zein protein and a polypeptide of a protein extract, wherein the zein protein and the polypeptide of a protein extract are linked to each other are disclosed. Process of preparing the compounds com...  
WO/2019/018660A1
The present disclosure provides for non-viral compositions and methods for delivering nucleic acids into eukaryodc cells (e.g., stem cells) with high efficiency and low genotoxicity.  
WO/2019/014891A1
Provided is a CART cell modified by an EGFR single-domain antibody, wherein the CART cell can be used to treat a tumor. Also provided are a humanized EGFR single-domain antibody gene and a single-domain antibody encoded thereby, an EGFR ...  
WO/2019/016306A1
The application discloses compounds useful in treatment of diabetes, weight loss and/or reduction of cardiovascular risks. The compounds are bi-functional and therefore suitable as a simple treatment for patients that may benefit from tr...  
WO/2019/017321A1
Provided is a gene mutation introduction method comprising: a step for expressing a fusion protein between a sequence-specific DNA cleavage enzyme and a nuclear receptor under control of an expression-inducing promoter; a step for formin...  
WO/2019/013308A1
The purpose of the present invention is to provide a method that, by stabilizing target proteins, enables efficient structural analysis of target proteins that have heretofore been difficult or impossible to analyze structurally. The fol...  
WO/2019/013258A1
The purpose of the present invention is to develop a virus vector, the activity of which is rendered controllable. A virus protein gene derived from an RNA virus is provided in which a gene encoding an optical switch protein is inserted ...  
WO/2019/010533A1
The present invention relates to methods, compositions and kits for the treatment of ocular conditions. In particular, the methods, compositions and kits are particularly useful for, but not limited to, the treatment of ocular conditions...  
WO/2019/013674A1
The invention relates to biotechnology and pharmacy, and specifically to the creation of a multivalent protein structure of a new format on the basis of a plurality of antibody fragments conjugated with a polyethylene glycol molecule and...  
WO/2019/009604A2
The present invention relates to a superparamagnetic gold nanoparticle cluster-protein nanoparticle fusion body for magnetic resonance imaging and magnetic thermotherapy. According to the present invention, a superparamagnetic gold nanop...  
WO/2019/009819A1
The invention refers to a split superantigen, divided into two fragments that by itself do not exhibit biologic activity, only upon dimerization they regain T cell activity. Scope of the invention is a screening method for detection of e...  
WO/2019/006692A1
The present application provides a compound having a structure shown in general formula (I): R1-S1-YEKL-S2-R2 (I). The present application also provides a use of the compound.  
WO/2019/007959A1
The present invention relates to a fusion protein selectively binding collagen and having ectonucleotidase activity. The fusion protein comprises an amino acid sequence of the extracellular domain of glycoprotein VI fused via a first lin...  
WO/2019/006691A1
The present application provides a pharmaceutical composition for treating cerebral hemorrhage. The pharmaceutical composition comprises a peptide containing an amino acid sequence of YEKLLDTEI (SEQ ID NO: 1) or a functional variant ther...  
WO/2019/006989A1
Provided is a multifunctional fusion protein, comprising: a. an extracellular part SIRP α for identifying positive tumor cells CD47; b. an extracellular part PD-1 for identifying positive tumor cells PD-L1; and c. a human IgG1Fc part be...  
WO/2019/006690A1
Provided are a polypeptide pharmaceutically acceptable salt and a pharmaceutical composition thereof, said polypeptide containing an amino acid sequence YEKLLDTEI or functional variants thereof.  
WO/2019/000620A1
Provided is a single-chain antibody ScFv capable of recognizing gp120 on the surface of cells infected with HIV and an application thereof. The antibody is obtained by tandemly linking antibody light chain and heavy chain variable region...  
WO/2019/006374A1
Disclosed herein are partially ordered polypeptides, which include a plurality of disordered domains and a plurality of structured domains. The partially ordered polypeptides may have phase transition behavior and form aggregates at, abo...  
WO/2019/005822A1
Provided herein are compositions, systems, kits, and methods for treating nervous system injuries caused by trauma or neurodegeneration or aging in a subject by administering a CSPG or SOCS3 reduction peptide (CRP and SRP respectively), ...  
WO/2019/004213A1
Provided is technology for using a particular antigen-binding peptide as an intrabody that is intracellularly functioning stably. An intracellularly-stabilised peptide comprising 10–39 amino acids, at least 45% of which are acidic, is ...  
WO/2019/000093A1
Methods and products are described, as well as uses thereof, for example for increasing frataxin expression/levels in a cell, as well as for the treatment or prevention of Friedreich ataxia in a subject suffering therefrom. Such products...  
WO/2018/232491A1
There is described herein compound comprising a mitochondrial targeting portion, a cargo portion including a drug unit, and a linker conjugating the mitochondrial targeting portion and the cargo portion, the linker portion cleavable in a...  
WO/2018/232810A1
Provided are a long-acting polypeptide for lowering blood glucose and regulating lipid and use thereof. The amino acid sequence of the polypeptide is HGEGTFTSDVSSYLEGQAAKEFIAWLVKGRGPGVLGGGCRCIPALDSLTPANED. The polypeptide can be used in ...  
WO/2018/235787A1
This method determines the interaction between a first protein and a second protein by: introducing into cells, or inducing expression in the cells of, a first fusion protein including the first protein and a first tetramer fluorescent p...  
WO/2018/233572A1
Disclosed in the present invention is a cysteine-modified antibody-toxin conjugate. The cysteine-modified antibody-toxin conjugate is characterized in that: the antibody is an antibody in which cysteine is inserted on a fixed point, and ...  
WO/2018/237003A1
Disclosed herein are methods for producing induced T regulatory cells (iTregs), involving contacting naive CD4+CD25- T cells and/or naive CD8+CD25- T cells in vitro with (i) a polypeptide comprising an Ig-C domain from a B7-H4 protein (a...  
WO/2018/231759A1
The present invention relates to compositions and methods for the regulated and controlled expression of proteins. Methods for inducing anti-cancer immune responses in a subject are also provided.  
WO/2018/228442A1
Provided are proteinaceous heterodimers, pharmaceutical compositions, medicaments and/or kits comprising the proteinaceous heterodimers, methods for producing the proteinaceous heterodimers, and uses thereof.  
WO/2018/231733A1
Methods for the treatment of leptomeningeal disease in a pediatric patient. The leptomeningeal disease may be leptomeningeal, disseminated, and/or multicentric disease (LDM) and may be associated with one or more primary CNS tumors or on...  
WO/2018/230257A1
The present invention addresses the problem of providing: a method for modifying an antibody in a specific and simple manner; and others. The present invention relates to: an IgG-binding peptide; an IgG-binding peptide modified with a cr...  
WO/2018/232369A1
The present disclosure is directed to alpha-synuclein (αSyn) peptide immunogen constructs, compositions containing the constructs, antibodies elicited by the constructs, and methods for making and using the constructs and compositions t...  

Matches 1 - 50 out of 22,808