| Document |
Document Title |
|
WO1999063933A9 |
Disclosed are multibinding compounds which are agonists, partial agonists, inverse agonists, partial inverse agonist or antagonists of the GABA receptors, which are involved in neurological disorders. The multibinding compounds of this i...
|
|
WO1999064046A9 |
Disclosed are novel multi-binding compounds (agents) which bind 5-HT>3< receptors. The compounds of this invention comprise a plurality of ligands each of which can bind to such receptors thereby modulating the biological processes/funct...
|
|
WO1999064000A9 |
Novel multi-binding compounds (agents) which bind neurokinin receptors are used to treat disorders in mammals that are mediated by the neurokinin receptors, such as Parkinson's disease, Alzheimer's disease, depression, anxiety, inflammat...
|
|
WO1999063983A9 |
Disclosed are novel multi-binding compounds (agents) which bind to PPAR gamma receptors. The compounds of this invention comprise a plurality of ligands each of which can bind to such receptors thereby modulating the biological processes...
|
|
WO1999064047A9 |
Novel compounds are disclosed, useful as antiviral agents.
|
|
WO1999063932A9 |
Disclosed are multibinding compounds are capable of binding to a 5-HT cell membrane transporter. The multibinding compounds of this invention contain from 2 to 10 ligands covalently attached to one or more linkers. the mltibinding compou...
|
|
WO1999063929A9 |
Disclosed are multibinding compounds which inhibit microsomal triglyceride transferase protein (MTP), a protein which mediates the transfer of lipids during the assembly of lipoproteins and related biomolecules. The multibinding compound...
|
|
WO1999064043A9 |
Disclosed are multibinding compounds which are muscarinic receptor antagonists. The multibinding compounds of this invention containing from 2 to 10 ligands covalently attached to one or more linkers. Each ligand is, independently of eac...
|
|
WO1999064054A9 |
Disclosed are multibinding compounds which inhibit topoisomerases which are essential enzymes in higher encaryotes for DNA replication and repair. The multibinding compounds of this invention containing from 2 to 10 ligands covalently at...
|
|
WO/2000/009653A2 |
A novel procathepsin K crystalline structure is identified. Also disclosed are methods of identifying inhibitors of cathepsin K and methods of designing inhibitors of cathepsin K using structural and physical data based on the crystallog...
|
|
WO/2000/009679A1 |
The invention concerns a method for producing $i(in vitro )recombined polynucleotide sequences from a bank of polynucleotide sequences, characterised in that it comprises the following steps: fragmenting an initial bank of double-strand ...
|
|
WO/2000/006694A2 |
The present invention is related to a compound for the prevention and/or the treatment of allergy consisting of: at least one allergen antigenic determinant which is recognised by a B cell or an antibody secreted by a B cell of a non-ato...
|
|
WO/2000/005249A2 |
The invention provides heteropolymer compositions and peptide compositions, and methods of making and using therapeutic compositions comprising amino acid heteropolymers for treatment of a subject for an autoimmune or an inflammatory dis...
|
|
WO/2000/001706A1 |
The invention concerns peptide derivatives useful as N-terminal site selective inhibitor of the human angiotensin conversion enzyme. Said derivatives comprise the amino acid sequence of the following formula: -Asp-Phe-$g(c)(PO¿2?CH¿2?)...
|
|
WO/1999/064042A1 |
Disclosed are novel multi-binding compounds (agents) which bind alpha-1A adrenergic receptors. The compounds of this invention comprise a plurality of ligands each of which can bind to such receptors thereby modulating the biological pro...
|
|
WO/1999/063996A1 |
Disclosed are multibinding compounds which are agonists, partial agonists, inverse agonists or antagonists of the 5HT¿2? receptors, which are involved in neurological disorders. The multibinding compounds of this invention containing fr...
|
|
WO/1999/064040A1 |
Novel multibinding compounds are disclosed. The compounds of the invention comprise 2-10 polyene macrolide antibiotic ligands covalently connected, each of said ligands being capable of binding to a ligand binding site in a cellular or v...
|
|
WO/1999/064051A1 |
Novel multibinding compounds are disclosed. The compounds of the invention comprise from 2-10 ligands covalently connected, each of said ligands being capable of inhibiting bacterial Type II DNA topoisomerase, thereby modulating the biol...
|
|
WO/1999/064052A1 |
This invention relates to novel multibinding compounds that bind to leukotriene receptors and inhibit their activity. In particular, cysteinal leukotriene receptor antagonists and, most particularly leukotriene D¿4? receptor antagonist ...
|
|
WO/1999/063944A2 |
Disclosed are novel multi-binding compounds (agents) which bind estrogen receptors. The compounds of this invention comprise a plurality of ligands each of which can bind to such receptors thereby modulating the biological processes/func...
|
|
WO/1999/064044A1 |
Novel multibinding compounds are disclosed. The compounds of the invention comprise from 2-10 ligands covalently connected, each of said ligands being capable of binding to a 5-HT receptor, thereby modulating the biological processes/fun...
|
|
WO/1999/063940A2 |
Disclosed are multibinding compounds which inhibit H?+¿/K?+¿-ATPase, an enzyme which is involved in the control of acid secretion in the stomach. The multibinding compounds of this invention containing from 2 to 10 ligands covalently a...
|
|
WO/1999/064037A1 |
Novel multi-binding compounds are disclosed that modulate enzymatic processes. The compounds of the invention comprise from 2-10 ligands covalently connected, each of said ligands being capable of binding to an enzyme, enzyme substrate o...
|
|
WO/1999/063993A1 |
Disclosed are multibinding compounds which are agonists, partial agonists, inverse agonists or antagonists of the D¿1? receptors, preferably, agonists of the D¿1? receptors, which are involved in neurological disorders. The multibindin...
|
|
WO/1999/063999A1 |
This invention relates to novel multibinding compounds (agents) that are H1-histamine receptor antagonists and pharmaceutical compositions comprising such compounds. Accordingly, the multibinding compounds and pharmaceutical compositions...
|
|
WO/1999/063984A1 |
The compounds of this invention comprise 2 - 10 ligands covalently connected, each of the ligands being capable of binding to a ligand binding site in an Na?+¿ channel, thereby modulating the biological activities thereof.
|
|
WO/1999/063930A2 |
This invention relates to novel multibinding compounds that bind to angiotensin (AT) receptors and modulate their activity. The compounds of this invention comprise 2-10 AT receptor ligands covalently connected by a linker or linkers, wh...
|
|
WO/1999/064053A1 |
The present invention is directed to multibinding compounds which are $g(b)3-adrenergic receptor agonists and are therefore useful in the treatment and prevention of metabolic disorders such as obesity, diabetes, and the like.
|
|
WO/1999/064032A1 |
Disclosed are methods for synthesizing large collections of diverse multimeric compounds as well as iterative processes for evaluating key molecular constraints imparting multibinding properties to multimeric compounds. Also disclosed ar...
|
|
WO/1999/062563A2 |
Breast and/or prostate cancer is diagnosed and/or treated with a radiolabeled peptide or peptidomimetic that binds to GRP (Gastrin Releasing Peptide) receptors.
|
|
WO/1999/059560A1 |
The invention provides methods and compounds for modulating the number of GLUT4 sorting vesicle resident molecules on the surface of a cell. The invention also provides methods of treating NIDDM in a subject. Methods of evaluating compou...
|
|
WO/1999/055900A2 |
The invention provides gcp polypeptides and polynucleotides encoding gcp polypeptides and methods for producing such polypeptides by recombinant techniques. Also provided are methods for utilizing gcp polypeptides to screen for antibacte...
|
|
WO/1999/050664A1 |
The invention provides a method based upon the two hybrid system for examining the interactions of nuclear receptors. The invention is additionally directed to compositions for use in the assay and a method of identifying ligands of nucl...
|
|
WO/1999/050657A1 |
Signaling pathways dependent on members of the corticotropin releasing factor (CRF) gene family exert pleiotropic effects within both the brain and peripheral tissues. Two biochemically and pharmacologically distinct corticotropin releas...
|
|
WO/1999/047253A1 |
The invention refers to a new process for preparing coated particles and hollow shells by coating colloidal particles with alternating layers of oppositely charged nanoparticles and polyelectrolytes and optionally removing the colloidal ...
|
|
WO1999023236A9 |
Disclosed is a method of producing random polynucleotides by introducing two or more related polynucleotides into a suitable host cell such that a hybrid polynucleotide is generated by recombination and reductive reassortment. Also provi...
|
|
WO/1999/041612A1 |
The present invention provides methods and compositions for screening, diagnosis and prognosis of hepatoma, for monitoring the effectiveness of hepatoma treatment, and for drug development. Hepatoma-Diagnostic Features (HFs), detectable ...
|
|
WO1998033901A9 |
The invention concerns gene banks and combinatorial derivatives thereof, prepared using phagemid- or phage-display in combination with type IIS restriction enzymes and cosmid packaging; their use for the isolation of ligands, including e...
|
|
WO/1999/012959A1 |
The present invention relates to the field of carbohydrate crosslinked glycoprotein crystals. Advantageously, such crosslinked glycoprotein crystals display stability to harsh environmental conditions, while maintaining the structural an...
|
|
WO/1999/011283A1 |
The present invention provides for a method for treating a subject suffering from a condition associated with an extracellular zinc sphingomyelinase activity which comprises administering to the subject an amount of a zinc sphingomyelina...
|
|
WO/1999/010527A2 |
The invention relates to a method for isolating anionic organic substances from aqueous systems using polymer nanoparticles with cationic pH-sensitive surface groups. Extraction can be carried out directly from diluted solutions, biologi...
|
|
WO/1999/001940A1 |
Using a whole byte to represent a monomer in a biological sequence is not the most efficient means of permanent storage. The invention relates to the compression of biological sequence data for electronic storage by utilising a sub-byte ...
|
|
WO/1998/058967A1 |
This invention describes self assembled monolayers (SAMs) manufactured by imprinting reactive peptides onto solid supports. The invention further relates to methods of preparing and using these improved SAMs.
|
|
WO/1998/028434A1 |
Oligopeptides are ligated to form ligation peptide products. In the first step, two starting oligopeptides are ligated to form an intermediate having an aminothioester linkage. In the second step, the aminothioester linkage undergoes a r...
|
|
WO/1998/020023A1 |
The present invention relates generally to therapeutic and diagnostic agents. More particularly, the present invention provides therapeutic molecules capable of modulating signal transduction such as but not limited to cytokine-mediated ...
|
|
WO/1998/011129A1 |
This invention is directed to novel (N-substituted)indole ICE/ced-3-inhibitor compounds. The invention is also directed to pharmaceutical compositions of such indole compounds, plus the use of such compositions in the treatment of patien...
|
|
WO/1998/011204A1 |
Purified and recombinant proteins TPC2 and TPC3 and recombinant or synthetic oligonucleotides corresponding to those proteins or fragments thereof can be used to detect regulators of telomere length and telomerase activity in mammalian c...
|
|
WO/1998/007036A1 |
A process is disclosed for determining the status of an organism by measuring peptides in a sample of the organism which contains high-molecular and low-molecular peptides and acts as an indicator of the organism status. Low-molecular pe...
|
|
WO/1998/005348A1 |
This invention relates to amino acid sequences from within a consensus peptide of the formula: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (Seq. #1). Eight mer peptides from within the consensus peptide were tested against an antibody raised to...
|
|
WO/1998/001581A1 |
Disclosed is a process of performing 'Sexual' PCR which includes generating random polynucleotides by interrupting or blocking a synthesis or amplification process to show or halt synthesis or amplification of at least one polynucleotide...
|
