Login| Sign Up| Help| Contact|

Patent Searching and Data


Matches 701 - 750 out of 1,562

Document Document Title
WO/1999/064043A1
Disclosed are multibinding compounds which are muscarinic receptor antagonists. The multibinding compounds of this invention containing from 2 to 10 ligands covalently attached to one or more linkers. Each ligand is, independently of eac...  
WO/1999/064053A1
The present invention is directed to multibinding compounds which are $g(b)3-adrenergic receptor agonists and are therefore useful in the treatment and prevention of metabolic disorders such as obesity, diabetes, and the like.  
WO/1999/064032A1
Disclosed are methods for synthesizing large collections of diverse multimeric compounds as well as iterative processes for evaluating key molecular constraints imparting multibinding properties to multimeric compounds. Also disclosed ar...  
WO/1999/064033A1
This invention relates to novel multibinding compounds that bind to the enzyme phosphodiesterase V (PDE V) and modulate its activity. The compounds of this invention comprise 2-10 PDE V modulator (particularly inhibitor) ligands covalent...  
WO/1999/063936A2
Novel multi-binding compounds (agents) which bind endothelin receptors are used to treat disorders affecting the cardiovascular, renal, endocrine and nervous systems in mammals that are mediated by the endothelin receptors, such as conge...  
WO/1999/063988A1
Disclosed are multibinding compounds which inhibit nitric oxide synthases (NOSs), enzymes which form nitric oxide and L-citrulline from L-arginine. The multibinding compounds of this invention contain from 2 to 10 ligands covalently atta...  
WO/1999/064035A1
Disclosed are multibinding compounds which are $g(b)2-adrenergic receptor agonists and are useful in the treatment and prevention of respiratory diseases such as asthma, bronchitis. They are also useful in the treatment of nervous system...  
WO/1999/063937A2
Disclosed are multibinding compounds which include macrolide antibiotics, aminoglycosides, lincosamides, oxazolidinones, streptogramins, tetracycline and/or other compounds which bind to bacterial ribosomal RNA and/or to one or more prot...  
WO/1999/062563A2
Breast and/or prostate cancer is diagnosed and/or treated with a radiolabeled peptide or peptidomimetic that binds to GRP (Gastrin Releasing Peptide) receptors.  
WO/1999/059560A1
The invention provides methods and compounds for modulating the number of GLUT4 sorting vesicle resident molecules on the surface of a cell. The invention also provides methods of treating NIDDM in a subject. Methods of evaluating compou...  
WO/1999/055900A2
The invention provides gcp polypeptides and polynucleotides encoding gcp polypeptides and methods for producing such polypeptides by recombinant techniques. Also provided are methods for utilizing gcp polypeptides to screen for antibacte...  
WO/1999/050664A1
The invention provides a method based upon the two hybrid system for examining the interactions of nuclear receptors. The invention is additionally directed to compositions for use in the assay and a method of identifying ligands of nucl...  
WO/1999/050657A1
Signaling pathways dependent on members of the corticotropin releasing factor (CRF) gene family exert pleiotropic effects within both the brain and peripheral tissues. Two biochemically and pharmacologically distinct corticotropin releas...  
WO/1999/047253A1
The invention refers to a new process for preparing coated particles and hollow shells by coating colloidal particles with alternating layers of oppositely charged nanoparticles and polyelectrolytes and optionally removing the colloidal ...  
WO1999023236A9
Disclosed is a method of producing random polynucleotides by introducing two or more related polynucleotides into a suitable host cell such that a hybrid polynucleotide is generated by recombination and reductive reassortment. Also provi...  
WO/1999/041612A1
The present invention provides methods and compositions for screening, diagnosis and prognosis of hepatoma, for monitoring the effectiveness of hepatoma treatment, and for drug development. Hepatoma-Diagnostic Features (HFs), detectable ...  
WO1998033901A9
The invention concerns gene banks and combinatorial derivatives thereof, prepared using phagemid- or phage-display in combination with type IIS restriction enzymes and cosmid packaging; their use for the isolation of ligands, including e...  
WO1998033901A3
The invention concerns gene banks and combinatorial derivatives thereof, prepared using phagemid- or phage-display in combination with type IIS restriction enzymes and cosmid packaging; their use for the isolation of ligands, including e...  
WO1999010527A3
The invention relates to a method for isolating anionic organic substances from aqueous systems using polymer nanoparticles with cationic pH-sensitive surface groups. Extraction can be carried out directly from diluted solutions, biologi...  
WO/1999/023236A1
Disclosed is a method of producing random polynucleotides by introducing two or more related polynucleotides into a suitable host cell such that a hybrid polynucleotide is generated by recombination and reductive reassortment. Also provi...  
WO/1999/012959A1
The present invention relates to the field of carbohydrate crosslinked glycoprotein crystals. Advantageously, such crosslinked glycoprotein crystals display stability to harsh environmental conditions, while maintaining the structural an...  
WO/1999/011283A1
The present invention provides for a method for treating a subject suffering from a condition associated with an extracellular zinc sphingomyelinase activity which comprises administering to the subject an amount of a zinc sphingomyelina...  
WO/1999/010527A2
The invention relates to a method for isolating anionic organic substances from aqueous systems using polymer nanoparticles with cationic pH-sensitive surface groups. Extraction can be carried out directly from diluted solutions, biologi...  
WO/1999/001940A1
Using a whole byte to represent a monomer in a biological sequence is not the most efficient means of permanent storage. The invention relates to the compression of biological sequence data for electronic storage by utilising a sub-byte ...  
WO/1998/058967A1
This invention describes self assembled monolayers (SAMs) manufactured by imprinting reactive peptides onto solid supports. The invention further relates to methods of preparing and using these improved SAMs.  
WO/1998/033901A2
The invention concerns gene banks and combinatorial derivatives thereof, prepared using phagemid- or phage-display in combination with type IIS restriction enzymes and cosmid packaging; their use for the isolation of ligands, including e...  
WO/1998/028434A1
Oligopeptides are ligated to form ligation peptide products. In the first step, two starting oligopeptides are ligated to form an intermediate having an aminothioester linkage. In the second step, the aminothioester linkage undergoes a r...  
WO/1998/020023A1
The present invention relates generally to therapeutic and diagnostic agents. More particularly, the present invention provides therapeutic molecules capable of modulating signal transduction such as but not limited to cytokine-mediated ...  
WO/1998/011129A1
This invention is directed to novel (N-substituted)indole ICE/ced-3-inhibitor compounds. The invention is also directed to pharmaceutical compositions of such indole compounds, plus the use of such compositions in the treatment of patien...  
WO/1998/011204A1
Purified and recombinant proteins TPC2 and TPC3 and recombinant or synthetic oligonucleotides corresponding to those proteins or fragments thereof can be used to detect regulators of telomere length and telomerase activity in mammalian c...  
WO1997046259A3
The present invention relates particularly to neoplastic cells targeted chimeric toxins comprising of cell targeting moieties and cell killing moieties for recognizing and for destroying the neoplastic cells, wherein the cell targeting m...  
WO/1998/007036A1
A process is disclosed for determining the status of an organism by measuring peptides in a sample of the organism which contains high-molecular and low-molecular peptides and acts as an indicator of the organism status. Low-molecular pe...  
WO/1998/005348A1
This invention relates to amino acid sequences from within a consensus peptide of the formula: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (Seq. #1). Eight mer peptides from within the consensus peptide were tested against an antibody raised to...  
WO/1998/001581A1
Disclosed is a process of performing 'Sexual' PCR which includes generating random polynucleotides by interrupting or blocking a synthesis or amplification process to show or halt synthesis or amplification of at least one polynucleotide...  
WO/1997/046259A2
The present invention relates particularly to neoplastic cells targeted chimeric toxins comprising of cell targeting moieties and cell killing moieties for recognizing and for destroying the neoplastic cells, wherein the cell targeting m...  
WO/1997/042500A1
The present invention is a method for ranking the affinity of each of a multiplicity of different molecules for a target molecule which is capable of denaturing due to a thermal change. The method comprises contacting the target molecule...  
WO/1997/038703A1
Disclosed is a chimeric isoprenoid synthase polypeptide including a first domain from a first isoprenoid synthase joined to a second domain from a second, heterologous isoprenoid synthase, whereby the chimeric isoprenoid synthase is capa...  
WO/1997/037995A1
The present invention provides calixpyrrole, calixpyridinopyrrole, and calixpyridine macrocycles, having 4, 5, 6, 7, or 8 heterocyclic rings, as well as syntheses, derivatives, conjugates, multimers, and solid supports thereof. Such macr...  
WO/1997/035009A1
The present invention relates to methods and materials for the recombinant microbial production of fusion proteins and peptides derived from or based on Domain I (amino acids 17-45), Domain II (amino acids 65-99) and Domain III (amino ac...  
WO/1997/033174A1
The instant invention is directed to a single, selectively N-alkylated compound and libraries of such compounds as set forth in Formula (I). Furthermore, the instant invention is directed to methods of effecting analgesia, a decrease in ...  
WO/1997/021431A1
The invention relates to cobalt compounds in which divalent or trivalent cobalt is complexed with water soluble tetradentate Schiff's bases. The tetradentate Schiff's bases preferably contain two nitrogen atoms and two oxygen atoms as co...  
WO/1997/019194A1
This invention provides a method for determining whether a compound is capable of suppressing ras functions comprising: (a) contacting an effective amount of the compound with Ha-ras transformed cloned rat embryo fibroblast cells under c...  
WO/1997/016542A1
This invention relates to the PrtR-PrtK cell surface protein of Porphyromonas gingivalis and in particular a multimeric cell associated protein complex comprising the PrtR and PrtK proteins. Accordingly the invention provides a substanti...  
WO/1997/011090A1
Anti-angiogenic protein composition can be prepared simply and efficiently by contacting cartilage particles containing the protein together with an electrolyte solution and an oligosaccharide bearing a minimum number of anionic substitu...  
WO/1997/010828A1
Disclosed are methods of therapy applicable to pathologies that involve loss of integrity of tissue and organ membranes that lead to abnormal permeation of proteinic and other agents and their elimination or penetration of other anatomic...  
WO/1997/007232A1
The present invention relates to antigenic preparations comprising polysaccharides and/or glycopeptides preparable from keratinophilic fungi as well as yeasts, processes for the preparation of these antigenic preparations, their use as p...  
WO/1996/031220A1
The present invention provides polyanionic, substituted CDs having cellular growth modulating activity. The invention further provides CDs having anionic groups on one side of the CD molecule. Therapeutic methods for using as well as met...  
WO/1996/030514A1
Compounds and compositions for eliciting or enhancing immune reactivity to HER-2/neu protein are disclosed. The compounds include polypeptides and nucleic acid molecules encoding such peptides. The compounds may be used for the preventio...  
WO/1996/010634A1
Disclosed and claimed are methods for the isolation and use of stem cell inhibiting factors for regulating the abnormal stem cell cycle and for accelerating the post-chemotherapy peripheral blood cell recovery. Also disclosed and claimed...  
WO/1996/005218A1
The present invention provides a method for introducing nucleic acids into cells. The method involves exposing the cells to a compound having formula (1), in which w is a nucleic acid, x is a peptide or amino acid, y is a linker having a...  

Matches 701 - 750 out of 1,562