| Document |
Document Title |
|
JP4657721B2 |
A method for preparing a grafted homodetic cyclopeptide forming a framework that defines a grafted upper face and grafted lower face, including synthesizing a linear peptide from modified or unmodified amino acids, some of which carry or...
|
|
JP4656728B2 |
A negatively-charged Staphylococcus antigen contains amino acids and a N-acetylated hexosamine as a major carbohydrate component. The antigen is common to many coagulase-negative strains of Staphylococcus, including S. epidermidis, S. ha...
|
|
JP4655298B1 |
The present invention provides a cationic polyamino acid suitable for a carrier that can form a stable complex with a nucleic acid under a physiological condition and release the nucleic acid in cells suitably. The cationic polyamino aci...
|
|
JP2011506497A |
Also the use of RhoC and immunogenic peptide fragments hereof in cancer treatment, diagnosis and prognosis is provided.
|
|
JP2011019518A |
To provide the Moraxella catarrhalis outer membrane protein polypeptide and polypeptides derived therefrom (collectively "OMP21"), nucleotide sequences encoding the OMP21, and antibodies that specifically bind the OMP21.There are provide...
|
|
JP2010535788A |
The invention relates to peptides derivatized with a hydrophilic polymer which, in some embodiments, bind to human FcRn and inhibit binding of the Fc portion of an IgG to an FcRn, thereby modulating serum IgG levels. The disclosed compos...
|
|
JP4559023B2 |
A method of enzymatically producing a protein hydrolysate from a protein substrate is described, wherein a proline-specific endoprotease or a composition containing a proline-specific endoprotease and optionally a subtilisin or a metallo...
|
|
JP4549862B2 |
This invention relates to the use of amine, amino acid and amino acid ester mobile modifiers in normal phase chromatography to improve the resolution and or productivity of peptide and lipopeptide purification. This chromatographic metho...
|
|
JP4547558B2 |
|
|
JP4532486B2 |
The present invention provides novel naturally-processed MHC class II antigenic peptides; which originate from interferon-gamma-inducible lysosomal thiol reductase, integrin beta-2, phosphatitylinositol-4,5-bisphosphate 3-kinase, urokina...
|
|
JP2010164581A |
To make easy diagnosis and disease activity monitoring, at human immunological states and immunological diseases, hematological diseases and blood disease, and inflammatory state and inflammatory disease. The present invention relates to...
|
|
JP4510147B2 |
Compounds and compositions for eliciting or enhancing immune reactivity to HER-2/neu protein are disclosed. The compounds include polypeptides and nucleic acid molecules encoding such peptides. The compounds may be used for the preventio...
|
|
JP4489582B2 |
Specific peptides have been discovered that mimic an idiotype of an autoantibody. Such peptides may be formed into polymers. The peptides may be used in pharmaceutical compositions for the treatment of an autoimmune disease together with...
|
|
JP2010131017A |
To provide an immunogenic composition comprising a glucan and a pharmaceutically acceptable carrier, characterized in that, when administered to a mammalian recipient, the composition elicits protective anti-glucan antibodies but does no...
|
|
JP4484968B2 |
This invention relates to amino acid sequences from within a consensus peptide of the formula: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (Seq. #1). Eight mer peptides from within the consensus peptide were tested against an antibody raised to...
|
|
JP4456596B2 |
We have discovered epitopes of the HCV viral proteins which are immunoreactive with immune serum. The epitopes are useful in immunodiagnostic assays and as immunogens.
|
|
JP4456595B2 |
We have discovered epitopes of the HCV viral proteins which are immunoreactive with immune serum. The epitopes are useful in immunodiagnostic assays and as immunogens.
|
|
JP4452312B2 |
The present invention provides peptides which affect T cells, presumably by action on the T-cell antigen receptors. The present invention further relates to the therapy of various inflammatory and autoimmune disease states involving the ...
|
|
JP4414900B2 |
The invention relates to an immunoglobulin characterized in that it comprises two heavy polypeptide chains sufficient for the formation of a complete antigen binding site or several antigen binding sites, this immunoglobulin being furthe...
|
|
JP4409287B2 |
A method for measuring heterodimerization of HIV RT, which comprises the steps of:a) providing a first solution comprising p66 subunit homodimers in the presence of a dissociation agent; b) contacting the first solution with p51 RT subun...
|
|
JP2010502201A |
This invention relates to novel nucleotide-based compounds, methods of making radiolabeled compounds and use of such compounds for diagnostic imaging. Provided are compounds according to Formula (I) A - B - L - C , wherein A stands for a...
|
|
JP2009280590A |
To provide new multibinding compounds (agents) which react quickly and are 2-adrenergic receptor agonists having increased effects and/or longer acting duration, and to provide medicinal compositions comprising the compounds.The multibin...
|
|
JP2009279003A |
To provide polynucleotide and polypeptide useful for prophylaxis, diagnosis and/or therapy.Provided are SMC-1 gene and SMC-2 gene comprising a specific sequence of Moraxella catarrhalis, vectors containing the nucleotide, and hosts trans...
|
|
JP2009280608A |
To provide isolated immunoglobulins each comprising two heavy polypeptide chains sufficient for the formation of a complete antigen binding site or several antigen binding sites, wherein the immunoglobulin is further devoid of light poly...
|
|
JP4348402B2 |
Described is a method for the preparation of a mixture of peptides having a cysteine content between 7-20 w/w % from a protein source, comprising cysteine containing proteins, comprising the steps of: a) cleaving the proteins of the prot...
|
|
JP4345338B2 |
|
|
JP4344728B2 |
Described is a method for the preparation of a mixture of peptides, having an arginine and lysine content of at least 20 w/w %, based on the protein content, from at least one protein source, to a preparation comprising a mixture of argi...
|
|
JP4340544B2 |
A kit of parts comprising two or more protein kinase substrate polypeptides, each said substrate polypeptide comprising a specificity conferring portion (which is different for each said kinase substrate polypeptide) and a phosphorylatab...
|
|
JP4324610B2 |
Polypeptides that are cleared from the kidney and do not contain in their original form a Fc region of an IgG are altered so as to comprise a salvage receptor binding epitope of an Fc region of an IgG and thereby have increased circulato...
|
|
JP4312054B2 |
The present invention relates to biologically active peptides derived from the neurite outgrowth-promoting domain of laminin-1, i.e. the γ1-chain of laminin-1. These peptides include the decapeptide RDIAEIIKDI (SEQ ID NO: 1) and the tru...
|
|
JP4294693B2 |
The present invention provides peptides which affect T cells, presumably by action on the T-cell antigen receptors. The present invention further relates to the therapy of various inflammatory and autoimmune disease states involving the ...
|
|
JP4282934B2 |
A composition which elicits antibodies to multiple known variants of Tat protein of HIV-1 of both the B and non-B clades contains the peptide R1-Asp-Pro-Asn-Leu-Asp-Pro-Trp-Asn-R2 SEQ ID NO: 23, and preferably an additional at least two ...
|
|
JP4278293B2 |
A composition which elicits antibodies to greater than 95%, and even greater than 99%, of the known variants of HIV-1 Tat protein contains at least one peptide or polypeptide of the formula of Epitope I (based on amino acids 2-10 of HIV-...
|
|
JP4267043B2 |
To provide a method for simply evaluating acetylation level of a peptide, to provide enzyme activity measurement base on the method, and to provide a method for screening an enzyme inhibitor. Acetylation of a peptide level is decided by ...
|
|
JP2009084285A |
To provide a reliable diagnostic and prognostic means, a vaccine for prevention and/or treatment of the disease, and an immunotherapeutic remedy.A polypeptide containing a newly characterized HCV epitope, a method for producing such a po...
|
|
JP4257030B2 |
Peptides comprising the amino acid sequence set forth in SEQ ID NO:1 are described wherein the amino acid at position 7 of SEQ ID NO:1 and the amino acid at position 8 of SEQ ID NO:1, which may be the same or different, is each a neutral...
|
|
JP2009060877A |
To enable an intracellular protein encoded by a solid culture-specific gene to be expressed in a liquid culture to facilitate the extraction by identifying a transcription regulatory gene enabling the solid culture-specific gene to be ex...
|
|
JP2009007339A |
To provide an adhesive for dental implants, reinforcing bondability of the dental implants with biological tissues, especially, soft tissues such as gingival epithelium.The adhesive for dental implants comprises a cell adhesive artificia...
|
|
JPWO2006134752A1 |
An object of the present invention is to obtain a composition that efficiently absorbs branched-chain amino acids using soybean protein as a raw material. The soybean protein is treated with two or more different types of enzymes from am...
|
|
JP2009001582A |
To provide a method of treatment of inflammatory, pre-cancerous or cancerous tissue or polyp in a mammalian subject.The treatment involves administration of a composition of at least one peptide agonist of a guanylate cyclase receptor an...
|
|
JP4205227B2 |
In a method of purifying whey separated from lactic acid fermentation liquid by electrodialysis wherein said whey contains angiotensin-converting enzyme inhibiting peptides, the improvement which comprises using an anion exchange membran...
|
|
JP2008228701A |
To provide a new immunotoxin cell target method capable of transiently inhibiting the function of a target cell, and to provide a means therefor.The recombinant protein contains a variable region polypeptide of an antibody selectively re...
|
|
JP4156671B2 |
The present invention provides peptides which affect T cells, presumably by action on the T-cell antigen receptors. The present invention further relates to the therapy of various inflammatory and autoimmune disease states involving the ...
|
|
JP2008208079A |
To provide a cross-linking agent getting information on an electrostatic environment in the vicinity of a cross-linked position in the topological analysis of between protein molecules and a protein complex material.This reagent set for ...
|
|
JP2008534594A |
The present invention relates to compositions comprising proteins or polynucleotides of Chlamydia sp., in particular combinations of proteins or polynucleotides encoding them, and methods for the use of the proteins or polynucleotides in...
|
|
JP4132665B2 |
The antibiotic TKR2999 having the physicochemical properties described below and its pharmacologically acceptable salt: (1) FAB-MS m/z 971 ÄM+HÜ<+>, (2) the molecular formula: C44H78N10O14, and high-resolution FAB-MS m/z 971.5776 ÄM+H...
|
|
JP4119248B2 |
A method of enzymatically producing a protein hydrolysate from a protein substrate is described, wherein a proline-specific endoprotease or a composition containing a proline-specific endoprotease and optionally a subtilisin or a metallo...
|
|
JP4088344B2 |
Novel peptides that are capable of binding to uPAR and inhibiting the binding of an integrin and vitronectin are described. Also provided are nucleic acid sequences encoding the novel peptides. Methods for screening for small molecules, ...
|
|
JP2008109934A |
To provide a new peptide binding to uPAR and inhibiting the binding of an integrin and a vitronectin, and a nucleic acid sequence encoding the peptide.There provided are a new peptide binding to uPAR and inhibiting the binding of an inte...
|
|
JP2008512986A |
The invention relates to a method of improving the immunogenicity of an immunogen, antigen or hapten, by means of coupling with a small support peptide. More specifically, the invention relates to a method of preparing an immunogenic com...
|
