Login| Sign Up| Help| Contact|

Patent Searching and Data


Title:
ANTI-EpCAM ANTIBODIES, COMPOSITIONS COMPRISING ANTI-EpCAM ANTIBODIES AND METHODS OF MAKING AND USING ANTI-EpCAM ANTIBODIES
Document Type and Number:
WIPO Patent Application WO/2017/023704
Kind Code:
A1
Abstract:
Provided herein are antibodies that selectively bind to EpCAM and its isoforms and homologs, and compositions comprising the antibodies. Also provided are methods of using the antibodies, such as therapeutic and diagnostic methods.

More Like This:
JP2022515250Improved cell-targeted binding molecule
JP5148804Immunomimetic methods and pharmaceutical compositions that are particularly useful in the treatment of cancer
JP3081208Title of Invention Antigen Recognized by MCA16-88
Inventors:
STAFFORD RYAN (US)
YAM ALICE (US)
LEE JOHN (US)
ARMSTRONG STEPHANIE (US)
SATO AARON (US)
Application Number:
PCT/US2016/044564
Publication Date:
February 09, 2017
Filing Date:
July 28, 2016
Export Citation:
Click for automatic bibliography generation   Help
Assignee:
SUTRO BIOPHARMA INC (US)
International Classes:
C07K16/30
Domestic Patent References:
WO2004106383A12004-12-09
WO2015048901A12015-04-09
WO2010115629A22010-10-14
WO2010142990A12010-12-16
WO2008122551A22008-10-16
WO2013131001A12013-09-06
Other References:
MÜNZ MARKUS ET AL: "Side-by-side analysis of five clinically tested anti-EpCAM monoclonal antibodies", CANCER CELL INTERNATIONAL, BIOMED CENTRAL, LONDON, GB, vol. 10, no. 1, 2 November 2010 (2010-11-02), pages 44, XP021077267, ISSN: 1475-2867, DOI: 10.1186/1475-2867-10-44
P RUF ET AL: "Characterisation of the new EpCAM-specific antibody HO-3: implications for trifunctional antibody immunotherapy of cancer", BRITISH JOURNAL OF CANCER, vol. 97, no. 3, 31 July 2007 (2007-07-31), pages 315 - 321, XP055011283, ISSN: 0007-0920, DOI: 10.1038/sj.bjc.6603881
SCHNELL ULRIKE ET AL: "EpCAM: structure and function in health and disease.", BIOCHIMICA ET BIOPHYSICA ACTA AUG 2013, vol. 1828, no. 8, August 2013 (2013-08-01), pages 1989 - 2001, XP002762424, ISSN: 0006-3002
Attorney, Agent or Firm:
PATHAK, Rahul et al. (US)
Download PDF:
View/Download PDF      PDF Help
Claims:
WHAT IS CLAIMED IS:

1. An isolated antibody that specifically binds to human EpCAM, wherein the antibody comprises a CDR-H3 sequence selected from: a. a sequence defined by the consensus sequence ai-W-a3-a -Q-a6- 7-Y-a9-aio-

D-Y, where ai is G, A, or D; o¾ is H or N; 04 is P, D, or R; ο½ is T, S, or D; a7 is L, M, or Y; 019 is D, G, H, or N; and a10 is L, Q, R, or V; b. a sequence defined by the consensus sequence L-R-N-W-Bs-Be-P-M-D-Y, where B¾ is E or D; and Ββ is G or M; and c. a sequence selected from SEQ ID NOs: 104 and 108-128, or a variant thereof having three, two, or one amino acid substitution(s).

2. The antibody of claim 1, wherein the CDR-H3 sequence is a sequence selected from SEQ ID NOs: 104-128.

3. The antibody of any of claims 1 or 2, wherein the antibody comprises a Chothia CDR- H2 sequence selected from: a. a sequence defined by the consensus sequence 8i-G-83-8 -G-86, where Si is D, A, or G; 83 is G, H, or S; 84 is E, D, V, G, or Q; and εβ is S, Y, or N; and b. a sequence selected from SEQ ID NOs: 54-78, or a variant thereof having two or one amino acid substitutions(s).

4. The antibody of claim 3, wherein the Chothia CDR-H2 sequence is a sequence

selected from SEQ ID NOs: 54-78.

5. The antibody of any of the preceding claims, wherein the antibody comprises a

Chothia CDR-H1 sequence selected from: a. a sequence defined by the consensus sequence G-F-T-F-y5-Y6-Y7, where γ¾ is S, R, G, or C; γ6 is G, V, A, or S; and γ7 is S, T, A, C, E, or F; b. a sequence defined by the consensus sequence δι-Υ-Α-Ρ-δί- -δγ, where δι is G or D; 85 is A or T; and 87 is R or S; and c. a sequence selected from SEQ ID NOs: 4-28, or a variant thereof having two or one amino acid substitutions(s).

6. The antibody of claim 5, wherein the Chothia CDR-Hl sequence is a sequence selected from SEQ ID NOs: 4-28.

7. The antibody of any of the preceding claims, wherein the antibody comprises a Kabat CDR-H2 sequence selected from: a. a sequence defined by the consensus sequence Α-Ι-θ3-0-θ5-θ6-0-θ8-Τ-θιο-Υ-

A-D-S-V-916-e17, where θ3 is D, A, or G; θ5 is G, H, or S; θ6 is E, D, V, G, or Q; 6g is S, Y, or N; θ10 is G, A, N, or S; θ16 is K or R; and θ17 is G or D; b. a sequence selected from SEQ ID NOs: 79-103, or a variant thereof having three, two, or one amino acid substitutions(s).

8. The antibody of claim 7, wherein the Kabat CDR-H2 sequence is a sequence selected from SEQ ID NOs: 79-103.

9. The antibody of any of the preceding claims, wherein the antibody comprises a Kabat CDR-Hl sequence selected from: a. a sequence defined by the consensus sequence ζι-ζι-S-M-S, where ζ1 is G, V, A, or S; and ζ2 is S, T, A, C, E, or F; b. a sequence defined by the consensus sequence Ν-ηι-W-L-G, where η2 is R or S. c. a sequence selected from SEQ ID NOs: 29-53, or a variant thereof having two or one amino acid substitutions.

10. The antibody of claim 9, wherein the Kabat CDR-Hl sequence is a sequence selected from SEQ ID NOs: 29-53.

11. The antibody of any of the preceding claims, wherein the antibody comprises a CDR- L3 sequence selected from: a. a sequence defined by the consensus sequence Q-Q-13-1 -15-I6-P-I8-T, where 13 is L, D, H, N, R, T, V, or Y; i4 is V, A, L, Q, S, E, F, M, or W; i5 is T, A, P, S, E, F, N, or Y; i6 is S, A, I, N, G, K, P, R, or V; and i8 is P or A; b. a sequence defined by the consensus sequence Q-N-D-K4-K5-Y-P-L-T, where K4 is L, S, or Y; and κ5 is S or R; and c. a sequence selected from SEQ ID NOs: 179-203, or a variant thereof having three, two, or one amino acid substitution(s).

12. The antibody of claim 11, wherein the CDR-L3 sequence is a sequence selected from SEQ ID NOs: 179-203.

13. The antibody of any of the preceding claims, wherein the antibody comprises a CDR- L2 sequence selected from: a. a sequence defined by the consensus sequence λι-Α-S-T-R-E-S, where λ1 is W or R; b. a sequence selected from SEQ ID NOs: 154-178, or a variant thereof having two or one amino acid substitution(s).

14. The antibody of claim 13, wherein the CDR-L2 sequence is a sequence selected from SEQ ID NOs: 154-178.

15. The antibody of any of the preceding claims, wherein the antibody comprises a CDR- Ll sequence selected from: a. a sequence defined by the consensus sequence μι-Α-8-0-μ5-μ6-μ7-μ8-μ9-μιο- μπ-Α, where μι is R or S; μ¾ is S, V, G, T, K, N, P, or R; μβ is V, L, C, D, G, or I; μ7 is S, P, A, H, K, or T; μ8 is S, T, N, or P; μ9 is S, G, N, R, or T; μ10 is Y, S, V, D, K, or T; and μη is L, M, or I; b. a sequence selected from SEQ ID NOs: 129-153, or a variant thereof having three, two, or one amino acid substitution(s).

16. The antibody of claim 15, wherein the CDR-Ll sequence is a sequence selected from SEQ ID NOs: 129-153.

17. An isolated antibody that specifically binds to human EpCAM, wherein the antibody comprises a CDR-L3 sequence selected from: a. a sequence defined by the consensus sequence Q-Q-13-1 -15-I6-P-I8-T, where 13 is L, D, H, N, R, T, V, or Y; i4 is V, A, L, Q, S, E, F, M, or W; i5 is T, A, P, S, E, F, N, or Y; i6 is S, A, I, N, G, K, P, R, or V; and i8 is P or A; b. a sequence defined by the consensus sequence Q-N-D-K4-K5-Y-P-L-T, where K4 is L, S, or Y; and κ5 is S or R; where if κ4 is Y, then κ5 is not S; c. a sequence selected from SEQ ID NOs: 179 and 183-203, or a variant thereof having three, two, or one amino acid substitution(s); and d. a sequence selected from SEQ ID NOs: 180-182.

18. The antibody of claim 17, wherein the CDR-L3 sequence is a sequence selected from SEQ ID NOs: 179 and 183-203.

19. The antibody of any of claims 17-18, wherein the antibody comprises a CDR-L2 sequence selected from: a. a sequence defined by the consensus sequence λι-Α-S-T-R-E-S, where λ1 is W or R; b. a sequence selected from SEQ ID NOs: 154-178, or a variant thereof having two or one amino acid substitution(s).

20. The antibody of claim 19, wherein the CDR-L2 sequence is a sequence selected from SEQ ID NOs: 154-178.

21. The antibody of any of claims 17-20, wherein the antibody comprises a CDR-Ll sequence selected from: a. a sequence defined by the consensus sequence μι-Α-8-0-μ5-μ6-μ7-μ8-μ9-μιο- μπ-Α, where μι is R or S; μ¾ is S, V, G, T, K, N, P, or R; μβ is V, L, C, D, G, or I; μ7 is S, P, A, H, K, or T; μ8 is S, T, N, or P; μ9 is S, G, N, R, or T; μ10 is Y, S, V, D, K, or T; and μη is L, M, or I; b. a sequence selected from SEQ ID NOs: 129-153, or a variant thereof having three, two, or one amino acid substitution(s).

22. The antibody of claim 21, wherein the CDR-Ll sequence is a sequence selected from SEQ ID NOs: 129-153.

23. An isolated antibody that specifically binds to EpCAM, wherein the antibody

comprises: a. a VH comprising: a CDR-H1 comprising one or more of SEQ ID NOs: 4 and 29; a CDR-H2 comprising one or more of SEQ ID NOs: 54 and 79; and a CDR-H3 comprising SEQ ID NO: 104; b. a VH comprising: a CDR-Hl comprising one or more of SEQ ID NOs: 5 and 30; a CDR-H2 comprising one or more of SEQ ID NOs: 55 and 80; and a CDR-H3 comprising SEQ ID NO: 105; c. a VH comprising: a CDR-Hl comprising one or more of SEQ ID NOs: 6 and 31 ; a CDR-H2 comprising one or more of SEQ ID NOs: 56 and 81 ; and a CDR-H3 comprising SEQ ID NO: 106; d. a VH comprising: a CDR-Hl comprising one or more of SEQ ID NOs: 7 and 32; a CDR-H2 comprising one or more of SEQ ID NOs: 57 and 82; and a CDR-H3 comprising SEQ ID NO: 107; e. a VH comprising: a CDR-Hl comprising one or more of SEQ ID NOs: 8 and 33; a CDR-H2 comprising one or more of SEQ ID NOs: 58 and 83; and a CDR-H3 comprising SEQ ID NO: 108; f. a VH comprising: a CDR-Hl comprising one or more of SEQ ID NOs: 9 and 34; a CDR-H2 comprising one or more of SEQ ID NOs: 59 and 84; and a CDR-H3 comprising SEQ ID NO: 109; g. a VH comprising: a CDR-Hl comprising one or more of SEQ ID NOs: 10 and 35; a CDR-H2 comprising one or more of SEQ ID NOs: 60 and 85; and a CDR-H3 comprising SEQ ID NO: 110; h. a VH comprising: a CDR-Hl comprising one or more of SEQ ID NOs: 11 and 36; a CDR-H2 comprising one or more of SEQ ID NOs: 61 and 86; and a CDR-H3 comprising SEQ ID NO: 111; i. a VH comprising: a CDR-Hl comprising one or more of SEQ ID NOs: 12 and 37; a CDR-H2 comprising one or more of SEQ ID NOs: 62 and 87; and a CDR-H3 comprising SEQ ID NO: 112; j. a VH comprising: a CDR-Hl comprising one or more of SEQ ID NOs: 13 and 38; a CDR-H2 comprising one or more of SEQ ID NOs: 63 and 88; and a CDR-H3 comprising SEQ ID NO: 113; k. a VH comprising: a CDR-Hl comprising one or more of SEQ ID NOs: 14 and 39; a CDR-H2 comprising one or more of SEQ ID NOs: 64 and 89; and a CDR-H3 comprising SEQ ID NO: 114;

1. a VH comprising: a CDR-Hl comprising one or more of SEQ ID NOs: 15 and 40; a CDR-H2 comprising one or more of SEQ ID NOs: 65 and 90; and a CDR-H3 comprising SEQ ID NO: 115; m. a VH comprising: a CDR-Hl comprising one or more of SEQ ID NOs: 16 and 41 ; a CDR-H2 comprising one or more of SEQ ID NOs: 66 and 91 ; and a CDR-H3 comprising SEQ ID NO: 116; n. a VH comprising: a CDR-Hl comprising one or more of SEQ ID NOs: 17 and 42; a CDR-H2 comprising one or more of SEQ ID NOs: 67 and 92; and a CDR-H3 comprising SEQ ID NO: 117; o. a VH comprising: a CDR-Hl comprising one or more of SEQ ID NOs: 18 and 43; a CDR-H2 comprising one or more of SEQ ID NOs: 68 and 93; and a CDR-H3 comprising SEQ ID NO: 118; p. a VH comprising: a CDR-Hl comprising one or more of SEQ ID NOs: 19 and 44; a CDR-H2 comprising one or more of SEQ ID NOs: 69 and 94; and a CDR-H3 comprising SEQ ID NO: 119; q. a VH comprising: a CDR-Hl comprising one or more of SEQ ID NOs: 20 and 45; a CDR-H2 comprising one or more of SEQ ID NOs: 70 and 95; and a CDR-H3 comprising SEQ ID NO: 120; r. a VH comprising: a CDR-Hl comprising one or more of SEQ ID NOs: 21 and 46; a CDR-H2 comprising one or more of SEQ ID NOs: 71 and 96; and a CDR-H3 comprising SEQ ID NO: 121; s. a VH comprising: a CDR-Hl comprising one or more of SEQ ID NOs: 22 and 47; a CDR-H2 comprising one or more of SEQ ID NOs: 72 and 97; and a CDR-H3 comprising SEQ ID NO: 122; t. a VH comprising: a CDR-Hl comprising one or more of SEQ ID NOs: 23 and 48; a CDR-H2 comprising one or more of SEQ ID NOs: 73 and 98; and a CDR-H3 comprising SEQ ID NO: 123; u. a VH comprising: a CDR-Hl comprising one or more of SEQ ID NOs: 24 and 49; a CDR-H2 comprising one or more of SEQ ID NOs: 74 and 99; and a CDR-H3 comprising SEQ ID NO: 124; v. a VH comprising: a CDR-Hl comprising one or more of SEQ ID NOs: 25 and 50; a CDR-H2 comprising one or more of SEQ ID NOs: 75 and 100; and a CDR-H3 comprising SEQ ID NO: 125; w. a VH comprising: a CDR-Hl comprising one or more of SEQ ID NOs: 26 and 51 ; a CDR-H2 comprising one or more of SEQ ID NOs: 76 and 101 ; and a CDR-H3 comprising SEQ ID NO: 126; x. a VH comprising: a CDR-Hl comprising one or more of SEQ ID NOs: 27 and 52; a CDR-H2 comprising one or more of SEQ ID NOs: 77 and 102; and a CDR-H3 comprising SEQ ID NO: 127; or y. a VH comprising: a CDR-Hl comprising one or more of SEQ ID NOs: 28 and 53; a CDR-H2 comprising one or more of SEQ ID NOs: 78 and 103; and a CDR-H3 comprising SEQ ID NO: 128.

24. The antibody of claim 23, wherein the VH is selected from SEQ ID NOs: 229-253.

25. An isolated antibody that specifically binds to EpCAM, wherein the antibody

comprises: a. a VL comprising: a CDR-L1 comprising SEQ ID NO: 129; a CDR-L2

comprising SEQ ID NO: 154; and a CDR-L3 comprising SEQ ID NO: 179; b. a VL comprising: a CDR-L1 comprising SEQ ID NO: 130; a CDR-L2

comprising SEQ ID NO: 155; and a CDR-L3 comprising SEQ ID NO: 180; c. a VL comprising: a CDR-L1 comprising SEQ ID NO: 131; a CDR-L2

comprising SEQ ID NO: 156; and a CDR-L3 comprising SEQ ID NO: 181; d. a VL comprising: a CDR-L1 comprising SEQ ID NO: 132; a CDR-L2

comprising SEQ ID NO: 157; and a CDR-L3 comprising SEQ ID NO: 182; e. a VL comprising: a CDR-L1 comprising SEQ ID NO: 133; a CDR-L2

comprising SEQ ID NO: 158; and a CDR-L3 comprising SEQ ID NO: 183; f. a VL comprising: a CDR-L1 comprising SEQ ID NO: 134; a CDR-L2

comprising SEQ ID NO: 159; and a CDR-L3 comprising SEQ ID NO: 184; g. a VL comprising: a CDR-L1 comprising SEQ ID NO: 135; a CDR-L2

comprising SEQ ID NO: 160; and a CDR-L3 comprising SEQ ID NO: 185; h. a VL comprising: a CDR-L1 comprising SEQ ID NO: 136; a CDR-L2 comprising SEQ ID NO: 161; and a CDR-L3 comprising SEQ ID NO: 186; i. a VL comprising: a CDR-L1 comprising SEQ ID NO: 137; a CDR-L2

comprising SEQ ID NO: 162; and a CDR-L3 comprising SEQ ID NO: 187; j. a VL comprising: a CDR-L1 comprising SEQ ID NO: 138; a CDR-L2

comprising SEQ ID NO: 163; and a CDR-L3 comprising SEQ ID NO: 188; k. a VL comprising: a CDR-L1 comprising SEQ ID NO: 139; a CDR-L2

comprising SEQ ID NO: 164; and a CDR-L3 comprising SEQ ID NO: 189;

1. a VL comprising: a CDR-L1 comprising SEQ ID NO: 140; a CDR-L2

comprising SEQ ID NO: 165; and a CDR-L3 comprising SEQ ID NO: 190; m. a VL comprising: a CDR-L1 comprising SEQ ID NO: 141; a CDR-L2

comprising SEQ ID NO: 166; and a CDR-L3 comprising SEQ ID NO: 191; n. a VL comprising: a CDR-L1 comprising SEQ ID NO: 142; a CDR-L2

comprising SEQ ID NO: 167; and a CDR-L3 comprising SEQ ID NO: 192; o. a VL comprising: a CDR-L1 comprising SEQ ID NO: 143; a CDR-L2

comprising SEQ ID NO: 168; and a CDR-L3 comprising SEQ ID NO: 193; p. a VL comprising, a CDR-L 1 comprising SEQ ID NO. 144; a CDR-L2

comprising SEQ ID NO: 169; and a CDR-L3 comprising SEQ ID NO: 194; q. a VL comprising: a CDR-L1 comprising SEQ ID NO: 145; a CDR-L2

comprising SEQ ID NO: 170; and a CDR-L3 comprising SEQ ID NO: 195; r. a VL comprising: a CDR-L 1 comprising SEQ ID NO: 146; a CDR-L2

comprising SEQ ID NO: 171; and a CDR-L3 comprising SEQ ID NO: 196; s. a VL comprising: a CDR-L1 comprising SEQ ID NO: 147; a CDR-L2

comprising SEQ ID NO: 172; and a CDR-L3 comprising SEQ ID NO: 197; t. a VL comprising: a CDR-L1 comprising SEQ ID NO: 148; a CDR-L2

comprising SEQ ID NO: 173; and a CDR-L3 comprising SEQ ID NO: 198; u. a VL comprising: a CDR-L1 comprising SEQ ID NO: 149; a CDR-L2

comprising SEQ ID NO: 174; and a CDR-L3 comprising SEQ ID NO: 199; v. a VL comprising: a CDR-L1 comprising SEQ ID NO: 150; a CDR-L2 comprising SEQ ID NO: 175; and a CDR-L3 comprising SEQ ID NO: 200; w. a VL comprising: a CDR-L1 comprising SEQ ID NO: 151; a CDR-L2

comprising SEQ ID NO: 176; and a CDR-L3 comprising SEQ ID NO: 201; x. a VL comprising: a CDR-L1 comprising SEQ ID NO: 152; a CDR-L2

comprising SEQ ID NO: 177; and a CDR-L3 comprising SEQ ID NO: 202; or y. a VL comprising: a CDR-L1 comprising SEQ ID NO: 153; a CDR-L2

comprising SEQ ID NO: 178; and a CDR-L3 comprising SEQ ID NO: 203.

26. The antibody of claim 25 wherein the VL sequence is selected from SEQ ID NOs:

254-278.

27. An isolated antibody that specifically binds to EpCAM, wherein the antibody

comprises a VH region selected from the group consisting of: a. SEQ ID NOs: 229 and 233-253, or a variant thereof having 20 or fewer amino acid substitutions; and b. SEQ ID NOs: 230-232, or a variant thereof having 1 amino acid substitution.

28. An isolated antibody that specifically binds to EpCAM, wherein the antibody

comprises a VL region selected from the group consisting of: a. SEQ ID NOs: 254 and 258-278, or a variant thereof having 20 or fewer amino acid substitutions; and b. SEQ ID NOs: 255-257.

29. An antibody comprising:

(i) the VH region selected from the group consisting of: a. SEQ ID NOs: 229 and 233-253, or a variant thereof having 20 or fewer amino acid substitutions; and b. SEQ ID NOs: 230-232, or a variant thereof having 1 amino acid substitution; and

(ii) the VL region selected from the group consisting of: a. SEQ ID NOs: 254 and 258-278, or a variant thereof having 20 or fewer amino acid substitutions; and b. SEQ ID NOs: 255-257. 30. The antibody of claim 29, wherein: a. the VH region is SEQ ID NO: 229, or the variant thereof, and the VL region is SEQ ID NO: 254, or the variant thereof; b. the VH region is SEQ ID NO: 230 and the VL region is SEQ ID NO: 255; c. the VH region is SEQ ID NO: 231 and the VL region is SEQ ID NO: 256; d. the VH region is SEQ ID NO: 232 and the VL region is SEQ ID NO: 257; e. the VH region is SEQ ID NO: 233, or the variant thereof, and the VL region is SEQ ID NO: 258, or the variant thereof; f. the VH region is SEQ ID NO: 234, or the variant thereof, and the VL region is SEQ ID NO: 259, or the variant thereof; g. the VH region is SEQ ID NO: 235, or the variant thereof, and the VL region is SEQ ID NO: 260, or the variant thereof; h. the VH region is SEQ ID NO: 236, or the variant thereof, and the VL region is SEQ ID NO: 261 , or the variant thereof; i. the VH region is SEQ ID NO: 237, or the variant thereof, and the VL region is SEQ ID NO: 262, or the variant thereof; j . the VH region is SEQ ID NO: 238, or the variant thereof, and the VL region is SEQ ID NO: 263, or the variant thereof; k. the VH region is SEQ ID NO: 239, or the variant thereof, and the VL region is SEQ ID NO: 264, or the variant thereof;

1. the VH region is SEQ ID NO: 240, or the variant thereof, and the VL region is SEQ ID NO: 265, or the variant thereof; m. the VH region is SEQ ID NO: 241, or the variant thereof, and the VL region is SEQ ID NO: 266, or the variant thereof; n. the VH region is SEQ ID NO: 242, or the variant thereof, and the VL region is SEQ ID NO: 267, or the variant thereof; o. the VH region is SEQ ID NO: 243, or the variant thereof, and the VL region is SEQ ID NO: 268, or the variant thereof; p. the VH region is SEQ ID NO: 244, or the variant thereof, and the VL region is SEQ ID NO: 269, or the variant thereof; q. the VH region is SEQ ID NO: 245, or the variant thereof, and the VL region is SEQ ID NO: 270, or the variant thereof; r. the VH region is SEQ ID NO: 246, or the variant thereof, and the VL region is SEQ ID NO: 271 , or the variant thereof; s. the VH region is SEQ ID NO: 247, or the variant thereof, and the VL region is SEQ ID NO: 272, or the variant thereof; t. the VH region is SEQ ID NO: 248, or the variant thereof, and the VL region is SEQ ID NO: 273, or the variant thereof; u. the VH region is SEQ ID NO: 249, or the variant thereof, and the VL region is SEQ ID NO: 274, or the variant thereof; v. the VH region is SEQ ID NO: 250, or the variant thereof, and the VL region is SEQ ID NO: 275, or the variant thereof; w. the VH region is SEQ ID NO: 251, or the variant thereof, and the VL region is SEQ ID NO: 276, or the variant thereof; x. the VH region is SEQ ID NO: 252, or the variant thereof, and the VL region is SEQ ID NO: 277, or the variant thereof; or y. the VH region is SEQ ID NO: 253, or the variant thereof, and the VL region is SEQ ID NO: 278, or the variant thereof.

31. The antibody of any of claims 1 , 3, 5, 7, 9, 11 , 13, 15, 17, 19, 21 , or 27-30, wherein the amino acid substitution is a conservative amino acid substitution.

32. An isolated antibody that specifically binds to EpCAM, wherein the antibody binds to the same epitope as a second antibody selected from: a. an antibody with aV„ of SEQ ID NO: 229 and aVL of SEQ ID NO: 254; b. an antibody with aVH of SEQ ID NO: 233 and aVL of SEQ ID NO: 258; c. an antibody with aV„ of SEQ ID NO: 234 and aVL of SEQ ID NO: 259; d. an antibody with aV„ of SEQ ID NO: 235 and aVL of SEQ ID NO: 260; e. an antibody with aV„ of SEQ ID NO: 236 and aVL of SEQ ID NO: 261; f. an antibody with aVH of SEQ ID NO: 237 and aVL of SEQ ID NO: 262; g- an antibody with aVH of SEQ ID NO: 238 and aVL of SEQ ID NO: 263; h. an antibody with aVH of SEQ ID NO: 239 and aVL of SEQ ID NO: 264; i. an antibody with aVH of SEQ ID NO: 240 and aVL of SEQ ID NO: 265;

J- an antibody with aVH of SEQ ID NO: 241 and aVL of SEQ ID NO: 266; k. an antibody with aVH of SEQ ID NO: 242 and aVL of SEQ ID NO: 267;

1. an antibody with aVH of SEQ ID NO: 243 and aVL of SEQ ID NO: 268; m. an antibody with aVH of SEQ ID NO: 244 and aVL of SEQ ID NO: 269; n. an antibody with aVH of SEQ ID NO: 245 and aVL of SEQ ID NO: 270;

0. an antibody with aVH of SEQ ID NO: 246 and aVL of SEQ ID NO: 271;

P- an antibody with aVH of SEQ ID NO: 247 and aVL of SEQ ID NO: 272; q- an antibody with aVH of SEQ ID NO: 248 and aVL of SEQ ID NO: 273; r. an antibody with aVH of SEQ ID NO: 249 and aVL of SEQ ID NO: 274; s. an antibody with aVH of SEQ ID NO: 250 and aVL of SEQ ID NO: 275; t. an antibody with aV„ of SEQ ID NO: 251 and aVL of SEQ ID NO: 276; u. an antibody with aVH of SEQ ID NO: 252 and aVL of SEQ ID NO: 277; and

V. an antibody with aVH of SEQ ID NO: 253 and aVL of SEQ ID NO: 278.

33. The antibody of claim 32, wherein the isolated antibody inhibits binding of the second antibody to the EpCAM by at least 50%. or wherein the second antibody inhibits binding of the isolated antibody to the EpCAM by at least 50%.

34. The antibody of any of the preceding claims, wherein the antibody comprises at least one constant region domain.

35. The antibody of claim 34, wherein the constant region comprises a sequence selected from SEQ ID NOs: 279, 281 , or 282.

36. The antibody of any of the preceding claims, wherein the antibody is a monoclonal antibody.

37. The antibody of any of the preceding claims, wherein the antibody is an IgA, an IgD, an IgE, an IgG, or an IgM.

38. The antibody of any of the preceding claims, wherein the antibody is humanized or human.

39. The antibody of any of the preceding claims, wherein the antibody is aglycosylated.

40. The antibody of any of the preceding claims, wherein the antibody is an antibody fragment.

41. The antibody of claim 40, wherein the antibody fragment is selected from an Fv fragment, a Fab fragment, a F(ab')2 fragment, a Fab' fragment, an scFv (sFv) fragment, and an scFv-Fc fragment.

42. The antibody of claim 41 , wherein the antibody is an scFv fragment.

43. The antibody of claim 42, wherein the scFv fragment comprises a sequence selected from SEQ ID NOs: 337-361 , with or without the N-terminal M residue.

44. The antibody of claim 41 , wherein the antibody is an scFv-Fc fragment.

45. The antibody of claim 44, wherein the scFv-Fc fragment comprises a sequence

selected from SEQ ID NOs: 204-228, with or without the N-terminal M residue.

46. The antibody of any of the preceding claims, wherein the antibody has a ka of about 6.52x l04 M^ xsec"1 to about 3.51 x l05 M^xsec"1 when associating with human EpCAM at a temperature of 25 °C.

47. The antibody of any of the preceding claims, wherein the antibody has a !¾ of about 1.75 x l0"3 sec"1 to about 1.74x l0"5 sec"1 when dissociating from human EpCAM at a temperature of 25°C.

48. The antibody of any of the preceding claims, wherein the antibody has a KD of about 7.21 10"9 M to about 1.93 x 10"10 M when bound to human EpCAM at a temperature of 25°C.

49. The antibody of any of the preceding claims, wherein the antibody specifically binds cynomolgus EpCAM.

50. The antibody of claim 49, wherein the antibody has a KD of about 1.62* 10"7 M to about 1.17x 10"9 M when bound to cynomolgus EpCAM at a temperature of 25°C.

51. The antibody of claim 50, wherein the ratio of KD for human EpCAM to KD for cynomolgus EpCAM is about 0.029 to about 6.162.

52. A kit comprising an antibody of any of the preceding claims, and instructions for use of the antibody.

53. The kit of claim 52, wherein the antibody is lyophilized.

54. The kit of claim 53, further comprising a fluid for reconstitution of the lyophilized antibody.

55. A polynucleotide encoding an antibody of any of claims 1 to 51.

56. A vector comprising the polynucleotide of claim 55.

57. A recombinant host cell comprising the vector of claim 56.

58. The host cell of claim 57, wherein the host cell is selected from a bacterial cell, a fungal cell, and a mammalian cell.

59. The host cell of claim 57, wherein the host cell is selected from an E. coli cell, a Saccharomyces cerevisiae cell, and a CHO cell.

60. A cell-free expression reaction comprising the vector of claim 56.

61. A pharmaceutical composition comprising the antibody of any of claims 1 to 51 and a pharmaceutically acceptable carrier.

62. A method of treating or preventing a disease or condition in a subject in need thereof, comprising administering to the subject an effective amount of an antibody of any of claims 1 to 51, or a pharmaceutical composition of claim 61.

63. A method of diagnosing a disease or condition in a subject in need thereof, comprising administering to the subject an effective amount of an antibody of any of claims 1 to 51 , or a pharmaceutical composition of claim 61.

64. The method of any of claims 62 to 63, wherein the disease or condition is a cancer.
Description:
ANTI-EpCAM ANTIBODIES, COMPOSITIONS COMPRISING ANTI-EpCAM ANTIBODIES AND METHODS OF MAKING AND USING ANTI-EpCAM ANTIBODIES

FIELD

[0001] Provided herein are antibodies with binding specificity for epithelial cell adhesion molecule (EpCAM) and compositions comprising the antibodies, including pharmaceutical compositions, diagnostic compositions, and kits. Also provided are methods of making anti-EpCAM antibodies, and methods of using anti-EpCAM antibodies, for example, for therapeutic, diagnostic purposes, and research purposes.

BACKGROUND

[0002] EpCAM is a type I transmembrane glycoprotein that mediates calcium- independent homotypic epithelial cell-cell adhesion. See Litvinov et al, J. Cell. Biol, 1994, 125:437-446, incorporated by reference in its entirety. EpCAM is also involved in cell signaling, migration, proliferation, and differentiation. See Maetzel et al., Nature Cell Biol , 2009, 11 : 162-171 ; Osta et al, Cancer Res. , 2004, 64:5818-5824; and Litvinov et al, Am. J. Pathol. , 1996, 148:865-875, each of which is incorporated by reference in its entirety.

[0003] EpCAM has oncogenic potential via its capacity to upregulate at least c-Myc,

E-FABP, and cyclins A and E. See Munz et al, Oncogene, 2004, 23:5748-5758, incorporated by reference in its entirety. Because EpCAM is expressed exclusively in epithelia and epithelial-derived neoplasms, it can be used as diagnostic marker for some cancers. It may also be a useful prognostic marker for certain tumor types. See Munz et al, Cancer Res. , 2009, 69:5627-5629 and Baeuerle and Gires, Br. J. Cancer, 2007, 96:417-423, each of which is incorporated by reference in its entirety.

[0004] EpCAM is known to be overexpressed in some cancers, and therefore represents a potential target for cancer therapy. See Osta et al, supra.; Haisma et al, Gene Therapy, 1999, 6: 1469-1474; Heideman et al, Cancer Gene Ther., 2001, 8:342-351; and Seimetz et al, Cancer Treatment Reviews, 2010, 36:458-467, each of which is incorporated by reference in its entirety. Most known EpCAM antibodies bind an epitope encoded by EpCAM exon 2. See Miinz et al., Cancer Cell Int. , 2010, 10:44. One known EpCAM antibody, adecatumumab, binds outside exon 2 at an epitope encoded by EpCAM exon 5. See id. However, adecatumumab does not have significant binding affinity for cynomolgus EpCAM. See id. Cynomolgous cross-reactivity is advantageous because it facilitates evaluation of the potential toxicity of antibodies in a primate model, without exposing human subjects to molecules of unknown toxicity.

[0005] There is a need for targeted delivery of therapeutics to tumor cells in a manner that provides a localized therapeutic effect while minimizing or eliminating systemic side- effects. More particularly, in light of the overexpression of EpCAM in various cancers, there is a need for therapeutics that specifically target cancer cells over expressing EpCAM. Particulalry advantageous therapeutics would bind epitopes outside those encoded by exon 2 of EpCAM and would cross-react with cynomolgus EpCAM.

SUMMARY

[0006] Provided herein are antibodies that specifically bind to EpCAM. In some embodiments, the antibodies bind human EpCAM. In some embodiments, the antibodies also bind homologs of human EpCAM. In some aspects, the homolog is a cynomolgus monkey homolog. In some aspects, the antibodies do not bind a murine homolog. In some embodiments, the antibodies bind to human EpCAM and a cynomolgus monkey homolog, but not a murine homolog.

[0007] In some embodiments, the antibodies comprise at least one CDR sequence defined by a consensus sequence provided in this disclosure. In some embodiments, the antibodies comprise an illustrative CDR, VH, or VL sequence provided in this disclosure, or a variant thereof. In some aspects, the variant is a variant with one or more conservative amino acid substitutions.

[0008] Also provided are compositions comprising the antibodies. In some embodiments, the composition is a pharmaceutical composition. In some embodiments, the pharmaceutical composition is for the treatment or diagnosis of a disease or condition, as described further elsewhere in this disclosure. In some embodiments, the pharmaceutical composition is a composition for parenteral administration.

[0009] This disclosure also provides methods of making the anti-EpCAM antibodies provided herein. The antibodies can be made, for example, in any suitable cell or organism. The antibodies can also be made in a cell-free reaction mixture.

[0010] Also provided are methods of using the anti-EpCAM antibodies provided herein. In some embodiments, the method of use is a method of treatment. In some embodiments, the method of use is a diagnostic method. In some embodiments, the method of use is an analytical method. In some embodiments, the method of use is a method of purifying and/or quantifying EpCAM.

[0011] In some embodiments, the antibodies are used to treat a disease or condition.

In some aspects, the disease or condition is a cancer.

BRIEF DESCRIPTION OF THE DRAWINGS

[0012] FIG. 1 (A-C) provides an alignment of the "1304," "1464," and "1557" V H sequences provided herein.

[0013] FIG. 2 (A, B) provides an alignment of the "1332" VH sequences provided herein.

[0014] FIG. 3 (A, B) provides an alignment of the "1304," "1464," and "1557" V L sequences provided herein.

[0015] FIG. 4 (A, B) provides an alignment of the "1332" VL sequences provided herein.

DETAILED DESCRIPTION

1. Definitions

[0016] Unless otherwise defined, all terms of art, notations and other scientific terminology used herein are intended to have the meanings commonly understood by those of skill in the art to which this invention pertains. In some cases, terms with commonly understood meanings are defined herein for clarity and/or for ready reference, and the inclusion of such definitions herein should not necessarily be construed to represent a difference over what is generally understood in the art. The techniques and procedures described or referenced herein are generally well understood and commonly employed using conventional methodologies by those skilled in the art, such as, for example, the widely utilized molecular cloning methodologies described in Sambrook et al, Molecular Cloning: A Laboratory Manual 2nd ed. (1989) Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY. As appropriate, procedures involving the use of commercially available kits and reagents are generally carried out in accordance with manufacturer-defined protocols and conditions unless otherwise noted. [0017] As used herein, the singular forms "a," "an," and "the" include the plural referents unless the context clearly indicates otherwise.

[0018] The term "about" indicates and encompasses an indicated value and a range above and below that value. In certain embodiments, the term "about" indicates the designated value ± 10%, ± 5%, or ± 1%. In certain embodiments, the term "about" indicates the designated value ± one standard deviation of that value.

[0019] The term "combinations thereof includes every possible combination of elements to which the term refers to. For example, a sentence stating that "if ο¾ is A, then o¾ is not D; a$ is not S; or ο¾ is not S; or combinations thereof includes the following combinations when ο¾ is A: (1) o¾ is not D; (2) a¾ is not S; (3) ο½ is not S; (4) o¾ is not D; a¾ is not S; and ο½ is not S; (5) o¾ is not D and a¾ is not S; (6) o¾ is not D and (¾ is not S; and (7) a¾ is not S and Oe is not S.

[0020] The terms "EpCAM" and "EpCAM antigen" are used interchangeably herein.

EpCAM is also known by a variety of synonyms, including CD326, Ep-CAM, 17-1A, HEA125, MK-1, GA733-2, EGP-2, EGP34, KSA, TROP-1, ESA, and KS 1/4, among others. Unless specified otherwise, the terms include any variants, isoforms and species homologs of human EpCAM that are naturally expressed by cells, or that are expressed by cells transfected with an EpCAM gene. EpCAM proteins include, for example, human EpCAM (GI: 15928632; SEQ ID NO: 1). In some embodiments, EpCAM proteins include cynomolgus monkey EpCAM (GI: 544483249; SEQ ID NO: 2). In some embodiments, EpCAM proteins include murine EpCAM (GI: 112293275; SEQ ID NO: 3). However, as discussed in detail elsewhere in this disclosure, in some embodiments the antibodies provided herein do not bind murine EpCAM proteins. The antibodies provided herein bind to an extracellular domain of EpCAM.

[0021] The term "immunoglobulin" refers to a class of structurally related proteins generally comprising two pairs of polypeptide chains: one pair of light (L) chains and one pair of heavy (H) chains. In an "intact immunoglobulin," all four of these chains are interconnected by disulfide bonds. The structure of immunoglobulins has been well characterized. See, e.g., Paul, Fundamental Immunology 7th ed., Ch. 5 (2013) Lippincott Williams & Wilkins, Philadelphia, PA. Briefly, each heavy chain typically comprises a heavy chain variable region (VH ) and a heavy chain constant region (CH). The heavy chain constant region typically comprises three domains, abbreviated CHI, CH2, and CH3- Each light chain typically comprises a light chain variable region (V L ) and a light chain constant region. The light chain constant region typically comprises one domain, abbreviated CL.

[0022] The term "antibody" describes a type of immunoglobulin molecule and is used herein in its broadest sense. An antibody specifically includes intact antibodies (e.g., intact immunoglobulins), and antibody fragments. Antibodies comprise at least one antigen-binding domain. One example of an antigen-binding domain is an antigen binding domain formed by a V H -V l dimer. An "EpCAM antibody," "anti-EpCAM antibody," "EpCAM Ab," "EpCAM-specific antibody" or "anti-EpCAM Ab" is an antibody, as described herein, which binds specifically to the antigen EpCAM. In some embodiments, the antibody binds the extracellular domain of EpCAM.

[0023] The VH and VL regions may be further subdivided into regions of hypervariability ("hypervariable regions (HVRs);" also called "complementarity determining regions" (CDRs)) interspersed with regions that are more conserved. The more conserved regions are called framework regions (FRs). Each VH and VL generally comprises three CDRs and four FRs, arranged in the following order (from N-terminus to C-terminus): FR1 - CDR1 - FR2 - CDR2 - FR3 - CDR3 - FR4. The CDRs are involved in antigen binding, and influence antigen specificity and binding affinity of the antibody. See Kabat et al, Sequences of Proteins of Immunological Interest 5th ed. (1991) Public Health Service, National Institutes of Health, Bethesda, MD, incorporated by reference in its entirety.

[0024] The light chain from any vertebrate species can be assigned to one of two types, called kappa and lambda, based on the sequence of the constant domain.

[0025] The heavy chain from any vertebrate species can be assigned to one of five different classes (or isotypes): IgA, IgD, IgE, IgG, and IgM. These classes are also designated α, δ, ε, γ, and μ, respectively. The IgG and IgA classes are further divided into subclasses on the basis of differences in sequence and function. Humans express the following subclasses: IgGl, IgG2, IgG3, IgG4, IgAl, and IgA2.

[0026] The amino acid sequence boundaries of a CDR can be determined by one of skill in the art using any of a number of known numbering schemes, including those described by Kabat et al, supra ("Kabat" numbering scheme); Al-Lazikani et al, 1997, J. Mol. Biol , 273:927-948 ("Chothia" numbering scheme); MacCallum et al, 1996, J. Mol. Biol. 262:732-745 ("Contact" numbering scheme); Lefranc et al, Dev. Comp. Immunol , 2003, 27:55-77 ("IMGT" numbering scheme); and Honegge and Pluckthun, J. Mol. Biol , 2001, 309:657-70 ("AHo" numbering scheme), each of which is incorporated by reference in its entirety.

[0027] Table 1 provides the positions of CDR-L1, CDR-L2, CDR-L3, CDR-H1,

CDR-H2, and CDR-H3 as identified by the Kabat and Chothia schemes. For CDR-H1, residue numbering is provided using both the Kabat and Chothia numbering schemes.

[0028] Unless otherwise specified, the numbering scheme used for identification of a particular CDR herein is the Kabat/Chothia numbering scheme. Where the residues encompassed by these two numbering schemes diverge (e.g., CDR-H1 and/or CDR-H2), the numbering scheme is specified as either Kabat or Chothia. For convenience, CDR-H3 is sometimes referred to herein as either Kabat or Chothia. However, this is not intended to imply differences in sequence where they do not exist, and one of skill in the art can readily confirm whether the sequences are the same or different by examining the sequences.

[0029] CDRs may be assigned, for example, using antibody numbering software, such as Abnum, available at http://www.bioinf.org.uk/abs/abnum/, and described in Abhinandan and Martin, Immunology, 2008, 45:3832-3839, incorporated by reference in its entirety.

Table 1. Residues in CDRs according to Kabat and Chothia numbering schemes.

between H32 and H34, depending on the length of the CDR, as illustrated in FIG. 1.

[0030] The "EU numbering scheme" is generally used when referring to a residue in an antibody heavy chain constant region (e.g., as reported in Kabat et al., supra). Unless stated otherwise, the EU numbering scheme is used to refer to residues in antibody heavy chain constant regions described herein.

[0031] An "antibody fragment" comprises a portion of an intact antibody, such as the antigen binding or variable region of an intact antibody. Antibody fragments include, for example, Fv fragments, Fab fragments, F(ab')2 fragments, Fab' fragments, scFv (sFv) fragments, and scFv-Fc fragments.

[0032] "Fv" fragments comprise a non-covalently-linked dimer of one heavy chain variable domain and one light chain variable domain.

[0033] "Fab" fragments comprise, in addition to the heavy and light chain variable domains, the constant domain of the light chain and the first constant domain (CHI) of the heavy chain. Fab fragments may be generated, for example, by recombinant methods or by papain digestion of a full-length antibody.

[0034] "F(ab')2" fragments contain two Fab' fragments joined, near the hinge region, by disulfide bonds. F(ab')2 fragments may be generated, for example, by recombinant methods or by pepsin digestion of an intact antibody. The F(ab') fragments can be dissociated, for example, by treatment with β-mercaptoethanol.

[0035] "Single-chain Fv" or "sFv" or "scFv" antibody fragments comprise a VH domain and a VL domain in a single polypeptide chain. The VH and VL are generally linked by a peptide linker. See Pliickthun A. (1994). In some embodiments, the linker is SEQ ID NO: 283. Antibodies from Escherichia coli. In Rosenberg M. & Moore G.P. (Eds.), The Pharmacology of Monoclonal Antibodies vol. 1 13 (pp. 269-315). Springer-Verlag, New York, incorporated by reference in its entirety.

[0036] "scFv-Fc" fragments comprise an scFv attached to an Fc domain. For example, an Fc domain may be attached to the C-terminal of the scFv. The Fc domain may follow the VH or VL, depending on the orientation of the variable domains in the scFv (i.e., VH -VL or VL -VH )· Any suitable Fc domain known in the art or described herein may be used. In some cases, the Fc domain comprises an IgGl Fc domain. In some embodiments, the IgGl Fc domain comprises SEQ ID NO: 279, or a portion thereof, or SEQ ID NO: 280. SEQ ID NO: 279 provides the sequence of CHI, CH2, and CH3 of the human IgGl constant region. SEQ ID NO: 280 provides the sequence of the constant region used in the illustrative scFv-Fc antibodies provided herein.

[0037] The term "monoclonal antibody" refers to an antibody from a population of substantially homogeneous antibodies. A population of substantially homogeneous antibodies comprises antibodies that are substantially similar and that bind the same epitope(s), except for variants that may normally arise during production of the monoclonal antibody. Such variants are generally present in only minor amounts. A monoclonal antibody is typically obtained by a process that includes the selection of a single antibody from a plurality of antibodies. For example, the selection process can be the selection of a unique clone from a plurality of clones, such as a pool of hybridoma clones, phage clones, yeast clones, bacterial clones, or other recombinant DNA clones. The selected antibody can be further altered, for example, to improve affinity for the target ("affinity maturation"), to humanize the antibody, to improve its production in cell culture, and/or to reduce its immunogenicity in a subject.

[0038] The term "chimeric antibody" refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species.

[0039] "Humanized" forms of non-human antibodies are chimeric antibodies that contain minimal sequence derived from the non-human antibody. A humanized antibody is generally a human immunoglobulin (recipient antibody) in which residues from one or more CDRs are replaced by residues from one or more CDRs of a non-human antibody (donor antibody). The donor antibody can be any suitable non-human antibody, such as a mouse, rat, rabbit, chicken, or non-human primate antibody having a desired specificity, affinity, or biological effect. In some instances, selected framework region residues of the recipient antibody are replaced by the corresponding framework region residues from the donor antibody. Humanized antibodies may also comprise residues that are not found in either the recipient antibody or the donor antibody. Such modifications may be made to further refine antibody function. For further details, see Jones et al, Nature, 1986, 321 :522-525; Riechmann et al., Nature, 1988, 332:323-329; and Presta, Curr. Op. Struct. Biol. , 1992, 2:593-596, each of which is incorporated by reference in its entirety.

[0040] A "human antibody" is one which possesses an amino acid sequence corresponding to that of an antibody produced by a human or a human cell, or derived from a non-human source that utilizes a human antibody repertoire or human antibody-encoding sequences (e.g., obtained from human sources or designed de novo). Human antibodies specifically exclude humanized antibodies.

[0041] An "isolated antibody" is one that has been separated and/or recovered from a component of its natural environment. Components of the natural environment may include enzymes, hormones, and other proteinaceous or nonproteinaceous materials. In some embodiments, an isolated antibody is purified to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence, for example by use of a spinning cup sequenator. In some embodiments, an isolated antibody is purified to homogeneity by gel electrophoresis (e.g., SDS-PAGE) under reducing or nonreducing conditions, with detection by Coomassie blue or silver stain. An isolated antibody includes an antibody in situ within recombinant cells, since at least one component of the antibody's natural environment is not present. In some aspects, an isolated antibody is prepared by at least one purification step.

[0042] In some embodiments, an isolated antibody is purified to at least 80%, 85%,

90%, 95%, or 99% by weight. In some embodiments, an isolated antibody is purified to at least 80%, 85%, 90%, 95%, or 99% by volume. In some embodiments, an isolated antibody is provided as a solution comprising at least 85%, 90%, 95%, 98%, 99% to 100% by weight. In some embodiments, an isolated antibody is provided as a solution comprising at least 85%, 90%, 95%, 98%, 99% to 100% by volume.

[0043] "Affinity" refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, "binding affinity" refers to intrinsic binding affinity, which reflects a 1 : 1 interaction between members of a binding pair (e.g., antibody and antigen). The affinity of a molecule X for its partner Y can be represented by the dissociation constant (K D ). Affinity can be measured by common methods known in the art, including those described herein. Affinity can be determined, for example, using surface plasmon resonance (SPR) technology, such as a Biacore ® instrument. In some embodiments, the affinity is determined at 25°C.

[0044] With regard to the binding of an antibody to a target molecule, the terms

"specific binding," "specifically binds to," "specific for," "selectively binds," and "selective for" a particular antigen (e.g., a polypeptide target) or an epitope on a particular antigen mean binding that is measurably different from a non-specific or non-selective interaction. Specific binding can be measured, for example, by determining binding of a molecule compared to binding of a control molecule. Specific binding can also be determined by competition with a control molecule that mimics the antibody binding site on the target. In that case, specific binding is indicated if the binding of the antibody to the target is competitively inhibited by the control molecule.

[0045] The term '¾" (sec -1 ), as used herein, refers to the dissociation rate constant of a particular antibody-antigen interaction. This value is also referred to as the k 0f value. [0046] The term "k a " (M^xsec -1 ), as used herein, refers to the association rate constant of a particular antibody-antigen interaction. This value is also referred to as the k on value.

[0047] The term "K D " (M), as used herein, refers to the dissociation equilibrium constant of a particular antibody-antigen interaction. K D = k,j/k a .

[0048] The term "KA" (M "1 ), as used herein, refers to the association equilibrium constant of a particular antibody-antigen interaction. KA = k a /k,j.

[0049] An "affinity matured" antibody is one with one or more alterations in one or more CDRs or FRs that result in an improvement in the affinity of the antibody for its antigen, compared to a parent antibody which does not possess the alteration(s). In one embodiment, an affinity matured antibody has nanomolar or picomolar affinity for the target antigen. Affinity matured antibodies may be produced using a variety of methods known in the art. For example, Marks et al. {Bio/Technology, 1992, 10:779-783, incorporated by reference in its entirety) describes affinity maturation by VH and VL domain shuffling. Random mutagenesis of CDR and/or framework residues is described by, for example, Barbas et al. (Proc. Nat. Acad. Sci. U.S.A. , 1994, 91 :3809-3813); Schier et al., Gene, 1995, 169: 147-155; Yelton et al., J. Immunol , 1995, 155: 1994-2004; Jackson et al, J. Immunol, 1995, 154:3310-33199; and Hawkins et al, J. Mol. Biol , 1992, 226:889-896, each of which is incorporated by reference in its entirety.

[0050] When used herein in the context of two or more antibodies, the term

"competes with" or "cross-competes with" indicates that the two or more antibodies compete for binding to an antigen (e.g., EpCAM). In one exemplary assay, EpCAM is coated on a plate and allowed to bind a first antibody, after which a second, labeled antibody is added. If the presence of the first antibody reduces binding of the second antibody, then the antibodies compete. In another exemplary assay, a first antibody is coated on a plate and allowed to bind the antigen, and then the second antibody is added. The term "competes with" also includes combinations of antibodies where one antibody reduces binding of another antibody, but where no competition is observed when the antibodies are added in the reverse order. However, in some embodiments, the first and second antibodies inhibit binding of each other, regardless of the order in which they are added. In some embodiments, one antibody reduces binding of another antibody to its antigen by at least 50%, at least 60%, at least 70%, at least 80%, or at least 90%. [0051] The term "epitope" means a portion of an antigen capable of specific binding to an antibody. Epitopes frequently consist of surface-accessible amino acid residues and/or sugar side chains and may have specific three dimensional structural characteristics, as well as specific charge characteristics. Conformational and non-conformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents. An epitope may comprise amino acid residues that are directly involved in the binding, and other amino acid residues, which are not directly involved in the binding. The epitope to which an antibody binds can be determined using known techniques for epitope determination such as, for example, testing for antibody binding to EpCAM variants with different point-mutations, or to chimeric EpCAM variants as described further in the Examples provided herein.

[0052] Percent "identity" between a polypeptide sequence and a reference sequence, is defined as the percentage of amino acid residues in the polypeptide sequence that are identical to the amino acid residues in the reference sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, MEGALIGN (DNASTAR), CLUSTALW, CLUSTAL OMEGA, or MUSCLE software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.

[0053] A "conservative substitution" or a "conservative amino acid substitution," refers to the substitution an amino acid with a chemically or functionally similar amino acid. Conservative substitution tables providing similar amino acids are well known in the art. Polypeptide sequences having such substitutions are known as "conservatively modified variants." By way of example, the groups of amino acids provided in Tables 2-4 are, in some embodiments, considered conservative substitutions for one another. Table 2. Selected groups of amino acids that are considered conservative substitutions for one another, in certain embodiments.

Acidic Residues jD and E !

Basic Residues !K. R, and H j

Hydrophilic Uncharged Residues IS. T, N, and Q j

Aliphatic Uncharged Residues !G. A, V, L, and I |

Non-polar Uncharged Residues !C. M, and P |

Aromatic Residues IF, Y, and W j

Table 3. Additional selected groups of amino acids that are considered conservative substitutions for one another, in certain embodiments.

Group 1 A, S, and T

Group 2 D and E

Group 3 and Q

Group 4 R an d K

Group 5 I, L, and M

Group 6 F, Y, and W

Table 4. Further selected groups of amino acids that are considered conservative substitutions for one another, in certain embodiments.

Group A A and G

Group B and E

Group C S and Q

Group D

Group E

Group F F, Y, and W

Group G S and T

Group H C and VI

[0054] Additional conservative substitutions may be found, for example, in

Creighton, Proteins: Structures and Molecular Properties 2nd ed. (1993) W. H. Freeman & Co., New York, NY. An antibody generated by making one or more conservative substitutions of amino acid residues in a parent antibody is referred to as a "conservatively modified variant."

[0055] The term "amino acid" refers to the twenty common naturally occurring amino acids. Naturally occurring amino acids include alanine (Ala; A), arginine (Arg; R), asparagine (Asn; N), aspartic acid (Asp; D), cysteine (Cys; C); glutamic acid (Glu; E), glutamine (Gin; Q), Glycine (Gly; G); histidine (His; H), isoleucine (He; I), leucine (Leu; L), lysine (Lys; K), methionine (Met; M), phenylalanine (Phe; F), proline (Pro; P), serine (Ser; S), threonine (Thr; T), tryptophan (Trp; W), tyrosine (Tyr; Y), and valine (Val; V).

[0056] "Treating" or "treatment" of any disease or disorder refers, in certain embodiments, to ameliorating a disease or disorder that exists in a subject. In another embodiment, "treating" or "treatment" includes ameliorating at least one physical parameter, which may be indiscernible by the subject. In yet another embodiment, "treating" or "treatment" includes modulating the disease or disorder, either physically (e.g., stabilization of a discernible symptom) or physiologically (e.g., stabilization of a physical parameter) or both. In yet another embodiment, "treating" or "treatment" includes delaying or preventing the onset of the disease or disorder.

[0057] As used herein, the term "therapeutically effective amount" or "effective amount" refers to an amount of an antibody or composition that when administered to a subject is effective to treat a disease or disorder.

[0058] As used herein, the term "subject" means a mammalian subject. Exemplary subjects include, but are not limited to humans, monkeys, dogs, cats, mice, rats, cows, horses, camels, avians, goats, and sheep. In certain embodiments, the subject is a human. In some embodiments, the subject has a cancer that can be treated or diagnosed with an antibody provided herein. In some embodiments, the cancer is a cancer of epithelial origin.

2. Antibodies

[0059] Provided herein are antibodies that selectively bind human EpCAM. In some aspects, the antibody selectively binds to the extracellular domain of human EpCAM. In some embodiments, the antibody selectively binds to a portion of the EpCAM protein encoded by an exon selected from exons 4-7 of the EpCAM gene. In some embodiments, the antibody does not bind the portion of the EpCAM protein encoded by exon 2 of the EpCAM gene.

[0060] In some embodiments, the antibody binds to a homolog of human EpCAM. In some aspects, the antibody binds to a homolog of human EpCAM from a species selected from monkeys, mice, dogs, cats, rats, cows, horses, goats and sheep. In some aspects, the homolog is a cynomolgus monkey homolog. In some aspects, the antibody does not bind a murine homolog. [0061] In some embodiments, the antibody has one or more CDRs having particular lengths, in terms of the number of amino acid residues. In some embodiments, the Chothia CDR-Hl of the antibody is 6, 7, or 8 residues in length. In some embodiments, the Kabat CDR-Hl of the antibody is 4, 5, or 6 residues in length. In some embodiments, the Chothia CDR-H2 of the antibody is 5, 6, or 7 residues in length. In some embodiments, the Kabat CDR-H2 of the antibody is 16, 17, or 18 residues in length. In some embodiments, the Kabat/Chothia CDR-H3 of the antibody is 9, 10, 11, 12, or 13 residues in length.

[0062] In some aspects, the Kabat/Chothia CDR-L1 of the antibody is 11, 12, 13, 14,

15, 16, 17, or 18 residues in length. In some aspects, the Kabat/Chothia CDR-L2 of the antibody is 6, 7, or 8 residues in length. In some aspects, the Kabat/Chothia CDR-L3 of the antibody is 8, 9, or 10 residues in length.

[0063] In some embodiments, the antibody comprises a light chain. In some aspects, the light chain is a kappa light chain. In some aspects, the light chain is a lambda light chain.

[0064] In some embodiments, the antibody comprises a heavy chain. In some aspects, the heavy chain is an IgA. In some aspects, the heavy chain is an IgD. In some aspects, the heavy chain is an IgE. In some aspects, the heavy chain is an IgG. In some aspects, the heavy chain is an IgM. In some aspects, the heavy chain is an IgGl. In some aspects, the heavy chain is an IgG2. In some aspects, the heavy chain is an IgG3. In some aspects, the heavy chain is an IgG4. In some aspects, the heavy chain is an IgAl. In some aspects, the heavy chain is an IgA2.

[0065] In some embodiments, the antibody is an antibody fragment. In some aspects, the antibody fragment is an Fv fragment. In some aspects, the antibody fragment is a Fab fragment. In some aspects, the antibody fragment is a F(ab')2 fragment. In some aspects, the antibody fragment is a Fab' fragment. In some aspects, the antibody fragment is an scFv (sFv) fragment. In some aspects, the antibody fragment is an scFv-Fc fragment.

[0066] In some embodiments, the scFv-Fc fragment comprises a constant region wherein the constant region comprises SEQ ID NO: 280. The constant region in SEQ ID NO: 280 differs from the human IgGl constant region of SEQ ID NO: 279 in several respects. First, the sequence in SEQ ID NO: 280 comprises the linker AAGSDQ (SEQ ID NO: 284). SEQ ID NO: 280 also does not comprise the CHI domain of the IgGl constant region. SEQ ID NO: 280 further comprises a C220S (EU numbering system) mutation, which removes an unpaired cysteine reside that is not needed when the light chain constant region is not present (e.g., in an scFv-Fc format). SEQ ID NO: 280 further comprises two, optional, P to S mutations (P230S and P238S by the EU numbering system). Either or both of these serine residues can be reverted to the naturally occurring proline residues. Finally, SEQ ID NO: 280 comprises an aspartic acid (D) residue at EU position 356 and a leucine (L) residue at EU position 358. In contrast, SEQ ID NO: 279 comprises glutamic acid (E) in EU position 356 and methionine (M) in EU position 358. In some embodiments, the antibodies provided herein comprise constant regions comprising D356/L358, E356/M358, D356/M358, or E356/L358 (EU numbering). However, a skilled person will recognize that the antibodies provide herein may comprise any suitable constant region and that the constant region sequences provided herein are for illustrative purposes.

[0067] In some embodiments, the antibody is a monoclonal antibody. In some embodiments, the antibody is a polyclonal antibody.

[0068] In some embodiments, the antibody is a chimeric antibody. In some embodiments, the antibody is a humanized antibody. In some embodiments, the antibody is a human antibody.

[0069] In some embodiments, the antibody is an affinity matured antibody. In some aspects, the antibody is an affinity matured antibody derived from an illustrative sequence provided in this disclosure.

[0070] In some embodiments, the antibody inhibits the binding of EpCAM to one or more of its ligands. In some aspects, the antibody inhibits the binding of EpCAM to a ligand selected from a second EpCAM molecule, claudin-7, CD44v4-v7, E-cadherin, and CD9.

[0071] The antibodies provided herein may be useful for the treatment of a variety of diseases and conditions including cancers. In particular, the antibodies provided herein may be useful for the treatment of cancers of epithelial origin.

2.1. CDR-H3 Sequences

[0072] In some embodiments, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of a CDR-H3 sequence of an illustrative antibody or VH sequence provided herein. In some aspects, the CDR-H3 sequence is a CDR- H3 sequence of an scFv-Fc sequence provided in SEQ ID NOs.: 204-228 or of an scFv sequence provided in SEQ ID NOs. : 337-361. In some aspects, the CDR-H3 sequence is a CDR-H3 sequence of a V H sequence provided in SEQ ID NOs. : 229-253. [0073] In some embodiments, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 104-128. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 104. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 105. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 106. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 107. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 108. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 109. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 110. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 111. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 112. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 113. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 114. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 115. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 116. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 117. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 118. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 119. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 120. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 121. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 122. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 123. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 124. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 125. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 126. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 127. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 128.

[0074] In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-H3 sequence provided in this disclosure. In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-H3 sequences provided in this disclosure. In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-H3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.

[0075] In some aspects, the CDR-H3 sequence does not comprise, consist of, or consist essentially of a sequence selected from SEQ ID NOs: 306-310. In some aspects, the CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 306. In some aspects, the CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 307. In some aspects, the CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 308. In some aspects, the CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 309. In some aspects, the CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 310.

2.2. V H Sequences Comprising Illustrative CDRs

[0076] In some embodiments, the antibody comprises a VH sequence comprising one or more CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative CDR-H sequences provided in this disclosure, and variants thereof. In some embodiments, the CDR-H sequences comprise, consist of, or consist essentially of one or more CDR-H sequences provided in a VH sequence selected from SEQ ID NOs: 229-253.

2.2.1. V H Sequences Comprising Illustrative Kabat CDRs

[0077] In some embodiments, the antibody comprises a VH sequence comprising one or more Kabat CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative Kabat CDR-H sequences provided in this disclosure, and variants thereof. 2.2.1.1. Kabat CDR-H3

[0078] In some embodiments, the antibody comprises a VH sequence comprising a

CDR-H3 sequence, wherein the CDR-H3 sequence comprises, consists of, or consists essentially of a Kabat CDR-H3 sequence of an illustrative antibody or VH sequence provided herein. In some aspects, the Kabat CDR-H3 sequence is a Kabat CDR-H3 sequence of a scFv-Fc sequence provided in SEQ ID NOs. : 204-228 or of a scFv sequence provided in SEQ ID NOs. : 337-361. In some aspects, the Kabat CDR-H3 sequence is a Kabat CDR-H3 sequence of a VH sequence provided in SEQ ID NOs. : 229-253.

[0079] In some embodiments, the antibody comprises a VH sequence comprising a

Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 104-128. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 104. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 105. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 106. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 107. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 108. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 109. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 1 10. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 1 1 1. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 1 12. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 1 13. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 1 14. In some aspects, the antibody comprises a VH sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 1 15. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 116. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 117. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 118. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 119. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR- H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 120. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 121. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 122. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 123. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 124. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 125. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 126. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 127. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 128.

2.2.1.2. Kabat CDR-H2

[0080] In some embodiments, the antibody comprises a V H sequence comprising a

CDR-H2 sequence, wherein the CDR-H2 sequence comprises, consists of, or consists essentially of a Kabat CDR-H2 sequence of an illustrative antibody or V H sequence provided herein. In some aspects, the Kabat CDR-H2 sequence is a Kabat CDR-H2 sequence of an scFv-Fc sequence provided in SEQ ID NOs.: 204-228 or of an scFv sequence provided in SEQ ID NOs.: 337-361. In some aspects, the Kabat CDR-H3 sequence is a Kabat CDR-H3 sequence of a V H sequence provided in SEQ ID NOs.: 229-253. [0081] In some embodiments, the antibody comprises a V H sequence comprising a

Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 79-103. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 79. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 80. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 81. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 82. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 83. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 84. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 85. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 86. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 87. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 88. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 89. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 90. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 91. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 92. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 93. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 94. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 95. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 96. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 97. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 98. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 99. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 100. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 101. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 102. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 103.

2.2.1.3. Kabat CDR-Hl

[0082] In some embodiments, the antibody comprises a V H sequence comprising a

CDR-Hl sequence, wherein the CDR-Hl sequence comprises, consists of, or consists essentially of a Kabat CDR-Hl sequence of an illustrative antibody or V H sequence provided herein. In some aspects, the Kabat CDR-Hl sequence is a Kabat CDR-Hl sequence of an scFv-Fc sequence provided in SEQ ID NOs.: 204-228 or of an scFv sequence provided in SEQ ID NOs.: 337-361. In some aspects, the Kabat CDR-H3 sequence is a Kabat CDR-Hl sequence of a V H sequence provided in SEQ ID NOs.: 229-253.

[0083] In some embodiments, the antibody comprises a V H sequence comprising a

Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 29-53. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 29. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 30. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 31. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 32. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 33. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 34. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 35. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 36. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 37. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 38. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 39. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 40. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 41. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 42. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 43. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 44. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 45. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 46. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 47. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 48. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 49. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 50. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 51. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 52. In some aspects, the antibody comprises a V H sequence comprising a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 53.

2.2.1.4. Kabat CDR-H3 + Kabat CDR-H2

[0084] In some embodiments, the antibody comprises a V H sequence comprising a

Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 104-128, and a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 79-103. In some aspects, the Kabat CDR-H3 sequence and the Kabat CDR-H2 sequence are both from a single illustrative V H sequence provided in this disclosure. For example, in some aspects, the Kabat CDR-H3 and Kabat CDR-H2 are both from a single illustrative V H sequence selected from SEQ ID NOs: 229-253.

2.2.1.5. Kabat CDR-H3 + Kabat CDR-Hl

[0085] In some embodiments, the antibody comprises a V H sequence comprising a

Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 104-128, and a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 29-53. In some aspects, the Kabat CDR-H3 sequence and the Kabat CDR-Hl sequence are both from a single illustrative V H sequence provided in this disclosure. For example, in some aspects, the Kabat CDR-H3 and Kabat CDR-Hl are both from a single illustrative V H sequence selected from SEQ ID NOs: 229-253.

2.2.1.6. Kabat CDR-Hl + Kabat CDR-H2

[0086] In some embodiments, the antibody comprises a V H sequence comprising a

Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 29-53 and a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 79-103. In some aspects, the Kabat CDR-Hl sequence and the Kabat CDR-H2 sequence are both from a single illustrative V H sequence provided in this disclosure. For example, in some aspects, the Kabat CDR-Hl and Kabat CDR-H2 are both from a single illustrative V H sequence selected from SEQ ID NOs: 229-253. 2.2.1.7. Kabat CDR-H1 + Kabat CDR-H2 + Kabat CDR-H3

[0087] In some embodiments, the antibody comprises a VH sequence comprising a

Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 29-53, a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 79-103, and a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 104-128. In some aspects, the Kabat CDR-H1 sequence, Kabat CDR-H2 sequence, and Kabat CDR-H3 sequence are all from a single illustrative VH sequence provided in this disclosure. For example, in some aspects, the Kabat CDR-H1, Kabat CDR-H2, and Kabat CDR-H3 are all from a single illustrative VH sequence selected from SEQ ID NOs: 229-253.

2.2.1.8. Variants of V H Sequences Comprising Illustrative Kabat CDRs

[0088] In some embodiments, the VH sequences provided herein comprise a variant of an illustrative Kabat CDR-H3, CDR-H2, and/or CDR-H1 sequence provided in this disclosure.

[0089] In some aspects, the Kabat CDR-H3 sequence comprises, consists of, or consists essentially of a variant of an illustrative Kabat CDR-H3 sequence provided in this disclosure. In some aspects, the Kabat CDR-H3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Kabat CDR-H3 sequences provided in this disclosure. In some aspects, the Kabat CDR-H3 sequence comprises, consists of, or consists essentially of any of the illustrative Kabat CDR-H3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.

[0090] In some aspects, the Kabat CDR-H2 sequence comprises, consists of, or consists essentially of a variant of an illustrative Kabat CDR-H2 sequence provided in this disclosure. In some aspects, the Kabat CDR-H2 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Kabat CDR-H2 sequences provided in this disclosure. In some aspects, the Kabat CDR-H2 sequence comprises, consists of, or consists essentially of any of the illustrative Kabat CDR-H2 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions. [0091] In some aspects, the Kabat CDR-H1 sequence comprises, consists of, or consists essentially of a variant of an illustrative Kabat CDR-H1 sequence provided in this disclosure. In some aspects, the Kabat CDR-H1 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Kabat CDR-H1 sequences provided in this disclosure. In some aspects, the Kabat CDR-H1 sequence comprises, consists of, or consists essentially of any of the illustrative Kabat CDR-H1 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.

2.2.1.9. Excluded V H Sequences Comprising Kabat CDRs

[0092] In some embodiments, the VH sequences provided herein do not comprise certain Kabat CDR-H3, CDR-H2, and/or CDR-H1 sequences.

[0093] In some aspects, the Kabat CDR-H3 sequence does not comprise, consist of, or consist essentially of a sequence selected from SEQ ID NOs: 306-310. In some aspects, the Kabat CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 306. In some aspects, the Kabat CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 307. In some aspects, the Kabat CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 308. In some aspects, the Kabat CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 309. In some aspects, the Kabat CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 310.

[0094] In some aspects, the Kabat CDR-H2 sequence does not comprise, consist of, or consist essentially of a sequence selected from SEQ ID NOs: 301-305. In some aspects, the Kabat CDR-H2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 301. In some aspects, the Kabat CDR-H2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 302. In some aspects, the Kabat CDR-H2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 303. In some aspects, the Kabat CDR-H2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 304. In some aspects, the Kabat CDR-H2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 305.

[0095] In some aspects, the Kabat CDR-H1 sequence does not comprise, consist of, or consist essentially of a sequence selected from SEQ ID NOs: 291-295. In some aspects, the Kabat CDR-Hl sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 291. In some aspects, the Kabat CDR-Hl sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 292. In some aspects, the Kabat CDR-Hl sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 293. In some aspects, the Kabat CDR-Hl sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 294. In some aspects, the Kabat CDR-Hl sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 295.

2.2.2. V H Sequences Comprising Illustrative Chothia CDRs

[0096] In some embodiments, the antibody comprises a V H sequence comprising one or more Chothia CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative Chothia CDR-H sequences provided in this disclosure, and variants thereof.

2.2.2.1. Chothia CDR-H3

[0097] In some embodiments, the antibody comprises a V H sequence comprising a

CDR-H3 sequence, wherein the CDR-H3 sequence comprises, consists of, or consists essentially of a Chothia CDR-H3 sequence of an illustrative antibody or V H sequence provided herein. In some aspects, the Chothia CDR-H3 sequence is a Chothia CDR-H3 sequence of an scFv-Fc sequence provided in SEQ ID NOs.: 204-228 or of an scFv sequence provided in SEQ ID NOs.: 337-361. In some aspects, the Chothia CDR-H3 sequence is a Chothia CDR-H3 sequence of a V H sequence provided in SEQ ID NOs.: 229-253.

[0098] In some embodiments, the antibody comprises a V H sequence comprising a

Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 104-128. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 104. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 105. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR- H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 106. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 107. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 108. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 109. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 110. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 111. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 112. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 113. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 114. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 115. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 116. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 117. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 118. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 119. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 120. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 121. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 122. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 123. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 124. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 125. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 126. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 127. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 128.

2.2.2.2. Chothia CDR-H2

[0099] In some embodiments, the antibody comprises a VH sequence comprising a

CDR-H2 sequence, wherein the CDR-H2 sequence comprises, consists of, or consists essentially of a Chothia CDR-H2 sequence of an illustrative antibody or VH sequence provided herein. In some aspects, the Chothia CDR-H2 sequence is a Chothia CDR-H2 sequence of an scFv-Fc sequence provided in SEQ ID NOs. : 204-228 or of an scFv sequence provided in SEQ ID NOs. : 337-361. In some aspects, the Chothia CDR-H2 sequence is a Chothia CDR-H2 sequence of a V H sequence provided in SEQ ID NOs.: 229-253.

[00100] In some embodiments, the antibody comprises a VH sequence comprising a

Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 54-78. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 54. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 55. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 56. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 57. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 58. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 59. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 60. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 61. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 62. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 63. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 64. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 65. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 66. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 67. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 68. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 69. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 70. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 71. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 72. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 73. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 74. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 75. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 76. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 77. In some aspects, the antibody comprises a VH sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 78.

2.2.2.3. Chothia CDR-Hl

[00101] In some embodiments, the antibody comprises a VH sequence comprising a

CDR-Hl sequence, wherein the CDR-Hl sequence comprises, consists of, or consists essentially of a Chothia CDR-Hl sequence of an illustrative antibody or VH sequence provided herein. In some aspects, the Chothia CDR-Hl sequence is a Chothia CDR-Hl sequence of an scFv-Fc sequence provided in SEQ ID NOs.: 204-228 or of an scFv sequence provided in SEQ ID NOs.: 337-361. In some aspects, the Chothia CDR-H1 sequence is a Chothia CDR-H1 sequence of a V H sequence provided in SEQ ID NOs.: 229-253.

[00102] In some embodiments, the antibody comprises a V H sequence comprising a

Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 4-28. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 4. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 5. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 6. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 7. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 8. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 9. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 10. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 11. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 12. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 13. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 14. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 15. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 16. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 17. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 18. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 19. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 20. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 21. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 22. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 23. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 24. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 25. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 26. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 27. In some aspects, the antibody comprises a V H sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 28.

2.2.2.4. Chothia CDR-H3 + Chothia CDR-H2

[00103] In some embodiments, the antibody comprises a V H sequence comprising a

Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 104-128, and a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 54-78. In some aspects, the Chothia CDR-H3 sequence and the Chothia CDR-H2 sequence are both from a single illustrative V H sequence provided in this disclosure. For example, in some aspects, the Chothia CDR-H3 and Chothia CDR-H2 are both from a single illustrative V H sequence selected from SEQ ID NOs: 229-253.

2.2.2.5. Chothia CDR-H3 + Chothia CDR-H1

[00104] In some embodiments, the antibody comprises a V H sequence comprising a

Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 104-128, and a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 4-28. In some aspects, the Chothia CDR-H3 sequence and the Chothia CDR-Hl sequence are both from a single illustrative V H sequence provided in this disclosure. For example, in some aspects, the Chothia CDR-H3 and Chothia CDR-Hl are both from a single illustrative V H sequence selected from SEQ ID NOs: 229-253.

2.2.2.6. Chothia CDR-Hl + Chothia CDR-H2

[00105] In some embodiments, the antibody comprises a V H sequence comprising a

Chothia CDR-Hl sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 4-28 and a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 54-78. In some aspects, the Chothia CDR-Hl sequence and the Chothia CDR-H2 sequence are both from a single illustrative V H sequence provided in this disclosure. For example, in some aspects, the Chothia CDR-Hl and Chothia CDR-H2 are both from a single illustrative V H sequence selected from SEQ ID NOs: 229-253.

2.2.2.7. Chothia CDR-Hl + Chothia CDR-H2 + Chothia CDR-H3

[00106] In some embodiments, the antibody comprises a V H sequence comprising a

Chothia CDR-Hl sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 4-28, a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 54-78, and a Chothia CDR- H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 104-128. In some aspects, the Chothia CDR-Hl sequence, Chothia CDR-H2 sequence, and Chothia CDR-H3 sequence are all from a single illustrative V H sequence provided in this disclosure. For example, in some aspects, the Chothia CDR-Hl, Chothia CDR-H2, and Chothia CDR-H3 are all from a single illustrative V H sequence selected from SEQ ID NOs: 229-253.

2.2.2.8. Variants of V H Sequences Comprising Illustrative Chothia CDRs

[00107] In some embodiments, the V H sequences provided herein comprise a variant of an illustrative Chothia CDR-H3, CDR-H2, and/or CDR-Hl sequence provided in this disclosure.

[00108] In some aspects, the Chothia CDR-H3 sequence comprises, consists of, or consists essentially of a variant of an illustrative Chothia CDR-H3 sequence provided in this disclosure. In some aspects, the Chothia CDR-H3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Chothia CDR-H3 sequences provided in this disclosure. In some aspects, the Chothia CDR-H3 sequence comprises, consists of, or consists essentially of any of the illustrative Chothia CDR-H3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.

[00109] In some aspects, the Chothia CDR-H2 sequence comprises, consists of, or consists essentially of a variant of an illustrative Chothia CDR-H2 sequence provided in this disclosure. In some aspects, the Chothia CDR-H2 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Chothia CDR-H2 sequences provided in this disclosure. In some aspects, the Chothia CDR-H2 sequence comprises, consists of, or consists essentially of any of the illustrative Chothia CDR-H2 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.

[00110] In some aspects, the Chothia CDR-H1 sequence comprises, consists of, or consists essentially of a variant of an illustrative Chothia CDR-H1 sequence provided in this disclosure. In some aspects, the Chothia CDR-H1 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Chothia CDR-H1 sequences provided in this disclosure. In some aspects, the Chothia CDR-H1 sequence comprises, consists of, or consists essentially of any of the illustrative Chothia CDR-H1 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.

2.2.2.9. Excluded V H Sequences Comprising Chothia CDRs

[00111] In some embodiments, the VH sequences provided herein do not comprise certain Chothia CDR-H3, CDR-H2, and/or CDR-H1 sequences.

[00112] In some aspects, the Chothia CDR-H3 sequence does not comprise, consist of, or consist essentially of a sequence selected from SEQ ID NOs: 306-310. In some aspects, the Chothia CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 306. In some aspects, the Chothia CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 307. In some aspects, the Chothia CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 308. In some aspects, the Chothia CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 309. In some aspects, the Chothia CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 310.

[001 13] In some aspects, the Chothia CDR-H2 sequence does not comprise, consist of, or consist essentially of a sequence selected from SEQ ID NOs: 296-300. In some aspects, the Chothia CDR-H2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 296. In some aspects, the Chothia CDR-H2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 297. In some aspects, the Chothia CDR-H2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 298. In some aspects, the Chothia CDR-H2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 299. In some aspects, the Chothia CDR-H2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 300.

[001 14] In some aspects, the Chothia CDR-Hl sequence does not comprise, consist of, or consist essentially of a sequence selected from SEQ ID NOs: 286-290. In some aspects, the Chothia CDR-Hl sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 286. In some aspects, the Chothia CDR-Hl sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 287. In some aspects, the Chothia CDR-Hl sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 288. In some aspects, the Chothia CDR-Hl sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 289. In some aspects, the Chothia CDR-Hl sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 290.

2.3. V H Sequences

[001 15] In some embodiments, the antibody comprises, consists of, or consists essentially of a VH sequence of an scFv-Fc sequence provided in SEQ ID NOs.: 204-228 or of an scFv sequence provided in SEQ ID NOs. : 337-361. In some embodiments, the antibody comprises, consists of, or consists essentially of a VH sequence provided in SEQ ID NOs. : 229-253.

[001 16] In some embodiments, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 229-253. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 229. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 230. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 231. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 232. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 233. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 234. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 235. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 236. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 237. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 238. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 239. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 240. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 241. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 242. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 243. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 244. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 245. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 246. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 247. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 248. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 249. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 250. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 251. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 252. In some aspects, the antibody comprises a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 253. 2.3.1. Variants of V H Sequences

[00117] In some embodiments, the VH sequences provided herein comprise, consist of, or consist essentially of a variant of an illustrative VH sequence provided in this disclosure.

[00118] In some aspects, the VH sequence comprises, consists of, or consists essentially of a variant of an illustrative VH sequence provided in this disclosure. In some aspects, the VH sequence comprises, consists of, or consists essentially of a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identity with any of the illustrative VH sequences provided in this disclosure.

[00119] In some embodiments, the VH sequence comprises, consists of, or consists essentially of any of the illustrative VH sequences provided in this disclosure having 20 or fewer, 19 or fewer, 18 or fewer, 17 or fewer, 16 or fewer, 15 or fewer, 14 or fewer, 13 or fewer, 12 or fewer, 11 or fewer, 10 or fewer, 9 or fewer, 8 or fewer, 7 or fewer, 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer, or 1 or fewer amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.

2.3.2. Excluded V H Sequences

[00120] In some embodiments, the VH sequences provided herein do not comprise certain VH sequences.

[00121] In some aspects, the VH sequence does not comprise, consist of, or consist essentially of a sequence selected from SEQ ID NOs: 326-330. In some aspects, the VH sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 326. In some aspects, the VH sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 327. In some aspects, the VH sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 328. In some aspects, the VH sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 329. In some aspects, the VH sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 330.

2.4. CDR-L3 Sequences

[00122] In some embodiments, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of a CDR-L3 sequence of an illustrative antibody or VL sequence provided herein. In some aspects, the CDR-L3 sequence is a CDR- L3 sequence of an scFv-Fc sequence provided in SEQ ID NOs. : 204-228 or of an scFv sequence provided in SEQ ID NOs. : 337-361. In some aspects, the CDR-L3 sequence is a CDR-L3 sequence of a V L sequence provided in SEQ ID NOs.: 254-278. [00123] In some embodiments, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 179-203. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 179. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 180. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 181. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 182. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 183. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 184. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 185. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 186. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 187. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 188. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 189. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 190. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 191. In some aspects, the antibody comprises a CDR- L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 192. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 193. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 194. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 195. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 196. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 197. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 198. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 199. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 200. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 201. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 202. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 203.

[00124] In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L3 sequence provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L3 sequences provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.

[00125] In some aspects, the CDR-L3 sequence does not comprise, consist of, or consist essentially of a sequence selected from SEQ ID NOs: 321-325. In some aspects the CDR-L3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 321. In some aspects the CDR-L3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 322. In some aspects the CDR-L3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 323. In some aspects the CDR-L3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 324. In some aspects the CDR-L3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 325.

2.5. V L Sequences Comprising Illustrative CDRs

[00126] In some embodiments, the antibody comprises a VL sequence comprising one or more CDR-L sequences comprising, consisting of, or consisting essentially of one or more illustrative CDR-L sequences provided in this disclosure, and variants thereof.

2.5.1. CDR-L3

[00127] In some embodiments, the antibody comprises a VL sequence comprising a

CDR-L3 sequence, wherein the CDR-L3 sequence comprises, consists of, or consists essentially of a CDR-L3 sequence of an illustrative antibody or VL sequence provided herein. In some aspects, the CDR-L3 sequence is a CDR-L3 sequence of an scFv-Fc sequence provided in SEQ ID NOs. : 204-228 or of an scFv sequence provided in SEQ ID NOs. : 337-361. In some aspects, the CDR-L3 sequence is a CDR-L3 sequence of a V L sequence provided in SEQ ID NOs.: 254-278.

[00128] In some embodiments, the antibody comprises a V L sequence comprising a

CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 179-203. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 179. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 180. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 181. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 182. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 183. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 184. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 185. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 186. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 187. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 188. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 189. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 190. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 191. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 192. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 193. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 194. In some aspects, the antibody comprises a V L sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 195. In some aspects, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 196. In some aspects, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 197. In some aspects, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 198. In some aspects, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 199. In some aspects, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 200. In some aspects, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 201. In some aspects, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 202. In some aspects, the antibody comprises a VL sequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 203.

2.5.2. CDR-L2

[00129] In some embodiments, the antibody comprises a VL sequence comprising a

CDR-L2 sequence, wherein the CDR-L2 sequence comprises, consists of, or consists essentially of a CDR-L2 sequence of an illustrative antibody or VL sequence provided herein. In some aspects, the CDR-L2 sequence is a CDR-L2 sequence of an scFv-Fc sequence provided in SEQ ID NOs. : 204-228 or of an scFv sequence provided in SEQ ID NOs. : 337-361. In some aspects, the CDR-L2 sequence is a CDR-L2 sequence of a VL sequence provided in SEQ ID NOs. : 254-278.

[00130] In some embodiments, the antibody comprises a VL sequence comprising a

CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 154-178. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 154. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 155. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 156. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 157. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 158. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 159. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 160. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 161. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 162. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 163. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 164. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 165. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 166. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 167. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 168. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 169. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 170. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 171. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 172. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 173. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 174. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 175. In some aspects, the antibody comprises a VL sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 176. In some aspects, the antibody comprises a V L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 177. In some aspects, the antibody comprises a V L sequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 178.

2.5.3. CDR-Ll

[00131] In some embodiments, the antibody comprises a V L sequence comprising a

CDR-Ll sequence, wherein the CDR-Ll sequence comprises, consists of, or consists essentially of a CDR-Ll sequence of an illustrative antibody or V L sequence provided herein. In some aspects, the CDR-Ll sequence is a CDR-Ll sequence of an scFv-Fc sequence provided in SEQ ID NOs.: 204-228 or of an scFv sequence provided in SEQ ID NOs.: 337-361. In some aspects, the CDR-Ll sequence is a CDR-Ll sequence of a V L sequence provided in SEQ ID NOs.: 254-278.

[00132] In some embodiments, the antibody comprises a V L sequence comprising a

CDR-Ll sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 129-153. In some aspects, the antibody comprises a V L sequence comprising a CDR-Ll sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 129. In some aspects, the antibody comprises a V L sequence comprising a CDR-Ll sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 130. In some aspects, the antibody comprises a V L sequence comprising a CDR-Ll sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 131. In some aspects, the antibody comprises a V L sequence comprising a CDR-Ll sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 132. In some aspects, the antibody comprises a V L sequence comprising a CDR-Ll sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 133. In some aspects, the antibody comprises a V L sequence comprising a CDR-Ll sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 134. In some aspects, the antibody comprises a V L sequence comprising a CDR-Ll sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 135. In some aspects, the antibody comprises a V L sequence comprising a CDR-Ll sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 136. In some aspects, the antibody comprises a V L sequence comprising a CDR-Ll sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 137. In some aspects, the antibody comprises a V L sequence comprising a CDR-Ll sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 138. In some aspects, the antibody comprises a V L sequence comprising a CDR-Ll sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 139. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 140. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 141. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 142. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 143. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 144. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 145. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 146. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 147. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 148. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 149. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 150. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 151. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 152. In some aspects, the antibody comprises a V L sequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 153.

2.5.4. CDR-L3 + CDR-L2

[00133] In some embodiments, the antibody comprises a V L sequence comprising a

CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 179-203 and a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 154-178. In some aspects, the CDR-L3 sequence and the CDR-L2 sequence are both from a single illustrative V L sequence provided in this disclosure. For example, in some aspects, the CDR-L3 and CDR-L2 are both from a single illustrative VL sequence selected from SEQ ID NOs: 254-278.

2.5.5. CDR-L3 + CDR-Ll

[00134] In some embodiments, the antibody comprises a VL sequence comprising a

CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 179-203 and a CDR-Ll sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 129-153. In some aspects, the CDR-L3 sequence and the CDR-Ll sequence are both from a single illustrative VL sequence provided in this disclosure. For example, in some aspects, the CDR-L3 and CDR-Ll are both from a single illustrative VL sequence selected from SEQ ID NOs: 254-278.

2.5.6. CDR-Ll + CDR-L2

[00135] In some embodiments, the antibody comprises a VL sequence comprising a

CDR-Ll sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 129-153 and a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 154-178. In some aspects, the CDR-Ll sequence and the CDR-L2 sequence are both from a single illustrative VL sequence provided in this disclosure. For example, in some aspects, the CDR-Ll and CDR-L2 are both from a single illustrative VL sequence selected from SEQ ID NOs: 254-278.

2.5.7. CDR-Ll + CDR-L2 + CDR-L3

[00136] In some embodiments, the antibody comprises a VL sequence comprising a

CDR-Ll sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 129-153, a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 154-178, and a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 179-203. In some aspects, the CDR-Ll sequence, CDR-L2 sequence, and CDR-L3 sequence are all from a single illustrative VL sequence provided in this disclosure. For example, in some aspects, the CDR-Ll, CDR-L2, and CDR-L3 are all from a single illustrative VL sequence selected from SEQ ID NOs: 254-278.

2.5.8. Variants of V L Sequences Comprising Illustrative CDR-Ls

[00137] In some embodiments, the VL sequences provided herein comprise a variant of an illustrative CDR-L3, CDR-L2, and/or CDR-Ll sequence provided in this disclosure. [00138] In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L3 sequence provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L3 sequences provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.

[00139] In some aspects, the CDR-L2 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L2 sequence provided in this disclosure. In some aspects, the CDR-L2 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L2 sequences provided in this disclosure. In some aspects, the CDR-L2 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L2 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.

[00140] In some aspects, the CDR-Ll sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-Ll sequence provided in this disclosure. In some aspects, the CDR-Ll sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-Ll sequences provided in this disclosure. In some aspects, the CDR-Ll sequence comprises, consists of, or consists essentially of any of the illustrative CDR-Ll sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.

2.5.9. Excluded V L Sequences Comprising CDR-Ls

[00141] In some embodiments, the VL sequences provided herein do not comprise certain CDR-L3, CDR-L2, and/or CDR-Ll sequences.

[00142] In some aspects, the CDR-L3 sequence does not comprise, consist of, or consist essentially of a sequence selected from SEQ ID NOs: 321-325. In some aspects, the CDR-L3 sequence does not comprise, consist of, or consist essentially of SEQ ID NOs: 321. In some aspects, the CDR-L3 sequence does not comprise, consist of, or consist essentially of SEQ ID NOs: 322. In some aspects, the CDR-L3 sequence does not comprise, consist of, or consist essentially of SEQ ID NOs: 323. In some aspects, the CDR-L3 sequence does not comprise, consist of, or consist essentially of SEQ ID NOs: 324. In some aspects, the CDR-L3 sequence does not comprise, consist of, or consist essentially of SEQ ID NOs: 325.

[00143] In some aspects, the CDR-L2 sequence does not comprise, consist of, or consist essentially of a sequence selected from SEQ ID NOs: 316-320. In some aspects, the CDR-L2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 316. In some aspects, the CDR-L2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 317. In some aspects, the CDR-L2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 318. In some aspects, the CDR-L2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 319. In some aspects, the CDR-L2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 320.

[00144] In some aspects, the CDR-Ll sequence does not comprise, consist of, or consist essentially of a sequence selected from SEQ ID NOs: 311-315. In some aspects, the CDR-Ll sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 311. In some aspects, the CDR-Ll sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 312. In some aspects, the CDR-Ll sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 313. In some aspects, the CDR-Ll sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 314. In some aspects, the CDR-Ll sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 315.

2.6. V L Sequences

[00145] In some embodiments, the antibody comprises, consists of, or consists essentially of a VL sequence of an scFv-Fc sequence provided in SEQ ID NOs. : 204-228 or of an scFv sequence provided in SEQ ID NOs. : 337-361. In some embodiments, the antibody comprises, consists of, or consists essentially of a VL sequence provided in SEQ ID NOs. : 254-278.

[00146] In some embodiments, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 254-278. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 254. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 255. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 256. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 257. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 258. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 259. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 260. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 261. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 262. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 263. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 264. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 265. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 266. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 267. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 268. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 269. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 270. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 271. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 272. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 273. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 274. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 275. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 276. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 277. In some aspects, the antibody comprises a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 278.

2.6.1. Variants of V L Sequences

[00147] In some embodiments, the VL sequences provided herein comprise, consist of, or consist essentially of a variant of an illustrative VL sequence provided in this disclosure. [00148] In some aspects, the V L sequence comprises, consists of, or consists essentially of a variant of an illustrative V L sequence provided in this disclosure. In some aspects, the V L sequence comprises, consists of, or consists essentially of a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identity with any of the illustrative V L sequences provided in this disclosure.

[00149] In some embodiments, the V L sequence comprises, consists of, or consists essentially of any of the illustrative V L sequences provided in this disclosure having 20 or fewer, 19 or fewer, 18 or fewer, 17 or fewer, 16 or fewer, 15 or fewer, 14 or fewer, 13 or fewer, 12 or fewer, 11 or fewer, 10 or fewer, 9 or fewer, 8 or fewer, 7 or fewer, 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer, or 1 or fewer amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.

2.6.2. Excluded V L Sequences

[00150] In some embodiments, the V L sequences provided herein do not comprise certain V L sequences.

[00151] In some aspects, the V L sequence does not comprise, consist of, or consist essentially of a sequence selected from SEQ ID NOs: 331-335. In some aspects, the V L sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 331. In some aspects, the V L sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 332. In some aspects, the V L sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 333. In some aspects, the V L sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 334. In some aspects, the V L sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 335.

2.7. Pairs

2.7.1. CDR-H3 - CDR-L3 Pairs

[00152] In some embodiments, the antibody comprises a CDR-H3 sequence and a

CDR-L3 sequence. In some aspects, the CDR-H3 sequence is part of a V H and the CDR-L3 sequence is part of a V L .

[00153] In some aspects, the CDR-H3 sequence is a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 104-128, and the CDR-L3 sequence is a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 179-203. [00154] In some aspects, the CDR-H3 - CDR-L3 pairs are selected from SEQ ID NO:

104 and SEQ ID NO: 179; SEQ ID NO: 104 and SEQ ID NO: 180; SEQ ID NO: 104 and SEQ ID NO: 181 ; SEQ ID NO: 104 and SEQ ID NO: 182; SEQ ID NO: 104 and SEQ ID NO: 183; SEQ ID NO: 104 and SEQ ID NO: 184; SEQ ID NO: 104 and SEQ ID NO: 185; SEQ ID NO: 104 and SEQ ID NO: 186; SEQ ID NO: 104 and SEQ ID NO: 187; SEQ ID NO: 104 and SEQ ID NO: 188; SEQ ID NO: 104 and SEQ ID NO: 189; SEQ ID NO: 104 and SEQ ID NO: 190; SEQ ID NO: 104 and SEQ ID NO: 191 ; SEQ ID NO: 104 and SEQ ID NO: 192; SEQ ID NO: 104 and SEQ ID NO: 193; SEQ ID NO: 104 and SEQ ID NO: 194; SEQ ID NO: 104 and SEQ ID NO: 195; SEQ ID NO: 104 and SEQ ID NO: 196; SEQ ID NO: 104 and SEQ ID NO: 197; SEQ ID NO: 104 and SEQ ID NO: 198; SEQ ID NO: 104 and SEQ ID NO: 199; SEQ ID NO: 104 and SEQ ID NO: 200; SEQ ID NO: 104 and SEQ ID NO: 201 ; SEQ ID NO: 104 and SEQ ID NO: 202; and SEQ ID NO: 104 and SEQ ID NO: 203.

[00155] In some aspects, the CDR-H3 - CDR-L3 pairs are selected from SEQ ID NO:

105 and SEQ ID NO: 179; SEQ ID NO: 105 and SEQ ID NO: 180; SEQ ID NO: 105 and SEQ ID NO: 181 ; SEQ ID NO: 105 and SEQ ID NO: 182; SEQ ID NO: 105 and SEQ ID NO: 183; SEQ ID NO: 105 and SEQ ID NO: 184; SEQ ID NO: 105 and SEQ ID NO: 185; SEQ ID NO: 105 and SEQ ID NO: 186; SEQ ID NO: 105 and SEQ ID NO: 187; SEQ ID NO: 105 and SEQ ID NO: 188; SEQ ID NO: 105 and SEQ ID NO: 189; SEQ ID NO: 105 and SEQ ID NO: 190; SEQ ID NO: 105 and SEQ ID NO: 191 ; SEQ ID NO: 105 and SEQ ID NO: 192; SEQ ID NO: 105 and SEQ ID NO: 193; SEQ ID NO: 105 and SEQ ID NO: 194; SEQ ID NO: 105 and SEQ ID NO: 195; SEQ ID NO: 105 and SEQ ID NO: 196; SEQ ID NO: 105 and SEQ ID NO: 197; SEQ ID NO: 105 and SEQ ID NO: 198; SEQ ID NO: 105 and SEQ ID NO: 199; SEQ ID NO: 105 and SEQ ID NO: 200; SEQ ID NO: 105 and SEQ ID NO: 201 ; SEQ ID NO: 105 and SEQ ID NO: 202; and SEQ ID NO: 105 and SEQ ID NO: 203.

[00156] In some aspects, the CDR-H3 - CDR-L3 pairs are selected from SEQ ID NO:

106 and SEQ ID NO: 179; SEQ ID NO: 106 and SEQ ID NO: 180; SEQ ID NO: 106 and SEQ ID NO: 181 ; SEQ ID NO: 106 and SEQ ID NO: 182; SEQ ID NO: 106 and SEQ ID NO: 183; SEQ ID NO: 106 and SEQ ID NO: 184; SEQ ID NO: 106 and SEQ ID NO: 185; SEQ ID NO: 106 and SEQ ID NO: 186; SEQ ID NO: 106 and SEQ ID NO: 187; SEQ ID NO: 106 and SEQ ID NO: 188; SEQ ID NO: 106 and SEQ ID NO: 189; SEQ ID NO: 106 and SEQ ID NO: 190; SEQ ID NO: 106 and SEQ ID NO: 191 ; SEQ ID NO: 106 and SEQ ID NO: 192; SEQ ID NO: 106 and SEQ ID NO: 193; SEQ ID NO: 106 and SEQ ID NO: 194; SEQ ID NO: 106 and SEQ ID NO: 195; SEQ ID NO: 106 and SEQ ID NO: 196; SEQ ID NO: 106 and SEQ ID NO: 197; SEQ ID NO: 106 and SEQ ID NO: 198; SEQ ID NO: 106 and SEQ ID NO: 199; SEQ ID NO: 106 and SEQ ID NO: 200; SEQ ID NO: 106 and SEQ ID NO: 201; SEQ ID NO: 106 and SEQ ID NO: 202; and SEQ ID NO: 106 and SEQ ID NO: 203.

[00157] In some aspects, the CDR-H3 - CDR-L3 pairs are selected from SEQ ID NO:

107 and SEQ ID NO: 179; SEQ ID NO: 107 and SEQ ID NO: 180; SEQ ID NO: 107 and SEQ ID NO: 181 ; SEQ ID NO: 107 and SEQ ID NO: 182; SEQ ID NO: 107 and SEQ ID NO: 183; SEQ ID NO: 107 and SEQ ID NO: 184; SEQ ID NO: 107 and SEQ ID NO: 185; SEQ ID NO: 107 and SEQ ID NO: 186; SEQ ID NO: 107 and SEQ ID NO: 187; SEQ ID NO: 107 and SEQ ID NO: 188; SEQ ID NO: 107 and SEQ ID NO: 189; SEQ ID NO: 107 and SEQ ID NO: 190; SEQ ID NO: 107 and SEQ ID NO: 191 ; SEQ ID NO: 107 and SEQ ID NO: 192; SEQ ID NO: 107 and SEQ ID NO: 193; SEQ ID NO: 107 and SEQ ID NO: 194; SEQ ID NO: 107 and SEQ ID NO: 195; SEQ ID NO: 107 and SEQ ID NO: 196; SEQ ID NO: 107 and SEQ ID NO: 197; SEQ ID NO: 107 and SEQ ID NO: 198; SEQ ID NO: 107 and SEQ ID NO: 199; SEQ ID NO: 107 and SEQ ID NO: 200; SEQ ID NO: 107 and SEQ ID NO: 201; SEQ ID NO: 107 and SEQ ID NO: 202; and SEQ ID NO: 107 and SEQ ID NO: 203.

[00158] In some aspects, the CDR-H3 - CDR-L3 pairs are selected from SEQ ID NO:

108 and SEQ ID NO: 179; SEQ ID NO: 108 and SEQ ID NO: 180; SEQ ID NO: 108 and SEQ ID NO: 181 ; SEQ ID NO: 108 and SEQ ID NO: 182; SEQ ID NO: 108 and SEQ ID NO: 183; SEQ ID NO: 108 and SEQ ID NO: 184; SEQ ID NO: 108 and SEQ ID NO: 185; SEQ ID NO: 108 and SEQ ID NO: 186; SEQ ID NO: 108 and SEQ ID NO: 187; SEQ ID NO: 108 and SEQ ID NO: 188; SEQ ID NO: 108 and SEQ ID NO: 189; SEQ ID NO: 108 and SEQ ID NO: 190; SEQ ID NO: 108 and SEQ ID NO: 191 ; SEQ ID NO: 108 and SEQ ID NO: 192; SEQ ID NO: 108 and SEQ ID NO: 193; SEQ ID NO: 108 and SEQ ID NO: 194; SEQ ID NO: 108 and SEQ ID NO: 195; SEQ ID NO: 108 and SEQ ID NO: 196; SEQ ID NO: 108 and SEQ ID NO: 197; SEQ ID NO: 108 and SEQ ID NO: 198; SEQ ID NO: 108 and SEQ ID NO: 199; SEQ ID NO: 108 and SEQ ID NO: 200; SEQ ID NO: 108 and SEQ ID NO: 201; SEQ ID NO: 108 and SEQ ID NO: 202; and SEQ ID NO: 108 and SEQ ID NO: 203.

[00159] In some aspects, the CDR-H3 - CDR-L3 pairs are selected from SEQ ID NO: 109 and SEQ ID NO: 179; SEQ ID NO: 109 and SEQ ID NO: 180; SEQ ID NO: 109 and SEQ ID NO: 181 ; SEQ ID NO: 109 and SEQ ID NO: 182; SEQ ID NO: 109 and SEQ ID NO: 183; SEQ ID NO: 109 and SEQ ID NO: 184; SEQ ID NO: 109 and SEQ ID NO: 185; SEQ ID NO: 109 and SEQ ID NO: 186; SEQ ID NO: 109 and SEQ ID NO: 187; SEQ ID NO: 109 and SEQ ID NO: 188; SEQ ID NO: 109 and SEQ ID NO: 189; SEQ ID NO: 109 and SEQ ID NO: 190; SEQ ID NO: 109 and SEQ ID NO: 191 ; SEQ ID NO: 109 and SEQ ID NO: 192; SEQ ID NO: 109 and SEQ ID NO: 193; SEQ ID NO: 109 and SEQ ID NO: 194; SEQ ID NO: 109 and SEQ ID NO: 195; SEQ ID NO: 109 and SEQ ID NO: 196; SEQ ID NO: 109 and SEQ ID NO: 197; SEQ ID NO: 109 and SEQ ID NO: 198; SEQ ID NO: 109 and SEQ ID NO: 199; SEQ ID NO: 109 and SEQ ID NO: 200; SEQ ID NO: 109 and SEQ ID NO: 201; SEQ ID NO: 109 and SEQ ID NO: 202; and SEQ ID NO: 109 and SEQ ID NO: 203.

[00160] In some aspects, the CDR-H3 - CDR-L3 pairs are selected from SEQ ID NO:

110 and SEQ ID NO: 179; SEQ ID NO: 110 and SEQ ID NO: 180; SEQ ID NO: 110 and SEQ ID NO: 181 ; SEQ ID NO: 110 and SEQ ID NO: 182; SEQ ID NO: 110 and SEQ ID NO: 183; SEQ ID NO: 110 and SEQ ID NO: 184; SEQ ID NO: 110 and SEQ ID NO: 185; SEQ ID NO: 110 and SEQ ID NO: 186; SEQ ID NO: 110 and SEQ ID NO: 187; SEQ ID NO: 110 and SEQ ID NO: 188; SEQ ID NO: 110 and SEQ ID NO: 189; SEQ ID NO: 110 and SEQ ID NO: 190; SEQ ID NO: 110 and SEQ ID NO: 191 ; SEQ ID NO: 110 and SEQ ID NO: 192; SEQ ID NO: 110 and SEQ ID NO: 193; SEQ ID NO: 110 and SEQ ID NO: 194; SEQ ID NO: 110 and SEQ ID NO: 195; SEQ ID NO: 110 and SEQ ID NO: 196; SEQ ID NO: 110 and SEQ ID NO: 197; SEQ ID NO: 110 and SEQ ID NO: 198; SEQ ID NO: 110 and SEQ ID NO: 199; SEQ ID NO: 110 and SEQ ID NO: 200; SEQ ID NO: 110 and SEQ ID NO: 201; SEQ ID NO: 110 and SEQ ID NO: 202; and SEQ ID NO: 110 and SEQ ID NO: 203.

[00161] In some aspects, the CDR-H3 - CDR-L3 pairs are selected from SEQ ID NO:

111 and SEQ ID NO: 179; SEQ ID NO: 111 and SEQ ID NO: 180; SEQ ID NO: 111 and SEQ ID NO: 181 ; SEQ ID NO: 111 and SEQ ID NO: 182; SEQ ID NO: 111 and SEQ ID NO: 183; SEQ ID NO: 111 and SEQ ID NO: 184; SEQ ID NO: 111 and SEQ ID NO: 185; SEQ ID NO: 111 and SEQ ID NO: 186; SEQ ID NO: 111 and SEQ ID NO: 187; SEQ ID NO: 111 and SEQ ID NO: 188; SEQ ID NO: 111 and SEQ ID NO: 189; SEQ ID NO: 111 and SEQ ID NO: 190; SEQ ID NO: 111 and SEQ ID NO: 191 ; SEQ ID NO: 111 and SEQ ID NO: 192; SEQ ID NO: 111 and SEQ ID NO: 193; SEQ ID NO: 111 and SEQ ID NO: 194; SEQ ID NO: 111 and SEQ ID NO: 195; SEQ ID NO: 111 and SEQ ID NO: 196; SEQ ID NO: 111 and SEQ ID NO: 197; SEQ ID NO: 111 and SEQ ID NO: 198; SEQ ID NO: 111 and SEQ ID NO: 199; SEQ ID NO: 111 and SEQ ID NO: 200; SEQ ID NO: 111 and SEQ ID NO: 201; SEQ ID NO: 111 and SEQ ID NO: 202; and SEQ ID NO: 111 and SEQ ID NO: 203.

[00162] In some aspects, the CDR-H3 - CDR-L3 pairs are selected from SEQ ID NO:

112 and SEQ ID NO: 179; SEQ ID NO: 112 and SEQ ID NO: 180; SEQ ID NO: 112 and SEQ ID NO: 181 ; SEQ ID NO: 112 and SEQ ID NO: 182; SEQ ID NO: 112 and SEQ ID NO: 183; SEQ ID NO: 112 and SEQ ID NO: 184; SEQ ID NO: 112 and SEQ ID NO: 185; SEQ ID NO: 112 and SEQ ID NO: 186; SEQ ID NO: 112 and SEQ ID NO: 187; SEQ ID NO: 112 and SEQ ID NO: 188; SEQ ID NO: 112 and SEQ ID NO: 189; SEQ ID NO: 112 and SEQ ID NO: 190; SEQ ID NO: 112 and SEQ ID NO: 191 ; SEQ ID NO: 112 and SEQ ID NO: 192; SEQ ID NO: 112 and SEQ ID NO: 193; SEQ ID NO: 112 and SEQ ID NO: 194; SEQ ID NO: 112 and SEQ ID NO: 195; SEQ ID NO: 112 and SEQ ID NO: 196; SEQ ID NO: 112 and SEQ ID NO: 197; SEQ ID NO: 112 and SEQ ID NO: 198; SEQ ID NO: 112 and SEQ ID NO: 199; SEQ ID NO: 112 and SEQ ID NO: 200; SEQ ID NO: 112 and SEQ ID NO: 201; SEQ ID NO: 112 and SEQ ID NO: 202; and SEQ ID NO: 112 and SEQ ID NO: 203.

[00163] In some aspects, the CDR-H3 - CDR-L3 pairs are selected from SEQ ID NO:

113 and SEQ ID NO: 179; SEQ ID NO: 113 and SEQ ID NO: 180; SEQ ID NO: 113 and SEQ ID NO: 181 ; SEQ ID NO: 113 and SEQ ID NO: 182; SEQ ID NO: 113 and SEQ ID NO: 183; SEQ ID NO: 113 and SEQ ID NO: 184; SEQ ID NO: 113 and SEQ ID NO: 185; SEQ ID NO: 113 and SEQ ID NO: 186; SEQ ID NO: 113 and SEQ ID NO: 187; SEQ ID NO: 113 and SEQ ID NO: 188; SEQ ID NO: 113 and SEQ ID NO: 189; SEQ ID NO: 113 and SEQ ID NO: 190; SEQ ID NO: 113 and SEQ ID NO: 191 ; SEQ ID NO: 113 and SEQ ID NO: 192; SEQ ID NO: 113 and SEQ ID NO: 193; SEQ ID NO: 113 and SEQ ID NO: 194; SEQ ID NO: 113 and SEQ ID NO: 195; SEQ ID NO: 113 and SEQ ID NO: 196; SEQ ID NO: 113 and SEQ ID NO: 197; SEQ ID NO: 113 and SEQ ID NO: 198; SEQ ID NO: 113 and SEQ ID NO: 199; SEQ ID NO: 113 and SEQ ID NO: 200; SEQ ID NO: 113 and SEQ ID NO: 201; SEQ ID NO: 113 and SEQ ID NO: 202; and SEQ ID NO: 113 and SEQ ID NO: 203.

[00164] In some aspects, the CDR-H3 - CDR-L3 pairs are selected from SEQ ID NO:

114 and SEQ ID NO: 179; SEQ ID NO: 114 and SEQ ID NO: 180; SEQ ID NO: 114 and SEQ ID NO: 181 ; SEQ ID NO: 114 and SEQ ID NO: 182; SEQ ID NO: 114 and SEQ ID NO: 183; SEQ ID NO: 114 and SEQ ID NO: 184; SEQ ID NO: 114 and SEQ ID NO: 185; SEQ ID NO: 114 and SEQ ID NO: 186; SEQ ID NO: 114 and SEQ ID NO: 187; SEQ ID NO: 114 and SEQ ID NO: 188; SEQ ID NO: 114 and SEQ ID NO: 189; SEQ ID NO: 114 and SEQ ID NO: 190; SEQ ID NO: 114 and SEQ ID NO: 191 ; SEQ ID NO: 114 and SEQ ID NO: 192; SEQ ID NO: 114 and SEQ ID NO: 193; SEQ ID NO: 114 and SEQ ID NO: 194; SEQ ID NO: 114 and SEQ ID NO: 195; SEQ ID NO: 114 and SEQ ID NO: 196; SEQ ID NO: 114 and SEQ ID NO: 197; SEQ ID NO: 114 and SEQ ID NO: 198; SEQ ID NO: 114 and SEQ ID NO: 199; SEQ ID NO: 114 and SEQ ID NO: 200; SEQ ID NO: 114 and SEQ ID NO: 201; SEQ ID NO: 114 and SEQ ID NO: 202; and SEQ ID NO: 114 and SEQ ID NO: 203.

[00165] In some aspects, the CDR-H3 - CDR-L3 pairs are selected from SEQ ID NO:

115 and SEQ ID NO: 179; SEQ ID NO: 115 and SEQ ID NO: 180; SEQ ID NO: 115 and SEQ ID NO: 181 ; SEQ ID NO: 115 and SEQ ID NO: 182; SEQ ID NO: 115 and SEQ ID NO: 183; SEQ ID NO: 115 and SEQ ID NO: 184; SEQ ID NO: 115 and SEQ ID NO: 185; SEQ ID NO: 115 and SEQ ID NO: 186; SEQ ID NO: 115 and SEQ ID NO: 187; SEQ ID NO: 115 and SEQ ID NO: 188; SEQ ID NO: 115 and SEQ ID NO: 189; SEQ ID NO: 115 and SEQ ID NO: 190; SEQ ID NO: 115 and SEQ ID NO: 191 ; SEQ ID NO: 115 and SEQ ID NO: 192; SEQ ID NO: 115 and SEQ ID NO: 193; SEQ ID NO: 115 and SEQ ID NO: 194; SEQ ID NO: 115 and SEQ ID NO: 195; SEQ ID NO: 115 and SEQ ID NO: 196; SEQ ID NO: 115 and SEQ ID NO: 197; SEQ ID NO: 115 and SEQ ID NO: 198; SEQ ID NO: 115 and SEQ ID NO: 199; SEQ ID NO: 115 and SEQ ID NO: 200; SEQ ID NO: 115 and SEQ ID NO: 201; SEQ ID NO: 115 and SEQ ID NO: 202; and SEQ ID NO: 115 and SEQ ID NO: 203.

[00166] In some aspects, the CDR-H3 - CDR-L3 pairs are selected from SEQ ID NO:

116 and SEQ ID NO: 179; SEQ ID NO: 116 and SEQ ID NO: 180; SEQ ID NO: 116 and SEQ ID NO: 181 ; SEQ ID NO: 116 and SEQ ID NO: 182; SEQ ID NO: 116 and SEQ ID NO: 183; SEQ ID NO: 116 and SEQ ID NO: 184; SEQ ID NO: 116 and SEQ ID NO: 185; SEQ ID NO: 116 and SEQ ID NO: 186; SEQ ID NO: 116 and SEQ ID NO: 187; SEQ ID NO: 116 and SEQ ID NO: 188; SEQ ID NO: 116 and SEQ ID NO: 189; SEQ ID NO: 116 and SEQ ID NO: 190; SEQ ID NO: 116 and SEQ ID NO: 191 ; SEQ ID NO: 116 and SEQ ID NO: 192; SEQ ID NO: 116 and SEQ ID NO: 193; SEQ ID NO: 116 and SEQ ID NO: 194; SEQ ID NO: 116 and SEQ ID NO: 195; SEQ ID NO: 116 and SEQ ID NO: 196; SEQ ID NO: 116 and SEQ ID NO: 197; SEQ ID NO: 116 and SEQ ID NO: 198; SEQ ID NO: 116 and SEQ ID NO: 199; SEQ ID NO: 116 and SEQ ID NO: 200; SEQ ID NO: 116 and SEQ ID NO: 201; SEQ ID NO: 116 and SEQ ID NO: 202; and SEQ ID NO: 116 and SEQ ID NO: 203.

[00167] In some aspects, the CDR-H3 - CDR-L3 pairs are selected from SEQ ID NO:

117 and SEQ ID NO: 179; SEQ ID NO: 117 and SEQ ID NO: 180; SEQ ID NO: 117 and SEQ ID NO: 181 ; SEQ ID NO: 117 and SEQ ID NO: 182; SEQ ID NO: 117 and SEQ ID NO: 183; SEQ ID NO: 117 and SEQ ID NO: 184; SEQ ID NO: 117 and SEQ ID NO: 185; SEQ ID NO: 117 and SEQ ID NO: 186; SEQ ID NO: 117 and SEQ ID NO: 187; SEQ ID NO: 117 and SEQ ID NO: 188; SEQ ID NO: 117 and SEQ ID NO: 189; SEQ ID NO: 117 and SEQ ID NO: 190; SEQ ID NO: 117 and SEQ ID NO: 191 ; SEQ ID NO: 117 and SEQ ID NO: 192; SEQ ID NO: 117 and SEQ ID NO: 193; SEQ ID NO: 117 and SEQ ID NO: 194; SEQ ID NO: 117 and SEQ ID NO: 195; SEQ ID NO: 117 and SEQ ID NO: 196; SEQ ID NO: 117 and SEQ ID NO: 197; SEQ ID NO: 117 and SEQ ID NO: 198; SEQ ID NO: 117 and SEQ ID NO: 199; SEQ ID NO: 117 and SEQ ID NO: 200; SEQ ID NO: 117 and SEQ ID NO: 201; SEQ ID NO: 117 and SEQ ID NO: 202; and SEQ ID NO: 117 and SEQ ID NO: 203.

[00168] In some aspects, the CDR-H3 - CDR-L3 pairs are selected from SEQ ID NO:

118 and SEQ ID NO: 179; SEQ ID NO: 118 and SEQ ID NO: 180; SEQ ID NO: 118 and SEQ ID NO: 181 ; SEQ ID NO: 118 and SEQ ID NO: 182; SEQ ID NO: 118 and SEQ ID NO: 183; SEQ ID NO: 118 and SEQ ID NO: 184; SEQ ID NO: 118 and SEQ ID NO: 185; SEQ ID NO: 118 and SEQ ID NO: 186; SEQ ID NO: 118 and SEQ ID NO: 187; SEQ ID NO: 118 and SEQ ID NO: 188; SEQ ID NO: 118 and SEQ ID NO: 189; SEQ ID NO: 118 and SEQ ID NO: 190; SEQ ID NO: 118 and SEQ ID NO: 191 ; SEQ ID NO: 118 and SEQ ID NO: 192; SEQ ID NO: 118 and SEQ ID NO: 193; SEQ ID NO: 118 and SEQ ID NO: 194; SEQ ID NO: 118 and SEQ ID NO: 195; SEQ ID NO: 118 and SEQ ID NO: 196; SEQ ID NO: 118 and SEQ ID NO: 197; SEQ ID NO: 118 and SEQ ID NO: 198; SEQ ID NO: 118 and SEQ ID NO: 199; SEQ ID NO: 118 and SEQ ID NO: 200; SEQ ID NO: 118 and SEQ ID NO: 201; SEQ ID NO: 118 and SEQ ID NO: 202; and SEQ ID NO: 118 and SEQ ID NO: 203.

[00169] In some aspects, the CDR-H3 - CDR-L3 pairs are selected from SEQ ID NO:

119 and SEQ ID NO: 179; SEQ ID NO: 119 and SEQ ID NO: 180; SEQ ID NO: 119 and SEQ ID NO: 181 ; SEQ ID NO: 119 and SEQ ID NO: 182; SEQ ID NO: 119 and SEQ ID NO: 183; SEQ ID NO: 119 and SEQ ID NO: 184; SEQ ID NO: 119 and SEQ ID NO: 185; SEQ ID NO: 119 and SEQ ID NO: 186; SEQ ID NO: 119 and SEQ ID NO: 187; SEQ ID NO: 119 and SEQ ID NO: 188; SEQ ID NO: 119 and SEQ ID NO: 189; SEQ ID NO: 119 and SEQ ID NO: 190; SEQ ID NO: 119 and SEQ ID NO: 191 ; SEQ ID NO: 119 and SEQ ID NO: 192; SEQ ID NO: 119 and SEQ ID NO: 193; SEQ ID NO: 119 and SEQ ID NO: 194; SEQ ID NO: 119 and SEQ ID NO: 195; SEQ ID NO: 119 and SEQ ID NO: 196; SEQ ID NO: 119 and SEQ ID NO: 197; SEQ ID NO: 119 and SEQ ID NO: 198; SEQ ID NO: 119 and SEQ ID NO: 199; SEQ ID NO: 119 and SEQ ID NO: 200; SEQ ID NO: 119 and SEQ ID NO: 201; SEQ ID NO: 119 and SEQ ID NO: 202; and SEQ ID NO: 119 and SEQ ID NO: 203.

[00170] In some aspects, the CDR-H3 - CDR-L3 pairs are selected from SEQ ID NO:

120 and SEQ ID NO: 179; SEQ ID NO: 120 and SEQ ID NO: 180; SEQ ID NO: 120 and SEQ ID NO: 181 ; SEQ ID NO: 120 and SEQ ID NO: 182; SEQ ID NO: 120 and SEQ ID NO: 183; SEQ ID NO: 120 and SEQ ID NO: 184; SEQ ID NO: 120 and SEQ ID NO: 185; SEQ ID NO: 120 and SEQ ID NO: 186; SEQ ID NO: 120 and SEQ ID NO: 187; SEQ ID NO: 120 and SEQ ID NO: 188; SEQ ID NO: 120 and SEQ ID NO: 189; SEQ ID NO: 120 and SEQ ID NO: 190; SEQ ID NO: 120 and SEQ ID NO: 191 ; SEQ ID NO: 120 and SEQ ID NO: 192; SEQ ID NO: 120 and SEQ ID NO: 193; SEQ ID NO: 120 and SEQ ID NO: 194; SEQ ID NO: 120 and SEQ ID NO: 195; SEQ ID NO: 120 and SEQ ID NO: 196; SEQ ID NO: 120 and SEQ ID NO: 197; SEQ ID NO: 120 and SEQ ID NO: 198; SEQ ID NO: 120 and SEQ ID NO: 199; SEQ ID NO: 120 and SEQ ID NO: 200; SEQ ID NO: 120 and SEQ ID NO: 201; SEQ ID NO: 120 and SEQ ID NO: 202; and SEQ ID NO: 120 and SEQ ID NO: 203.

[00171] In some aspects, the CDR-H3 - CDR-L3 pairs are selected from SEQ ID NO:

121 and SEQ ID NO: 179; SEQ ID NO: 121 and SEQ ID NO: 180; SEQ ID NO: 121 and SEQ ID NO: 181 ; SEQ ID NO: 121 and SEQ ID NO: 182; SEQ ID NO: 121 and SEQ ID NO: 183; SEQ ID NO: 121 and SEQ ID NO: 184; SEQ ID NO: 121 and SEQ ID NO: 185; SEQ ID NO: 121 and SEQ ID NO: 186; SEQ ID NO: 121 and SEQ ID NO: 187; SEQ ID NO: 121 and SEQ ID NO: 188; SEQ ID NO: 121 and SEQ ID NO: 189; SEQ ID NO: 121 and SEQ ID NO: 190; SEQ ID NO: 121 and SEQ ID NO: 191 ; SEQ ID NO: 121 and SEQ ID NO: 192; SEQ ID NO: 121 and SEQ ID NO: 193; SEQ ID NO: 121 and SEQ ID NO: 194; SEQ ID NO: 121 and SEQ ID NO: 195; SEQ ID NO: 121 and SEQ ID NO: 196; SEQ ID NO: 121 and SEQ ID NO: 197; SEQ ID NO: 121 and SEQ ID NO: 198; SEQ ID NO: 121 and SEQ ID NO: 199; SEQ ID NO: 121 and SEQ ID NO: 200; SEQ ID NO: 121 and SEQ ID NO: 201; SEQ ID NO: 121 and SEQ ID NO: 202; and SEQ ID NO: 121 and SEQ ID NO: 203.

[00172] In some aspects, the CDR-H3 - CDR-L3 pairs are selected from SEQ ID NO:

122 and SEQ ID NO: 179; SEQ ID NO: 122 and SEQ ID NO: 180; SEQ ID NO: 122 and SEQ ID NO: 181 ; SEQ ID NO: 122 and SEQ ID NO: 182; SEQ ID NO: 122 and SEQ ID NO: 183; SEQ ID NO: 122 and SEQ ID NO: 184; SEQ ID NO: 122 and SEQ ID NO: 185; SEQ ID NO: 122 and SEQ ID NO: 186; SEQ ID NO: 122 and SEQ ID NO: 187; SEQ ID NO: 122 and SEQ ID NO: 188; SEQ ID NO: 122 and SEQ ID NO: 189; SEQ ID NO: 122 and SEQ ID NO: 190; SEQ ID NO: 122 and SEQ ID NO: 191 ; SEQ ID NO: 122 and SEQ ID NO: 192; SEQ ID NO: 122 and SEQ ID NO: 193; SEQ ID NO: 122 and SEQ ID NO: 194; SEQ ID NO: 122 and SEQ ID NO: 195; SEQ ID NO: 122 and SEQ ID NO: 196; SEQ ID NO: 122 and SEQ ID NO: 197; SEQ ID NO: 122 and SEQ ID NO: 198; SEQ ID NO: 122 and SEQ ID NO: 199; SEQ ID NO: 122 and SEQ ID NO: 200; SEQ ID NO: 122 and SEQ ID NO: 201; SEQ ID NO: 122 and SEQ ID NO: 202; and SEQ ID NO: 122 and SEQ ID NO: 203.

[00173] In some aspects, the CDR-H3 - CDR-L3 pairs are selected from SEQ ID NO:

123 and SEQ ID NO: 179; SEQ ID NO: 123 and SEQ ID NO: 180; SEQ ID NO: 123 and SEQ ID NO: 181 ; SEQ ID NO: 123 and SEQ ID NO: 182; SEQ ID NO: 123 and SEQ ID NO: 183; SEQ ID NO: 123 and SEQ ID NO: 184; SEQ ID NO: 123 and SEQ ID NO: 185; SEQ ID NO: 123 and SEQ ID NO: 186; SEQ ID NO: 123 and SEQ ID NO: 187; SEQ ID NO: 123 and SEQ ID NO: 188; SEQ ID NO: 123 and SEQ ID NO: 189; SEQ ID NO: 123 and SEQ ID NO: 190; SEQ ID NO: 123 and SEQ ID NO: 191 ; SEQ ID NO: 123 and SEQ ID NO: 192; SEQ ID NO: 123 and SEQ ID NO: 193; SEQ ID NO: 123 and SEQ ID NO: 194; SEQ ID NO: 123 and SEQ ID NO: 195; SEQ ID NO: 123 and SEQ ID NO: 196; SEQ ID NO: 123 and SEQ ID NO: 197; SEQ ID NO: 123 and SEQ ID NO: 198; SEQ ID NO: 123 and SEQ ID NO: 199; SEQ ID NO: 123 and SEQ ID NO: 200; SEQ ID NO: 123 and SEQ ID NO: 201; SEQ ID NO: 123 and SEQ ID NO: 202; and SEQ ID NO: 123 and SEQ ID NO: 203.

[00174] In some aspects, the CDR-H3 - CDR-L3 pairs are selected from SEQ ID NO:

124 and SEQ ID NO: 179; SEQ ID NO: 124 and SEQ ID NO: 180; SEQ ID NO: 124 and SEQ ID NO: 181 ; SEQ ID NO: 124 and SEQ ID NO: 182; SEQ ID NO: 124 and SEQ ID NO: 183; SEQ ID NO: 124 and SEQ ID NO: 184; SEQ ID NO: 124 and SEQ ID NO: 185; SEQ ID NO: 124 and SEQ ID NO: 186; SEQ ID NO: 124 and SEQ ID NO: 187; SEQ ID NO: 124 and SEQ ID NO: 188; SEQ ID NO: 124 and SEQ ID NO: 189; SEQ ID NO: 124 and SEQ ID NO: 190; SEQ ID NO: 124 and SEQ ID NO: 191 ; SEQ ID NO: 124 and SEQ ID NO: 192; SEQ ID NO: 124 and SEQ ID NO: 193; SEQ ID NO: 124 and SEQ ID NO: 194; SEQ ID NO: 124 and SEQ ID NO: 195; SEQ ID NO: 124 and SEQ ID NO: 196; SEQ ID NO: 124 and SEQ ID NO: 197; SEQ ID NO: 124 and SEQ ID NO: 198; SEQ ID NO: 124 and SEQ ID NO: 199; SEQ ID NO: 124 and SEQ ID NO: 200; SEQ ID NO: 124 and SEQ ID NO: 201; SEQ ID NO: 124 and SEQ ID NO: 202; and SEQ ID NO: 124 and SEQ ID NO: 203.

[00175] In some aspects, the CDR-H3 - CDR-L3 pairs are selected from SEQ ID NO:

125 and SEQ ID NO: 179; SEQ ID NO: 125 and SEQ ID NO: 180; SEQ ID NO: 125 and SEQ ID NO: 181 ; SEQ ID NO: 125 and SEQ ID NO: 182; SEQ ID NO: 125 and SEQ ID NO: 183; SEQ ID NO: 125 and SEQ ID NO: 184; SEQ ID NO: 125 and SEQ ID NO: 185; SEQ ID NO: 125 and SEQ ID NO: 186; SEQ ID NO: 125 and SEQ ID NO: 187; SEQ ID NO: 125 and SEQ ID NO: 188; SEQ ID NO: 125 and SEQ ID NO: 189; SEQ ID NO: 125 and SEQ ID NO: 190; SEQ ID NO: 125 and SEQ ID NO: 191 ; SEQ ID NO: 125 and SEQ ID NO: 192; SEQ ID NO: 125 and SEQ ID NO: 193; SEQ ID NO: 125 and SEQ ID NO: 194; SEQ ID NO: 125 and SEQ ID NO: 195; SEQ ID NO: 125 and SEQ ID NO: 196; SEQ ID NO: 125 and SEQ ID NO: 197; SEQ ID NO: 125 and SEQ ID NO: 198; SEQ ID NO: 125 and SEQ ID NO: 199; SEQ ID NO: 125 and SEQ ID NO: 200; SEQ ID NO: 125 and SEQ ID NO: 201; SEQ ID NO: 125 and SEQ ID NO: 202; and SEQ ID NO: 125 and SEQ ID NO: 203.

[00176] In some aspects, the CDR-H3 - CDR-L3 pairs are selected from SEQ ID NO:

126 and SEQ ID NO: 179; SEQ ID NO: 126 and SEQ ID NO: 180; SEQ ID NO: 126 and SEQ ID NO: 181 ; SEQ ID NO: 126 and SEQ ID NO: 182; SEQ ID NO: 126 and SEQ ID NO: 183; SEQ ID NO: 126 and SEQ ID NO: 184; SEQ ID NO: 126 and SEQ ID NO: 185; SEQ ID NO: 126 and SEQ ID NO: 186; SEQ ID NO: 126 and SEQ ID NO: 187; SEQ ID NO: 126 and SEQ ID NO: 188; SEQ ID NO: 126 and SEQ ID NO: 189; SEQ ID NO: 126 and SEQ ID NO: 190; SEQ ID NO: 126 and SEQ ID NO: 191 ; SEQ ID NO: 126 and SEQ ID NO: 192; SEQ ID NO: 126 and SEQ ID NO: 193; SEQ ID NO: 126 and SEQ ID NO: 194; SEQ ID NO: 126 and SEQ ID NO: 195; SEQ ID NO: 126 and SEQ ID NO: 196; SEQ ID NO: 126 and SEQ ID NO: 197; SEQ ID NO: 126 and SEQ ID NO: 198; SEQ ID NO: 126 and SEQ ID NO: 199; SEQ ID NO: 126 and SEQ ID NO: 200; SEQ ID NO: 126 and SEQ ID NO: 201; SEQ ID NO: 126 and SEQ ID NO: 202; and SEQ ID NO: 126 and SEQ ID NO: 203.

[00177] In some aspects, the CDR-H3 - CDR-L3 pairs are selected from SEQ ID NO:

127 and SEQ ID NO: 179; SEQ ID NO: 127 and SEQ ID NO: 180; SEQ ID NO: 127 and SEQ ID NO: 181; SEQ ID NO: 127 and SEQ ID NO: 182; SEQ ID NO: 127 and SEQ ID NO: 183; SEQ ID NO: 127 and SEQ ID NO: 184; SEQ ID NO: 127 and SEQ ID NO: 185; SEQ ID NO: 127 and SEQ ID NO: 186; SEQ ID NO: 127 and SEQ ID NO: 187; SEQ ID NO: 127 and SEQ ID NO: 188; SEQ ID NO: 127 and SEQ ID NO: 189; SEQ ID NO: 127 and SEQ ID NO: 190; SEQ ID NO: 127 and SEQ ID NO: 191; SEQ ID NO: 127 and SEQ ID NO: 192; SEQ ID NO: 127 and SEQ ID NO: 193; SEQ ID NO: 127 and SEQ ID NO: 194; SEQ ID NO: 127 and SEQ ID NO: 195; SEQ ID NO: 127 and SEQ ID NO: 196; SEQ ID NO: 127 and SEQ ID NO: 197; SEQ ID NO: 127 and SEQ ID NO: 198; SEQ ID NO: 127 and SEQ ID NO: 199; SEQ ID NO: 127 and SEQ ID NO: 200; SEQ ID NO: 127 and SEQ ID NO: 201; SEQ ID NO: 127 and SEQ ID NO: 202; and SEQ ID NO: 127 and SEQ ID NO: 203.

[00178] In some aspects, the CDR-H3 - CDR-L3 pairs are selected from SEQ ID NO:

128 and SEQ ID NO: 179; SEQ ID NO: 128 and SEQ ID NO: 180; SEQ ID NO: 128 and SEQ ID NO: 181; SEQ ID NO: 128 and SEQ ID NO: 182; SEQ ID NO: 128 and SEQ ID NO: 183; SEQ ID NO: 128 and SEQ ID NO: 184; SEQ ID NO: 128 and SEQ ID NO: 185; SEQ ID NO: 128 and SEQ ID NO: 186; SEQ ID NO: 128 and SEQ ID NO: 187; SEQ ID NO: 128 and SEQ ID NO: 188; SEQ ID NO: 128 and SEQ ID NO: 189; SEQ ID NO: 128 and SEQ ID NO: 190; SEQ ID NO: 128 and SEQ ID NO: 191; SEQ ID NO: 128 and SEQ ID NO: 192; SEQ ID NO: 128 and SEQ ID NO: 193; SEQ ID NO: 128 and SEQ ID NO: 194; SEQ ID NO: 128 and SEQ ID NO: 195; SEQ ID NO: 128 and SEQ ID NO: 196; SEQ ID NO: 128 and SEQ ID NO: 197; SEQ ID NO: 128 and SEQ ID NO: 198; SEQ ID NO: 128 and SEQ ID NO: 199; SEQ ID NO: 128 and SEQ ID NO: 200; SEQ ID NO: 128 and SEQ ID NO: 201; SEQ ID NO: 128 and SEQ ID NO: 202; and SEQ ID NO: 128 and SEQ ID NO: 203.

2.7.1.1. Variants of CDR-H3 - CDR-L3 Pairs

[00179] In some embodiments, the CDR-H3 - CDR-L3 pairs provided herein comprise a variant of an illustrative CDR-H3 and/or CDR-L1 sequence provided in this disclosure. [00180] In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-H3 sequence provided in this disclosure. In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-H3 sequences provided in this disclosure. In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-H3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.

[00181] In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L3 sequence provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L3 sequences provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.

2.7.1.2. Excluded CDR-H3 - CDR-L3 Pairs

[00182] In some embodiments, the CDR-H3 - CDR-L3 pairs provided herein do not comprise certain CDR-H3 - CDR-L3 pairs.

[00183] In some aspects, the CDR-H3 sequence is not selected from SEQ ID NOs:

306-310, and the CDR-L3 sequence is not selected from SEQ ID NOs: 321-325.

[00184] In some aspects, the CDR-H3 - CDR-L3 pairs are not selected from SEQ ID

NO: 306 and SEQ ID NO: 321; SEQ ID NO: 306 and SEQ ID NO: 322; SEQ ID NO: 306 and SEQ ID NO: 323; SEQ ID NO: 306 and SEQ ID NO: 324; and SEQ ID NO: 306 and SEQ ID NO: 325.

[00185] In some aspects, the CDR-H3 - CDR-L3 pairs are not selected from SEQ ID

NO: 307 and SEQ ID NO: 321; SEQ ID NO: 307 and SEQ ID NO: 322; SEQ ID NO: 307 and SEQ ID NO: 323; SEQ ID NO: 307 and SEQ ID NO: 324; and SEQ ID NO: 307 and SEQ ID NO: 325.

[00186] In some aspects, the CDR-H3 - CDR-L3 pairs are not selected from SEQ ID

NO: 308 and SEQ ID NO: 321; SEQ ID NO: 308 and SEQ ID NO: 322; SEQ ID NO: 308 and SEQ ID NO: 323; SEQ ID NO: 308 and SEQ ID NO: 324; and SEQ ID NO: 308 and SEQ ID NO: 325.

[00187] In some aspects, the CDR-H3 - CDR-L3 pairs are not selected from SEQ ID

NO: 309 and SEQ ID NO: 321; SEQ ID NO: 309 and SEQ ID NO: 322; SEQ ID NO: 309 and SEQ ID NO: 323; SEQ ID NO: 309 and SEQ ID NO: 324; and SEQ ID NO: 309 and SEQ ID NO: 325.

[00188] In some aspects, the CDR-H3 - CDR-L3 pairs are not selected from SEQ ID

NO: 310 and SEQ ID NO: 321; SEQ ID NO: 310 and SEQ ID NO: 322; SEQ ID NO: 310 and SEQ ID NO: 323; SEQ ID NO: 310 and SEQ ID NO: 324; and SEQ ID NO: 310 and SEQ ID NO: 325.

2.7.2. CDR-Hl - CDR-L1 Pairs

[00189] In some embodiments, the antibody comprises a CDR-Hl sequence and a

CDR-L1 sequence. In some aspects, the CDR-Hl sequence is part of a VH and the CDR-L1 sequence is part of a VL .

[00190] In some aspects, the CDR-Hl sequence is a Chothia CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 4-28, and the CDR-L1 sequence is a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 129-153.

[00191] In some aspects, the CDR-Hl sequence is a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 29-53, and the CDR-L1 sequence is a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 129-153.

2.7.2.1. Variants of CDR-Hl - CDR-L1 Pairs

[00192] In some embodiments, the CDR-Hl - CDR-L1 pairs provided herein comprise a variant of an illustrative CDR-Hl and/or CDR-L1 sequence provided in this disclosure.

[00193] In some aspects, the CDR-Hl sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-Hl sequence provided in this disclosure. In some aspects, the CDR-Hl sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-Hl sequences provided in this disclosure. In some aspects, the CDR-Hl sequence comprises, consists of, or consists essentially of any of the illustrative CDR-Hl sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.

[00194] In some aspects, the CDR-Ll sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-Ll sequence provided in this disclosure. In some aspects, the CDR-Ll sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-Ll sequences provided in this disclosure. In some aspects, the CDR-Ll sequence comprises, consists of, or consists essentially of any of the illustrative CDR-Ll sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.

2.7.2.2. Excluded CDR-Hl - CDR-Ll Pairs

[00195] In some embodiments, the CDR-Hl - CDR-Ll pairs provided herein do not comprise certain CDR-Hl - CDR-Ll pairs.

[00196] In some aspects, the Chothia CDR-Hl sequence is not selected from SEQ ID

NOs: 286-290, and the CDR-Ll sequence is not selected from SEQ ID NOs: 311-315. In some aspects, the Kabat CDR-Hl sequence is not selected from SEQ ID NOs: 290-295, and the CDR-Ll sequence is not selected from SEQ ID NOs: 311-315.

2.7.3. CDR-H2 - CDR-L2 Pairs

[00197] In some embodiments, the antibody comprises a CDR-H2 sequence and a

CDR-L2 sequence. In some aspects, the CDR-H2 sequence is part of a VH and the CDR-L2 sequence is part of a VL .

[00198] In some aspects, the CDR-H2 sequence is a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 54-78, and the CDR-L2 sequence is a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 154-178.

[00199] In some aspects, the CDR-Hl sequence is a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 79-103, and the CDR-L2 sequence is a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 154-178.

2.7.3.1. Variants of CDR-H2 - CDR-L2 Pairs

[00200] In some embodiments, the CDR-H2 - CDR-L2 pairs provided herein comprise a variant of an illustrative CDR-H2 and/or CDR-L2 sequence provided in this disclosure. [00201] In some aspects, the CDR-H2 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-H2 sequence provided in this disclosure. In some aspects, the CDR-H2 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-H2 sequences provided in this disclosure. In some aspects, the CDR-H2 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-H2 sequences provided in this disclosure, with 1 , 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.

[00202] In some aspects, the CDR-L2 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L2 sequence provided in this disclosure. In some aspects, the CDR-L2 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L2 sequences provided in this disclosure. In some aspects, the CDR-L2 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L2 sequences provided in this disclosure, with 1 , 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.

2.7.3.2. Excluded CDR-H2 - CDR-L2 Pairs

[00203] In some embodiments, the CDR-H2 - CDR-L2 pairs provided herein do not comprise certain CDR-H2 - CDR-L2 pairs.

[00204] In some aspects, the Chothia CDR-H2 sequence is not selected from SEQ ID

NOs: 296-300, and the CDR-L2 sequence is not selected from SEQ ID NOs: 316-320. In some aspects, the Kabat CDR-H2 sequence is not selected from SEQ ID NOs: 301-305, and the CDR-L2 sequence is not selected from SEQ ID NOs: 316-320.

2.7.4. V H - V L Pairs

[00205] In some embodiments, the antibody comprises a VH sequence and a VL sequence.

[00206] In some aspects, the VH sequence is a VH sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 229-253, and the VL sequence is a VL sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 254-278.

[00207] In some aspects, the V H - V L pairs are selected from SEQ ID NO: 229 and

SEQ ID NO: 254; SEQ ID NO: 229 and SEQ ID NO: 255; SEQ ID NO: 229 and SEQ ID NO: 256; SEQ ID NO: 229 and SEQ ID NO: 257; SEQ ID NO: 229 and SEQ ID NO: 258; SEQ ID NO: 229 and SEQ ID NO: 259; SEQ ID NO: 229 and SEQ ID NO: 260; SEQ ID NO: 229 and SEQ ID NO: 261 ; SEQ ID NO: 229 and SEQ ID NO: 262; SEQ ID NO: 229 and SEQ ID NO: 263; SEQ ID NO: 229 and SEQ ID NO: 264; SEQ ID NO: 229 and SEQ ID NO: 265; SEQ ID NO: 229 and SEQ ID NO: 266; SEQ ID NO: 229 and SEQ ID NO: 267; SEQ ID NO: 229 and SEQ ID NO: 268; SEQ ID NO: 229 and SEQ ID NO: 269; SEQ ID NO: 229 and SEQ ID NO: 270; SEQ ID NO: 229 and SEQ ID NO: 271 ; SEQ ID NO: 229 and SEQ ID NO: 272; SEQ ID NO: 229 and SEQ ID NO: 273; SEQ ID NO: 229 and SEQ ID NO: 274; SEQ ID NO: 229 and SEQ ID NO: 275; SEQ ID NO: 229 and SEQ ID NO: 276; SEQ ID NO: 229 and SEQ ID NO: 277; and SEQ ID NO: 229 and SEQ ID NO: 278.

[00208] In some aspects, the V H - VL pairs are selected from SEQ ID NO: 230 and

SEQ ID NO: 254; SEQ ID NO: 230 and SEQ ID NO: 255; SEQ ID NO: 230 and SEQ ID NO: 256; SEQ ID NO: 230 and SEQ ID NO: 257; SEQ ID NO: 230 and SEQ ID NO: 258; SEQ ID NO: 230 and SEQ ID NO: 259; SEQ ID NO: 230 and SEQ ID NO: 260; SEQ ID NO: 230 and SEQ ID NO: 261 ; SEQ ID NO: 230 and SEQ ID NO: 262; SEQ ID NO: 230 and SEQ ID NO: 263; SEQ ID NO: 230 and SEQ ID NO: 264; SEQ ID NO: 230 and SEQ ID NO: 265; SEQ ID NO: 230 and SEQ ID NO: 266; SEQ ID NO: 230 and SEQ ID NO: 267; SEQ ID NO: 230 and SEQ ID NO: 268; SEQ ID NO: 230 and SEQ ID NO: 269; SEQ ID NO: 230 and SEQ ID NO: 270; SEQ ID NO: 230 and SEQ ID NO: 271 ; SEQ ID NO: 230 and SEQ ID NO: 272; SEQ ID NO: 230 and SEQ ID NO: 273; SEQ ID NO: 230 and SEQ ID NO: 274; SEQ ID NO: 230 and SEQ ID NO: 275; SEQ ID NO: 230 and SEQ ID NO: 276; SEQ ID NO: 230 and SEQ ID NO: 277; and SEQ ID NO: 230 and SEQ ID NO: 278.

[00209] In some aspects, the V H - V L pairs are selected from SEQ ID NO: 231 and

SEQ ID NO: 254; SEQ ID NO: 231 and SEQ ID NO: 255; SEQ ID NO: 231 and SEQ ID NO: 256; SEQ ID NO: 231 and SEQ ID NO: 257; SEQ ID NO: 231 and SEQ ID NO: 258; SEQ ID NO: 231 and SEQ ID NO: 259; SEQ ID NO: 231 and SEQ ID NO: 260; SEQ ID NO: 231 and SEQ ID NO: 261 ; SEQ ID NO: 231 and SEQ ID NO: 262; SEQ ID NO: 231 and SEQ ID NO: 263; SEQ ID NO: 231 and SEQ ID NO: 264; SEQ ID NO: 231 and SEQ ID NO: 265; SEQ ID NO: 231 and SEQ ID NO: 266; SEQ ID NO: 231 and SEQ ID NO: 267; SEQ ID NO: 231 and SEQ ID NO: 268; SEQ ID NO: 231 and SEQ ID NO: 269; SEQ ID NO: 231 and SEQ ID NO: 270; SEQ ID NO: 231 and SEQ ID NO: 271 ; SEQ ID NO: 231 and SEQ ID NO: 272; SEQ ID NO: 231 and SEQ ID NO: 273; SEQ ID NO: 231 and SEQ ID NO: 274; SEQ ID NO: 231 and SEQ ID NO: 275; SEQ ID NO: 231 and SEQ ID NO: 276; SEQ ID NO: 231 and SEQ ID NO: 277; and SEQ ID NO: 231 and SEQ ID NO: 278. [00210] In some aspects, the V H - V L pairs are selected from SEQ ID NO: 232 and

SEQ ID NO: 254; SEQ ID NO: 232 and SEQ ID NO: 255; SEQ ID NO: 232 and SEQ ID NO: 256; SEQ ID NO: 232 and SEQ ID NO: 257; SEQ ID NO: 232 and SEQ ID NO: 258; SEQ ID NO: 232 and SEQ ID NO: 259; SEQ ID NO: 232 and SEQ ID NO: 260; SEQ ID NO: 232 and SEQ ID NO: 261 ; SEQ ID NO: 232 and SEQ ID NO: 262; SEQ ID NO: 232 and SEQ ID NO: 263; SEQ ID NO: 232 and SEQ ID NO: 264; SEQ ID NO: 232 and SEQ ID NO: 265; SEQ ID NO: 232 and SEQ ID NO: 266; SEQ ID NO: 232 and SEQ ID NO: 267; SEQ ID NO: 232 and SEQ ID NO: 268; SEQ ID NO: 232 and SEQ ID NO: 269; SEQ ID NO: 232 and SEQ ID NO: 270; SEQ ID NO: 232 and SEQ ID NO: 271 ; SEQ ID NO: 232 and SEQ ID NO: 272; SEQ ID NO: 232 and SEQ ID NO: 273; SEQ ID NO: 232 and SEQ ID NO: 274; SEQ ID NO: 232 and SEQ ID NO: 275; SEQ ID NO: 232 and SEQ ID NO: 276; SEQ ID NO: 232 and SEQ ID NO: 277; and SEQ ID NO: 232 and SEQ ID NO: 278.

[0021 1] In some aspects, the VH - VL pairs are selected from SEQ ID NO: 233 and

SEQ ID NO: 254; SEQ ID NO: 233 and SEQ ID NO: 255; SEQ ID NO: 233 and SEQ ID NO: 256; SEQ ID NO: 233 and SEQ ID NO: 257; SEQ ID NO: 233 and SEQ ID NO: 258; SEQ ID NO: 233 and SEQ ID NO: 259; SEQ ID NO: 233 and SEQ ID NO: 260; SEQ ID NO: 233 and SEQ ID NO: 261 ; SEQ ID NO: 233 and SEQ ID NO: 262; SEQ ID NO: 233 and SEQ ID NO: 263; SEQ ID NO: 233 and SEQ ID NO: 264; SEQ ID NO: 233 and SEQ ID NO: 265; SEQ ID NO: 233 and SEQ ID NO: 266; SEQ ID NO: 233 and SEQ ID NO: 267; SEQ ID NO: 233 and SEQ ID NO: 268; SEQ ID NO: 233 and SEQ ID NO: 269; SEQ ID NO: 233 and SEQ ID NO: 270; SEQ ID NO: 233 and SEQ ID NO: 271 ; SEQ ID NO: 233 and SEQ ID NO: 272; SEQ ID NO: 233 and SEQ ID NO: 273; SEQ ID NO: 233 and SEQ ID NO: 274; SEQ ID NO: 233 and SEQ ID NO: 275; SEQ ID NO: 233 and SEQ ID NO: 276; SEQ ID NO: 233 and SEQ ID NO: 277; and SEQ ID NO: 233 and SEQ ID NO: 278.

[00212] In some aspects, the V H - V L pairs are selected from SEQ ID NO: 234 and

SEQ ID NO: 254; SEQ ID NO: 234 and SEQ ID NO: 255; SEQ ID NO: 234 and SEQ ID NO: 256; SEQ ID NO: 234 and SEQ ID NO: 257; SEQ ID NO: 234 and SEQ ID NO: 258; SEQ ID NO: 234 and SEQ ID NO: 259; SEQ ID NO: 234 and SEQ ID NO: 260; SEQ ID NO: 234 and SEQ ID NO: 261 ; SEQ ID NO: 234 and SEQ ID NO: 262; SEQ ID NO: 234 and SEQ ID NO: 263; SEQ ID NO: 234 and SEQ ID NO: 264; SEQ ID NO: 234 and SEQ ID NO: 265; SEQ ID NO: 234 and SEQ ID NO: 266; SEQ ID NO: 234 and SEQ ID NO: 267; SEQ ID NO: 234 and SEQ ID NO: 268; SEQ ID NO: 234 and SEQ ID NO: 269; SEQ ID NO: 234 and SEQ ID NO: 270; SEQ ID NO: 234 and SEQ ID NO: 271 ; SEQ ID NO: 234 and SEQ ID NO: 272; SEQ ID NO: 234 and SEQ ID NO: 273; SEQ ID NO: 234 and SEQ ID NO: 274; SEQ ID NO: 234 and SEQ ID NO: 275; SEQ ID NO: 234 and SEQ ID NO: 276; SEQ ID NO: 234 and SEQ ID NO: 277; and SEQ ID NO: 234 and SEQ ID NO: 278.

[00213] In some aspects, the VH - VL pairs are selected from SEQ ID NO: 235 and

SEQ ID NO: 254; SEQ ID NO: 235 and SEQ ID NO: 255; SEQ ID NO: 235 and SEQ ID NO: 256; SEQ ID NO: 235 and SEQ ID NO: 257; SEQ ID NO: 235 and SEQ ID NO: 258; SEQ ID NO: 235 and SEQ ID NO: 259; SEQ ID NO: 235 and SEQ ID NO: 260; SEQ ID NO: 235 and SEQ ID NO: 261 ; SEQ ID NO: 235 and SEQ ID NO: 262; SEQ ID NO: 235 and SEQ ID NO: 263; SEQ ID NO: 235 and SEQ ID NO: 264; SEQ ID NO: 235 and SEQ ID NO: 265; SEQ ID NO: 235 and SEQ ID NO: 266; SEQ ID NO: 235 and SEQ ID NO: 267; SEQ ID NO: 235 and SEQ ID NO: 268; SEQ ID NO: 235 and SEQ ID NO: 269; SEQ ID NO: 235 and SEQ ID NO: 270; SEQ ID NO: 235 and SEQ ID NO: 271 ; SEQ ID NO: 235 and SEQ ID NO: 272; SEQ ID NO: 235 and SEQ ID NO: 273; SEQ ID NO: 235 and SEQ ID NO: 274; SEQ ID NO: 235 and SEQ ID NO: 275; SEQ ID NO: 235 and SEQ ID NO: 276; SEQ ID NO: 235 and SEQ ID NO: 277; and SEQ ID NO: 235 and SEQ ID NO: 278.

[00214] In some aspects, the VH - VL pairs are selected from SEQ ID NO: 236 and

SEQ ID NO: 254; SEQ ID NO: 236 and SEQ ID NO: 255; SEQ ID NO: 236 and SEQ ID NO: 256; SEQ ID NO: 236 and SEQ ID NO: 257; SEQ ID NO: 236 and SEQ ID NO: 258; SEQ ID NO: 236 and SEQ ID NO: 259; SEQ ID NO: 236 and SEQ ID NO: 260; SEQ ID NO: 236 and SEQ ID NO: 261 ; SEQ ID NO: 236 and SEQ ID NO: 262; SEQ ID NO: 236 and SEQ ID NO: 263; SEQ ID NO: 236 and SEQ ID NO: 264; SEQ ID NO: 236 and SEQ ID NO: 265; SEQ ID NO: 236 and SEQ ID NO: 266; SEQ ID NO: 236 and SEQ ID NO: 267; SEQ ID NO: 236 and SEQ ID NO: 268; SEQ ID NO: 236 and SEQ ID NO: 269; SEQ ID NO: 236 and SEQ ID NO: 270; SEQ ID NO: 236 and SEQ ID NO: 271 ; SEQ ID NO: 236 and SEQ ID NO: 272; SEQ ID NO: 236 and SEQ ID NO: 273; SEQ ID NO: 236 and SEQ ID NO: 274; SEQ ID NO: 236 and SEQ ID NO: 275; SEQ ID NO: 236 and SEQ ID NO: 276; SEQ ID NO: 236 and SEQ ID NO: 277; and SEQ ID NO: 236 and SEQ ID NO: 278.

[00215] In some aspects, the VH - VL pairs are selected from SEQ ID NO: 237 and

SEQ ID NO: 254; SEQ ID NO: 237 and SEQ ID NO: 255; SEQ ID NO: 237 and SEQ ID NO: 256; SEQ ID NO: 237 and SEQ ID NO: 257; SEQ ID NO: 237 and SEQ ID NO: 258; SEQ ID NO: 237 and SEQ ID NO: 259; SEQ ID NO: 237 and SEQ ID NO: 260; SEQ ID NO: 237 and SEQ ID NO: 261 ; SEQ ID NO: 237 and SEQ ID NO: 262; SEQ ID NO: 237 and SEQ ID NO: 263; SEQ ID NO: 237 and SEQ ID NO: 264; SEQ ID NO: 237 and SEQ ID NO: 265; SEQ ID NO: 237 and SEQ ID NO: 266; SEQ ID NO: 237 and SEQ ID NO: 267; SEQ ID NO: 237 and SEQ ID NO: 268; SEQ ID NO: 237 and SEQ ID NO: 269; SEQ ID NO: 237 and SEQ ID NO: 270; SEQ ID NO: 237 and SEQ ID NO: 271 ; SEQ ID NO: 237 and SEQ ID NO: 272; SEQ ID NO: 237 and SEQ ID NO: 273; SEQ ID NO: 237 and SEQ ID NO: 274; SEQ ID NO: 237 and SEQ ID NO: 275; SEQ ID NO: 237 and SEQ ID NO: 276; SEQ ID NO: 237 and SEQ ID NO: 277; and SEQ ID NO: 237 and SEQ ID NO: 278.

[00216] In some aspects, the VH - VL pairs are selected from SEQ ID NO: 238 and

SEQ ID NO: 254; SEQ ID NO: 238 and SEQ ID NO: 255; SEQ ID NO: 238 and SEQ ID NO: 256; SEQ ID NO: 238 and SEQ ID NO: 257; SEQ ID NO: 238 and SEQ ID NO: 258; SEQ ID NO: 238 and SEQ ID NO: 259; SEQ ID NO: 238 and SEQ ID NO: 260; SEQ ID NO: 238 and SEQ ID NO: 261 ; SEQ ID NO: 238 and SEQ ID NO: 262; SEQ ID NO: 238 and SEQ ID NO: 263; SEQ ID NO: 238 and SEQ ID NO: 264; SEQ ID NO: 238 and SEQ ID NO: 265; SEQ ID NO: 238 and SEQ ID NO: 266; SEQ ID NO: 238 and SEQ ID NO: 267; SEQ ID NO: 238 and SEQ ID NO: 268; SEQ ID NO: 238 and SEQ ID NO: 269; SEQ ID NO: 238 and SEQ ID NO: 270; SEQ ID NO: 238 and SEQ ID NO: 271 ; SEQ ID NO: 238 and SEQ ID NO: 272; SEQ ID NO: 238 and SEQ ID NO: 273; SEQ ID NO: 238 and SEQ ID NO: 274; SEQ ID NO: 238 and SEQ ID NO: 275; SEQ ID NO: 238 and SEQ ID NO: 276; SEQ ID NO: 238 and SEQ ID NO: 277; and SEQ ID NO: 238 and SEQ ID NO: 278.

[00217] In some aspects, the VH - VL pairs are selected from SEQ ID NO: 239 and

SEQ ID NO: 254; SEQ ID NO: 239 and SEQ ID NO: 255; SEQ ID NO: 239 and SEQ ID NO: 256; SEQ ID NO: 239 and SEQ ID NO: 257; SEQ ID NO: 239 and SEQ ID NO: 258; SEQ ID NO: 239 and SEQ ID NO: 259; SEQ ID NO: 239 and SEQ ID NO: 260; SEQ ID NO: 239 and SEQ ID NO: 261 ; SEQ ID NO: 239 and SEQ ID NO: 262; SEQ ID NO: 239 and SEQ ID NO: 263; SEQ ID NO: 239 and SEQ ID NO: 264; SEQ ID NO: 239 and SEQ ID NO: 265; SEQ ID NO: 239 and SEQ ID NO: 266; SEQ ID NO: 239 and SEQ ID NO: 267; SEQ ID NO: 239 and SEQ ID NO: 268; SEQ ID NO: 239 and SEQ ID NO: 269; SEQ ID NO: 239 and SEQ ID NO: 270; SEQ ID NO: 239 and SEQ ID NO: 271 ; SEQ ID NO: 239 and SEQ ID NO: 272; SEQ ID NO: 239 and SEQ ID NO: 273; SEQ ID NO: 239 and SEQ ID NO: 274; SEQ ID NO: 239 and SEQ ID NO: 275; SEQ ID NO: 239 and SEQ ID NO: 276; SEQ ID NO: 239 and SEQ ID NO: 277; and SEQ ID NO: 239 and SEQ ID NO: 278.

[00218] In some aspects, the V H - VL pairs are selected from SEQ ID NO: 240 and

SEQ ID NO: 254; SEQ ID NO: 240 and SEQ ID NO: 255; SEQ ID NO: 240 and SEQ ID NO: 256; SEQ ID NO: 240 and SEQ ID NO: 257; SEQ ID NO: 240 and SEQ ID NO: 258; SEQ ID NO: 240 and SEQ ID NO: 259; SEQ ID NO: 240 and SEQ ID NO: 260; SEQ ID NO: 240 and SEQ ID NO: 261 ; SEQ ID NO: 240 and SEQ ID NO: 262; SEQ ID NO: 240 and SEQ ID NO: 263; SEQ ID NO: 240 and SEQ ID NO: 264; SEQ ID NO: 240 and SEQ ID NO: 265; SEQ ID NO: 240 and SEQ ID NO: 266; SEQ ID NO: 240 and SEQ ID NO: 267; SEQ ID NO: 240 and SEQ ID NO: 268; SEQ ID NO: 240 and SEQ ID NO: 269; SEQ ID NO: 240 and SEQ ID NO: 270; SEQ ID NO: 240 and SEQ ID NO: 271 ; SEQ ID NO: 240 and SEQ ID NO: 272; SEQ ID NO: 240 and SEQ ID NO: 273; SEQ ID NO: 240 and SEQ ID NO: 274; SEQ ID NO: 240 and SEQ ID NO: 275; SEQ ID NO: 240 and SEQ ID NO: 276; SEQ ID NO: 240 and SEQ ID NO: 277; and SEQ ID NO: 240 and SEQ ID NO: 278.

[00219] In some aspects, the V H - VL pairs are selected from SEQ ID NO: 241 and

SEQ ID NO: 254; SEQ ID NO: 241 and SEQ ID NO: 255; SEQ ID NO: 241 and SEQ ID NO: 256; SEQ ID NO: 241 and SEQ ID NO: 257; SEQ ID NO: 241 and SEQ ID NO: 258; SEQ ID NO: 241 and SEQ ID NO: 259; SEQ ID NO: 241 and SEQ ID NO: 260; SEQ ID NO: 241 and SEQ ID NO: 261 ; SEQ ID NO: 241 and SEQ ID NO: 262; SEQ ID NO: 241 and SEQ ID NO: 263; SEQ ID NO: 241 and SEQ ID NO: 264; SEQ ID NO: 241 and SEQ ID NO: 265; SEQ ID NO: 241 and SEQ ID NO: 266; SEQ ID NO: 241 and SEQ ID NO: 267; SEQ ID NO: 241 and SEQ ID NO: 268; SEQ ID NO: 241 and SEQ ID NO: 269; SEQ ID NO: 241 and SEQ ID NO: 270; SEQ ID NO: 241 and SEQ ID NO: 271 ; SEQ ID NO: 241 and SEQ ID NO: 272; SEQ ID NO: 241 and SEQ ID NO: 273; SEQ ID NO: 241 and SEQ ID NO: 274; SEQ ID NO: 241 and SEQ ID NO: 275; SEQ ID NO: 241 and SEQ ID NO: 276; SEQ ID NO: 241 and SEQ ID NO: 277; and SEQ ID NO: 241 and SEQ ID NO: 278.

[00220] In some aspects, the V H - V L pairs are selected from SEQ ID NO: 242 and

SEQ ID NO: 254; SEQ ID NO: 242 and SEQ ID NO: 255; SEQ ID NO: 242 and SEQ ID NO: 256; SEQ ID NO: 242 and SEQ ID NO: 257; SEQ ID NO: 242 and SEQ ID NO: 258; SEQ ID NO: 242 and SEQ ID NO: 259; SEQ ID NO: 242 and SEQ ID NO: 260; SEQ ID NO: 242 and SEQ ID NO: 261 ; SEQ ID NO: 242 and SEQ ID NO: 262; SEQ ID NO: 242 and SEQ ID NO: 263; SEQ ID NO: 242 and SEQ ID NO: 264; SEQ ID NO: 242 and SEQ ID NO: 265; SEQ ID NO: 242 and SEQ ID NO: 266; SEQ ID NO: 242 and SEQ ID NO: 267; SEQ ID NO: 242 and SEQ ID NO: 268; SEQ ID NO: 242 and SEQ ID NO: 269; SEQ ID NO: 242 and SEQ ID NO: 270; SEQ ID NO: 242 and SEQ ID NO: 271 ; SEQ ID NO: 242 and SEQ ID NO: 272; SEQ ID NO: 242 and SEQ ID NO: 273; SEQ ID NO: 242 and SEQ ID NO: 274; SEQ ID NO: 242 and SEQ ID NO: 275; SEQ ID NO: 242 and SEQ ID NO: 276; SEQ ID NO: 242 and SEQ ID NO: 277; and SEQ ID NO: 242 and SEQ ID NO: 278. [00221] In some aspects, the V H - V L pairs are selected from SEQ ID NO: 243 and

SEQ ID NO: 254; SEQ ID NO: 243 and SEQ ID NO: 255; SEQ ID NO: 243 and SEQ ID NO: 256; SEQ ID NO: 243 and SEQ ID NO: 257; SEQ ID NO: 243 and SEQ ID NO: 258; SEQ ID NO: 243 and SEQ ID NO: 259; SEQ ID NO: 243 and SEQ ID NO: 260; SEQ ID NO: 243 and SEQ ID NO: 261; SEQ ID NO: 243 and SEQ ID NO: 262; SEQ ID NO: 243 and SEQ ID NO: 263; SEQ ID NO: 243 and SEQ ID NO: 264; SEQ ID NO: 243 and SEQ ID NO: 265; SEQ ID NO: 243 and SEQ ID NO: 266; SEQ ID NO: 243 and SEQ ID NO: 267; SEQ ID NO: 243 and SEQ ID NO: 268; SEQ ID NO: 243 and SEQ ID NO: 269; SEQ ID NO: 243 and SEQ ID NO: 270; SEQ ID NO: 243 and SEQ ID NO: 271 ; SEQ ID NO: 243 and SEQ ID NO: 272; SEQ ID NO: 243 and SEQ ID NO: 273; SEQ ID NO: 243 and SEQ ID NO: 274; SEQ ID NO: 243 and SEQ ID NO: 275; SEQ ID NO: 243 and SEQ ID NO: 276; SEQ ID NO: 243 and SEQ ID NO: 277; and SEQ ID NO: 243 and SEQ ID NO: 278.

[00222] In some aspects, the V H - V L pairs are selected from SEQ ID NO: 244 and

SEQ ID NO: 254; SEQ ID NO: 244 and SEQ ID NO: 255; SEQ ID NO: 244 and SEQ ID NO: 256; SEQ ID NO: 244 and SEQ ID NO: 257; SEQ ID NO: 244 and SEQ ID NO: 258; SEQ ID NO: 244 and SEQ ID NO: 259; SEQ ID NO: 244 and SEQ ID NO: 260; SEQ ID NO: 244 and SEQ ID NO: 261; SEQ ID NO: 244 and SEQ ID NO: 262; SEQ ID NO: 244 and SEQ ID NO: 263; SEQ ID NO: 244 and SEQ ID NO: 264; SEQ ID NO: 244 and SEQ ID NO: 265; SEQ ID NO: 244 and SEQ ID NO: 266; SEQ ID NO: 244 and SEQ ID NO: 267; SEQ ID NO: 244 and SEQ ID NO: 268; SEQ ID NO: 244 and SEQ ID NO: 269; SEQ ID NO: 244 and SEQ ID NO: 270; SEQ ID NO: 244 and SEQ ID NO: 271 ; SEQ ID NO: 244 and SEQ ID NO: 272; SEQ ID NO: 244 and SEQ ID NO: 273; SEQ ID NO: 244 and SEQ ID NO: 274; SEQ ID NO: 244 and SEQ ID NO: 275; SEQ ID NO: 244 and SEQ ID NO: 276; SEQ ID NO: 244 and SEQ ID NO: 277; and SEQ ID NO: 244 and SEQ ID NO: 278.

[00223] In some aspects, the V H - V L pairs are selected from SEQ ID NO: 245 and

SEQ ID NO: 254; SEQ ID NO: 245 and SEQ ID NO: 255; SEQ ID NO: 245 and SEQ ID NO: 256; SEQ ID NO: 245 and SEQ ID NO: 257; SEQ ID NO: 245 and SEQ ID NO: 258; SEQ ID NO: 245 and SEQ ID NO: 259; SEQ ID NO: 245 and SEQ ID NO: 260; SEQ ID NO: 245 and SEQ ID NO: 261; SEQ ID NO: 245 and SEQ ID NO: 262; SEQ ID NO: 245 and SEQ ID NO: 263; SEQ ID NO: 245 and SEQ ID NO: 264; SEQ ID NO: 245 and SEQ ID NO: 265; SEQ ID NO: 245 and SEQ ID NO: 266; SEQ ID NO: 245 and SEQ ID NO: 267; SEQ ID NO: 245 and SEQ ID NO: 268; SEQ ID NO: 245 and SEQ ID NO: 269; SEQ ID NO: 245 and SEQ ID NO: 270; SEQ ID NO: 245 and SEQ ID NO: 271 ; SEQ ID NO: 245 and SEQ ID NO: 272; SEQ ID NO: 245 and SEQ ID NO: 273; SEQ ID NO: 245 and SEQ ID NO: 274; SEQ ID NO: 245 and SEQ ID NO: 275; SEQ ID NO: 245 and SEQ ID NO: 276; SEQ ID NO: 245 and SEQ ID NO: 277; and SEQ ID NO: 245 and SEQ ID NO: 278.

[00224] In some aspects, the V H - V L pairs are selected from SEQ ID NO: 246 and

SEQ ID NO: 254; SEQ ID NO: 246 and SEQ ID NO: 255; SEQ ID NO: 246 and SEQ ID NO: 256; SEQ ID NO: 246 and SEQ ID NO: 257; SEQ ID NO: 246 and SEQ ID NO: 258; SEQ ID NO: 246 and SEQ ID NO: 259; SEQ ID NO: 246 and SEQ ID NO: 260; SEQ ID NO: 246 and SEQ ID NO: 261; SEQ ID NO: 246 and SEQ ID NO: 262; SEQ ID NO: 246 and SEQ ID NO: 263; SEQ ID NO: 246 and SEQ ID NO: 264; SEQ ID NO: 246 and SEQ ID NO: 265; SEQ ID NO: 246 and SEQ ID NO: 266; SEQ ID NO: 246 and SEQ ID NO: 267; SEQ ID NO: 246 and SEQ ID NO: 268; SEQ ID NO: 246 and SEQ ID NO: 269; SEQ ID NO: 246 and SEQ ID NO: 270; SEQ ID NO: 246 and SEQ ID NO: 271 ; SEQ ID NO: 246 and SEQ ID NO: 272; SEQ ID NO: 246 and SEQ ID NO: 273; SEQ ID NO: 246 and SEQ ID NO: 274; SEQ ID NO: 246 and SEQ ID NO: 275; SEQ ID NO: 246 and SEQ ID NO: 276; SEQ ID NO: 246 and SEQ ID NO: 277; and SEQ ID NO: 246 and SEQ ID NO: 278.

[00225] In some aspects, the V H - V L pairs are selected from SEQ ID NO: 247 and

SEQ ID NO: 254; SEQ ID NO: 247 and SEQ ID NO: 255; SEQ ID NO: 247 and SEQ ID NO: 256; SEQ ID NO: 247 and SEQ ID NO: 257; SEQ ID NO: 247 and SEQ ID NO: 258; SEQ ID NO: 247 and SEQ ID NO: 259; SEQ ID NO: 247 and SEQ ID NO: 260; SEQ ID NO: 247 and SEQ ID NO: 261; SEQ ID NO: 247 and SEQ ID NO: 262; SEQ ID NO: 247 and SEQ ID NO: 263; SEQ ID NO: 247 and SEQ ID NO: 264; SEQ ID NO: 247 and SEQ ID NO: 265; SEQ ID NO: 247 and SEQ ID NO: 266; SEQ ID NO: 247 and SEQ ID NO: 267; SEQ ID NO: 247 and SEQ ID NO: 268; SEQ ID NO: 247 and SEQ ID NO: 269; SEQ ID NO: 247 and SEQ ID NO: 270; SEQ ID NO: 247 and SEQ ID NO: 271 ; SEQ ID NO: 247 and SEQ ID NO: 272; SEQ ID NO: 247 and SEQ ID NO: 273; SEQ ID NO: 247 and SEQ ID NO: 274; SEQ ID NO: 247 and SEQ ID NO: 275; SEQ ID NO: 247 and SEQ ID NO: 276; SEQ ID NO: 247 and SEQ ID NO: 277; and SEQ ID NO: 247 and SEQ ID NO: 278.

[00226] In some aspects, the V H - V L pairs are selected from SEQ ID NO: 248 and

SEQ ID NO: 254; SEQ ID NO: 248 and SEQ ID NO: 255; SEQ ID NO: 248 and SEQ ID NO: 256; SEQ ID NO: 248 and SEQ ID NO: 257; SEQ ID NO: 248 and SEQ ID NO: 258; SEQ ID NO: 248 and SEQ ID NO: 259; SEQ ID NO: 248 and SEQ ID NO: 260; SEQ ID NO: 248 and SEQ ID NO: 261; SEQ ID NO: 248 and SEQ ID NO: 262; SEQ ID NO: 248 and SEQ ID NO: 263; SEQ ID NO: 248 and SEQ ID NO: 264; SEQ ID NO: 248 and SEQ ID NO: 265; SEQ ID NO: 248 and SEQ ID NO: 266; SEQ ID NO: 248 and SEQ ID NO: 267; SEQ ID NO: 248 and SEQ ID NO: 268; SEQ ID NO: 248 and SEQ ID NO: 269; SEQ ID NO: 248 and SEQ ID NO: 270; SEQ ID NO: 248 and SEQ ID NO: 271 ; SEQ ID NO: 248 and SEQ ID NO: 272; SEQ ID NO: 248 and SEQ ID NO: 273; SEQ ID NO: 248 and SEQ ID NO: 274; SEQ ID NO: 248 and SEQ ID NO: 275; SEQ ID NO: 248 and SEQ ID NO: 276; SEQ ID NO: 248 and SEQ ID NO: 277; and SEQ ID NO: 248 and SEQ ID NO: 278.

[00227] In some aspects, the V H - V L pairs are selected from SEQ ID NO: 249 and

SEQ ID NO: 254; SEQ ID NO: 249 and SEQ ID NO: 255; SEQ ID NO: 249 and SEQ ID NO: 256; SEQ ID NO: 249 and SEQ ID NO: 257; SEQ ID NO: 249 and SEQ ID NO: 258; SEQ ID NO: 249 and SEQ ID NO: 259; SEQ ID NO: 249 and SEQ ID NO: 260; SEQ ID NO: 249 and SEQ ID NO: 261 ; SEQ ID NO: 249 and SEQ ID NO: 262; SEQ ID NO: 249 and SEQ ID NO: 263; SEQ ID NO: 249 and SEQ ID NO: 264; SEQ ID NO: 249 and SEQ ID NO: 265; SEQ ID NO: 249 and SEQ ID NO: 266; SEQ ID NO: 249 and SEQ ID NO: 267; SEQ ID NO: 249 and SEQ ID NO: 268; SEQ ID NO: 249 and SEQ ID NO: 269; SEQ ID NO: 249 and SEQ ID NO: 270; SEQ ID NO: 249 and SEQ ID NO: 271 ; SEQ ID NO: 249 and SEQ ID NO: 272; SEQ ID NO: 249 and SEQ ID NO: 273; SEQ ID NO: 249 and SEQ ID NO: 274; SEQ ID NO: 249 and SEQ ID NO: 275; SEQ ID NO: 249 and SEQ ID NO: 276; SEQ ID NO: 249 and SEQ ID NO: 277; and SEQ ID NO: 249 and SEQ ID NO: 278.

[00228] In some aspects, the V H - V L pairs are selected from SEQ ID NO: 250 and

SEQ ID NO: 254; SEQ ID NO: 250 and SEQ ID NO: 255; SEQ ID NO: 250 and SEQ ID NO: 256; SEQ ID NO: 250 and SEQ ID NO: 257; SEQ ID NO: 250 and SEQ ID NO: 258; SEQ ID NO: 250 and SEQ ID NO: 259; SEQ ID NO: 250 and SEQ ID NO: 260; SEQ ID NO: 250 and SEQ ID NO: 261 ; SEQ ID NO: 250 and SEQ ID NO: 262; SEQ ID NO: 250 and SEQ ID NO: 263; SEQ ID NO: 250 and SEQ ID NO: 264; SEQ ID NO: 250 and SEQ ID NO: 265; SEQ ID NO: 250 and SEQ ID NO: 266; SEQ ID NO: 250 and SEQ ID NO: 267; SEQ ID NO: 250 and SEQ ID NO: 268; SEQ ID NO: 250 and SEQ ID NO: 269; SEQ ID NO: 250 and SEQ ID NO: 270; SEQ ID NO: 250 and SEQ ID NO: 271 ; SEQ ID NO: 250 and SEQ ID NO: 272; SEQ ID NO: 250 and SEQ ID NO: 273; SEQ ID NO: 250 and SEQ ID NO: 274; SEQ ID NO: 250 and SEQ ID NO: 275; SEQ ID NO: 250 and SEQ ID NO: 276; SEQ ID NO: 250 and SEQ ID NO: 277; and SEQ ID NO: 250 and SEQ ID NO: 278.

[00229] In some aspects, the V H - VL pairs are selected from SEQ ID NO: 251 and

SEQ ID NO: 254; SEQ ID NO: 251 and SEQ ID NO: 255; SEQ ID NO: 251 and SEQ ID NO: 256; SEQ ID NO: 251 and SEQ ID NO: 257; SEQ ID NO: 251 and SEQ ID NO: 258; SEQ ID NO: 251 and SEQ ID NO: 259; SEQ ID NO: 251 and SEQ ID NO: 260; SEQ ID NO: 251 and SEQ ID NO: 261 ; SEQ ID NO: 251 and SEQ ID NO: 262; SEQ ID NO: 251 and SEQ ID NO: 263; SEQ ID NO: 251 and SEQ ID NO: 264; SEQ ID NO: 251 and SEQ ID NO: 265; SEQ ID NO: 251 and SEQ ID NO: 266; SEQ ID NO: 251 and SEQ ID NO: 267; SEQ ID NO: 251 and SEQ ID NO: 268; SEQ ID NO: 251 and SEQ ID NO: 269; SEQ ID NO: 251 and SEQ ID NO: 270; SEQ ID NO: 251 and SEQ ID NO: 271 ; SEQ ID NO: 251 and SEQ ID NO: 272; SEQ ID NO: 251 and SEQ ID NO: 273; SEQ ID NO: 251 and SEQ ID NO: 274; SEQ ID NO: 251 and SEQ ID NO: 275; SEQ ID NO: 251 and SEQ ID NO: 276; SEQ ID NO: 251 and SEQ ID NO: 277; and SEQ ID NO: 251 and SEQ ID NO: 278.

[00230] In some aspects, the V H - VL pairs are selected from SEQ ID NO: 252 and

SEQ ID NO: 254; SEQ ID NO: 252 and SEQ ID NO: 255; SEQ ID NO: 252 and SEQ ID NO: 256; SEQ ID NO: 252 and SEQ ID NO: 257; SEQ ID NO: 252 and SEQ ID NO: 258; SEQ ID NO: 252 and SEQ ID NO: 259; SEQ ID NO: 252 and SEQ ID NO: 260; SEQ ID NO: 252 and SEQ ID NO: 261 ; SEQ ID NO: 252 and SEQ ID NO: 262; SEQ ID NO: 252 and SEQ ID NO: 263; SEQ ID NO: 252 and SEQ ID NO: 264; SEQ ID NO: 252 and SEQ ID NO: 265; SEQ ID NO: 252 and SEQ ID NO: 266; SEQ ID NO: 252 and SEQ ID NO: 267; SEQ ID NO: 252 and SEQ ID NO: 268; SEQ ID NO: 252 and SEQ ID NO: 269; SEQ ID NO: 252 and SEQ ID NO: 270; SEQ ID NO: 252 and SEQ ID NO: 271 ; SEQ ID NO: 252 and SEQ ID NO: 272; SEQ ID NO: 252 and SEQ ID NO: 273; SEQ ID NO: 252 and SEQ ID NO: 274; SEQ ID NO: 252 and SEQ ID NO: 275; SEQ ID NO: 252 and SEQ ID NO: 276; SEQ ID NO: 252 and SEQ ID NO: 277; and SEQ ID NO: 252 and SEQ ID NO: 278.

[00231] In some aspects, the VH - VL pairs are selected from SEQ ID NO: 253 and

SEQ ID NO: 254; SEQ ID NO: 253 and SEQ ID NO: 255; SEQ ID NO: 253 and SEQ ID NO: 256; SEQ ID NO: 253 and SEQ ID NO: 257; SEQ ID NO: 253 and SEQ ID NO: 258; SEQ ID NO: 253 and SEQ ID NO: 259; SEQ ID NO: 253 and SEQ ID NO: 260; SEQ ID NO: 253 and SEQ ID NO: 261 ; SEQ ID NO: 253 and SEQ ID NO: 262; SEQ ID NO: 253 and SEQ ID NO: 263; SEQ ID NO: 253 and SEQ ID NO: 264; SEQ ID NO: 253 and SEQ ID NO: 265; SEQ ID NO: 253 and SEQ ID NO: 266; SEQ ID NO: 253 and SEQ ID NO: 267; SEQ ID NO: 253 and SEQ ID NO: 268; SEQ ID NO: 253 and SEQ ID NO: 269; SEQ ID NO: 253 and SEQ ID NO: 270; SEQ ID NO: 253 and SEQ ID NO: 271 ; SEQ ID NO: 253 and SEQ ID NO: 272; SEQ ID NO: 253 and SEQ ID NO: 273; SEQ ID NO: 253 and SEQ ID NO: 274; SEQ ID NO: 253 and SEQ ID NO: 275; SEQ ID NO: 253 and SEQ ID NO: 276; SEQ ID NO: 253 and SEQ ID NO: 277; and SEQ ID NO: 253 and SEQ ID NO: 278. 2.7.4.1. Variants of V H - V L Pairs

[00232] In some embodiments, the VH - VL pairs provided herein comprise a variant of an illustrative VH and/or VL sequence provided in this disclosure.

[00233] In some aspects, the VH sequence comprises, consists of, or consists essentially of a variant of an illustrative VH sequence provided in this disclosure. In some aspects, the VH sequence comprises, consists of, or consists essentially of a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.1% identity with any of the illustrative VH sequences provided in this disclosure.

[00234] In some embodiments, the VH sequence comprises, consists of, or consists essentially of any of the illustrative VH sequences provided in this disclosure having 20 or fewer, 19 or fewer, 18 or fewer, 17 or fewer, 16 or fewer, 15 or fewer, 14 or fewer, 13 or fewer, 12 or fewer, 11 or fewer, 10 or fewer, 9 or fewer, 8 or fewer, 7 or fewer, 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer, or 1 or fewer amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.

[00235] In some aspects, the VL sequence comprises, consists of, or consists essentially of a variant of an illustrative VL sequence provided in this disclosure. In some aspects, the VL sequence comprises, consists of, or consists essentially of a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identity with any of the illustrative V L sequences provided in this disclosure.

[00236] In some embodiments, the VL sequence comprises, consists of, or consists essentially of any of the illustrative VL sequences provided in this disclosure having 20 or fewer, 19 or fewer, 18 or fewer, 17 or fewer, 16 or fewer, 15 or fewer, 14 or fewer, 13 or fewer, 12 or fewer, 11 or fewer, 10 or fewer, 9 or fewer, 8 or fewer, 7 or fewer, 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer, or 1 or fewer amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.

2.7.4.2. Excluded V H - V L Pairs

[00237] In some embodiments, the VH - VL pairs provided herein do not comprise certain VH - VL pairs.

[00238] In some aspects, the VH sequence is not selected from SEQ ID NOs: 326-330, and the VL sequence is not selected from SEQ ID NOs: 331-335.

[00239] In some aspects, the VH - VL pairs are not selected from SEQ ID NO: 326 and

SEQ ID NO: 331 ; SEQ ID NO: 326 and SEQ ID NO: 332; SEQ ID NO: 326 and SEQ ID NO: 333; SEQ ID NO: 326 and SEQ ID NO: 334; and SEQ ID NO: 326 and SEQ ID NO: 335.

[00240] In some aspects, the V H - V L pairs are not selected from SEQ ID NO: 327 and

SEQ ID NO: 331 ; SEQ ID NO: 327 and SEQ ID NO: 332; SEQ ID NO: 327 and SEQ ID NO: 333; SEQ ID NO: 327 and SEQ ID NO: 334; and SEQ ID NO: 327 and SEQ ID NO: 335.

[00241] In some aspects, the V H - V L pairs are not selected from SEQ ID NO: 328 and

SEQ ID NO: 331 ; SEQ ID NO: 328 and SEQ ID NO: 332; SEQ ID NO: 328 and SEQ ID NO: 333; SEQ ID NO: 328 and SEQ ID NO: 334; and SEQ ID NO: 328 and SEQ ID NO: 335.

[00242] In some aspects, the V H - V L pairs are not selected from SEQ ID NO: 329 and

SEQ ID NO: 331 ; SEQ ID NO: 329 and SEQ ID NO: 332; SEQ ID NO: 329 and SEQ ID NO: 333; SEQ ID NO: 329 and SEQ ID NO: 334; and SEQ ID NO: 329 and SEQ ID NO: 335.

[00243] In some aspects, the V H - V L pairs are not selected from SEQ ID NO: 330 and

SEQ ID NO: 331 ; SEQ ID NO: 330 and SEQ ID NO: 332; SEQ ID NO: 330 and SEQ ID NO: 333; SEQ ID NO: 330 and SEQ ID NO: 334; and SEQ ID NO: 330 and SEQ ID NO: 335.

2.8. Antibodies Comprising All Six CDRs

[00244] In some embodiments, the antibody comprises a CDR-H1 sequence, a

CDR-H2 sequence, a CDR-H3 sequence, a CDR-L1 sequence, and a CDR-L3 sequence. In some aspects, the CDR sequences are part of a V H (for CDR-H) or V L (for CDR-L).

[00245] In some aspects, the CDR-H1 sequence is a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 4-28; the CDR-H2 sequence is a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 59-78; the CDR-H3 sequence is a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 104-128; the CDR-L1 sequence is a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 129-153; the CDR-L2 sequence is a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 154-178; and the CDR-L3 sequence is a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 179-203. [00246] In some aspects, the CDR-Hl sequence is a Kabat CDR-Hl sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 29-53; the CDR-H2 sequence is a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 79-103; the CDR-H3 sequence is a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 104-128; the CDR-L1 sequence is a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 129-153; the CDR-L2 sequence is a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 154-178; and the CDR-L3 sequence is a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 179-203.

2.8.1. Variants of Antibodies Comprising All Six CDRs

[00247] In some embodiments, the CDR-Hl, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and CDR-L3 provided herein comprise a variant of an illustrative CDR-Hl, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and/or CDR-L3 sequence provided in this disclosure.

[00248] In some aspects, the CDR-Hl sequence comprises, consists of, or consists essentially of a variant of an illustrative Chothia or Kabat CDR-Hl sequence provided in this disclosure. In some aspects, the CDR-Hl sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Chothia or Kabat CDR-Hl sequences provided in this disclosure. In some aspects, the CDR-Hl sequence comprises, consists of, or consists essentially of any of the illustrative Chothia or Kabat CDR-Hl sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.

[00249] In some aspects, the CDR-H2 sequence comprises, consists of, or consists essentially of a variant of an illustrative Chothia or Kabat CDR-H2 sequence provided in this disclosure. In some aspects, the CDR-H2 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Chothia or Kabat CDR-H2 sequences provided in this disclosure. In some aspects, the CDR-H2 sequence comprises, consists of, or consists essentially of any of the illustrative Chothia or Kabat CDR-H2 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions. [00250] In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-H3 sequence provided in this disclosure. In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-H3 sequences provided in this disclosure. In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-H3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.

[00251] In some aspects, the CDR-Ll sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-Ll sequence provided in this disclosure. In some aspects, the CDR-Ll sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-Ll sequences provided in this disclosure. In some aspects, the CDR-Ll sequence comprises, consists of, or consists essentially of any of the illustrative CDR-Ll sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.

[00252] In some aspects, the CDR-L2 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L2 sequence provided in this disclosure. In some aspects, the CDR-L2 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L2 sequences provided in this disclosure. In some aspects, the CDR-L2 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L2 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.

[00253] In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L3 sequence provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L3 sequences provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions. 2.8.2. Excluded Six CDR Combinations

[00254] In some embodiments, the CDR-Hl, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and CDR-L3 provided herein do not comprise certain CDR-Hl, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and/or CDR-L3.

[00255] In some aspects, the Chothia CDR-Hl sequence is not selected from SEQ ID

NOs: 286-290; the Kabat CDR-Hl sequence is not selected from SEQ ID NOs: 291-295; the Chothia CDR-H2 sequence is not selected from SEQ ID NOs: 296-300; the Kabat CDR-H2 sequence is not selected from SEQ ID NOs: 301-305; the CDR-H3 sequence is not selected from 306-310; the CDR-L1 sequence is not selected from SEQ ID NOs: 311-315; the CDR-L2 sequence is not selected from SEQ ID NOs: 316-320; and/or the CDR-L3 sequence is not selected from SEQ ID NOs: 321-325.

2.9. Consensus Sequences

[00256] In some embodiments, provided herein are anti-EpCAM antibodies comprising one or more sequences defined by consensus sequences. Each consensus sequence is based, at least in part, on one or more alignments of two or more useful anti-EpCAM CDR sequences provided in this disclosure. Based on such alignments, a person of skill in the art would recognize that different amino acid residues may useful in certain positions of the CDRs. Accordingly, each consensus sequence encompasses two or more useful anti-EpCAM CDR sequences.

[00257] In some embodiments, the antibodies comprise one to six of the consensus

CDR sequences provided herein. In some embodiments, the antibodies comprise two to six of the consensus CDR sequences provided herein. In some embodiments, the antibodies comprise three to six of the consensus CDR sequences provided herein. In some embodiments, the antibodies comprise four to six of the consensus CDR sequences provided herein. In some embodiments, the antibodies comprise five to six of the consensus CDR sequences provided herein. In some embodiments, the antibodies comprise six of the consensus CDR sequences provided herein. In some embodiments, the antibodies comprise a V L comprising the CDR-L consensus sequence(s). In some embodiments, the antibodies comprise a V H comprising the CDR-H consensus sequence(s). In some embodiments, the antibodies comprise a V H comprising the CDR-H consensus sequence(s) and a V L comprising the CDR-L consensus sequence(s). 2.9.1. CDR-H3 Consensus Sequences

[00258] In some embodiments, the antibody comprises a CDR-H3 sequence defined by the consensus sequence ai-W-a3-a -Q-a6- 7-Y-a9-aio-D-Y, where ai is G, A, or D; o¾ is H or N; θ4 is P, D, or R; ο½ is T, S, or D; a 7 is L, M, or Y; o¾ is D, G, H, or N; and a 10 is L, Q, R, or V.

[00259] In some embodiments, the antibody comprises a CDR-H3 sequence defined by the consensus sequence L-R-N-W-Bs-Be-P-M-D-Y, where B¾ is E or D; and Ββ is G or M.

2.9.2. Chothia CDR-H1 Consensus Sequences

[00260] In some embodiments, the antibody comprises a Chothia CDR-H1 sequence defined by the consensus sequence G-F-T-F-y 5 -Y6-Y7, where γ¾ is S, R, G, or C; je is G, V, A, or S; and jj is S, T, A, C, E, or F.

[00261] In some embodiments, the antibody comprises a Chothia CDR-H1 sequence defined by the consensus sequence δι-Υ-Α-Ρ-δ ί - -δγ, where δι is G or D; δ¾ is A or T; and

2.9.3. Chothia CDR-H2 Consensus Sequences

[00262] In some embodiments, the antibody comprises a Chothia CDR-H2 sequence defined by the consensus sequence 8i-G-83-84-G-86, where Si is D, A, or G; 8 3 is G, H, or S; 84 is E, D, V, G, or Q; and Be is S, Y, or N.

2.9.4. Kabat CDR-H1 Consensus Sequences

[00263] In some embodiments, the antibody comprises a Kabat CDR-H1 sequence defined by the consensus sequence ζι-ζι-S-M-S, where ζ 1 is G, V, A, or S; and ζ 2 is S, T, A, C, E, or F.

[00264] In some embodiments, the antibody comprises a Kabat CDR-H1 sequence defined by the consensus sequence Ν-ηι-W-L-G, where r\ 2 is R or S.

2.9.5. Kabat CDR-H2 Consensus Sequences

[00265] In some embodiments, the antibody comprises a Kabat CDR-H2 sequence defined by the consensus sequence Α-Ι-θ 3 -0-θ5-θ 6 -0-θ 8 -Τ-θιο-Υ-Α-0-8-ν-θ ΐ6 -θ ΐ 7, where Θ3 is D, A, or G; θ 5 is G, H, or S; θ 6 is E, D, V, G, or Q; θ 8 is S, Y, or N; θ 10 is G, A, N, or S; θ 16 is K or R; and θ 17 is G or D. 2.9.6. CDR-L3 Consensus Sequences

[00266] In some embodiments, the antibody comprises a CDR-L3 sequence defined by the consensus sequence Q-Q-13-14-15-I6-P-I8-T, where 1 3 is L, D, H, N, R, T, V, or Y; i 4 is V,

A, L, Q, S, E, F, M, or W; i 5 is T, A, P, S, E, F, N, or Y; i 6 is S, A, I, N, G, K, P, R, or V; and is is P or A.

[00267] In some embodiments, the antibody comprises a CDR-L3 sequence defined by the consensus sequence Q-N-D-K4-K5-Y-P-L-T, where κ 4 is L, S, or Y; and κ 5 is S or R.

[00268] In some aspects, if κ 4 is Y, then κ 5 is not S.

2.9.7. CDR-L2 Consensus Sequences

[00269] In some embodiments, the antibody comprises a CDR-L2 sequence defined by the consensus sequence λι-Α-S-T-R-E-S, where λ 1 is W or R.

[00270] In some aspects, λ 1 is not W.

2.9.8. CDR-L 1 Consensus Sequences

[00271] In some embodiments, the antibody comprises a CDR-L 1 sequence defined by the consensus sequence μι-Α-8-0-μ5-μ6-μ7-μ8-μ9-μιο-μιι-Α, where μι is R or S; μ¾ is S, V, G,

T, K, N, P, or R; μ 6 is V, L, C, D, G, or I; μ 7 is S, P, A, H, K, or T; μ 8 is S, T, N, or P; μ 9 is S, G, N, R, or T; μ 10 is Y, S, V, D, K, or T; and μ η is L, M, or I.

3. Germline

[00272] In some embodiments, the antibody that specifically binds EpCAM is an antibody comprising a variable region that is encoded by a particular germline gene, or a variant thereof. The illustrative antibodies provided herein comprise variable regions that are encoded by the heavy chain variable region germline genes VH3-23 and VH5-51, or variants thereof; and the light chain variable region germline genes VK3-20 and VK4-1, or variants thereof.

[00273] One of skill in the art would recognize that the CDR sequences provided herein may also be useful when combined with variable regions encoded by other variable region germline genes, or variants thereof. In particular, the CDR sequences provided herein may be useful when combined with variable regions encoded by variable region germline genes, or variants thereof, that are structurally similar to the variable region germline genes recited above. For example, in some embodiments, a CDR-H sequence provided herein may be combined with a variable region encoded by a variable region germline gene selected from the V H 3 or V H 5 families, or a variant thereof. In some embodiments, a CDR-L sequence provided herein may be combined with a variable region encoded by a variable region germline gene selected from the VK3 or VK4 families, or a variant thereof.

4. Affinity

[00274] In some embodiments, the affinity of the antibody for EpCAM as indicated by

K D , is less than about 10 "5 M, less than about 10 "6 M, less than about 10 "7 M, less than about 10 "8 M, less than about 10 "9 M, less than about 10 "10 M, less than about 10 "11 M, or less than about 10 "12 M. In some embodiments, the affinity of the antibody is between about 10 "7 M and 10 "11 M. In some embodiments, the affinity of the antibody is between about 10 "7 M and 10 "10 M. In some embodiments, the affinity of the antibody is between about 10 "7 M and 10 "9 M. In some embodiments, the affinity of the antibody is between about 10 "7 M and 10 "8 M. In some embodiments, the affinity of the antibody is between about 10 "8 M and 10 "11 M. In some embodiments, the affinity of the antibody is between about 10 "8 M and 10 "10 M. In some embodiments, the affinity of the antibody is between about 10 "9 M and 10 "11 M. In some embodiments, the affinity of the antibody is between about 10 "10 M and 10 "11 M.

[00275] In some embodiments, the affinity of the antibody for human EpCAM, as determined by surface plasmon resonance at 25°C, and as indicated by K D , is between about 7.21 x lO "9 M and about 1.93x l0 "10 M. In some embodiments, the affinity of the antibody for human EpCAM is about 7.21 x lO "9 M, about 6.91 x lO "9 M, about 6.70x l0 "9 M, about 6.17x l0 "9 M, about 5.46x l0 "9 M, about 5.24x l0 "9 M, about 4.17x l0 "9 M, about 3.99x l0 "9 M, about 3.93 x l0 "9 M, about 3.56x l0 "9 M, about 3.50x l0 "9 M, about 3.44x l0 "9 M, about 3.43 x l0 "9 M, about 2.75 x l0 "9 M, about 2.54x l0 "9 M, about 1.78x l0 "9 M, about 1.49x l0 "9 M, about 1.45x l0 "9 M, about 1.41 x l0 "9 M, about 1.19x l0 "9 M, about 9.83x l0 "10 M, about 9.04 x 10 "10 M, or about 1.93 χ 10 "10 M.

[00276] In some embodiments, the affinity of the antibody for human EpCAM expressed on the surface of a cell, as indicated by K D , is between about 3.68 and about 1.08 nM. In some embodiments, the affinity of the antibody for human EpCAM expressed on the surface of a cell is about 3.68 nM, about 3.24 nM, about 3 nM, about 2.6 nM, about 2.59 nM, about 2.49 nM, about 2.47 nM, about 2 nM, about 1.96 nM, about 1.91 nM, about 1.89 nM, about 1.85 nM, about 1.79 nM, about 1.71 nM, about 1.69 nM, about 1.6 nM, about 1.54 nM, about 1.5 nM, about 1.45 nM, about 1.2 nM, about 1.17 nM, about 1.14 nM, or about 1.08 nM. In some embodiments, the cell is a CHO cell. [00277] In some embodiments, the affinity of the antibody for human EpCAM expressed on the surface of a cell, as indicated by K D , is between about 6.9 and about 3.6 nM. In some embodiments, the affinity of the antibody for human EpCAM expressed on the surface of a cell is about 6.9 nM, about 6.7 nM, or about 3.6 nM. In some embodiments, the cell is an HCT 116 cell (ATCC No. CCL-247).

[00278] In some embodiments, the affinity of the antibody for human EpCAM expressed on the surface of a cell, as indicated by K D , is between about 7.6 and about 2.7 nM. In some embodiments, the affinity of the antibody for human EpCAM expressed on the surface of a cell is about 7.6 nM, about 5.2 nM, or about 2.7 nM. In some embodiments, the cell is a JIMT-1 cell (DSMZ No. ACC 589).

[00279] In some embodiments, the affinity of the antibody for cynomolgus EpCAM, as determined by surface plasmon resonance at 25°C, and as indicated by K D , is between about 1.62x l0 "7 M and about 1.17x l0 "9 M. In some embodiments, the affinity of the antibody for cynomolgus EpCAM is about 1.62x l0 "7 M, about 1.20x l0 "7 M, about 4.52x l0 "8 M, about 3.99x l0 "8 M, about 3.52x l0 "8 M, about 2.97x l0 "8 M, about 2.91 x lO "8 M, about 2.29x l0 "8 M, about 1.82x l0 "8 M, about 1.52x l0 "8 M, about 8.59x l0 "9 M, about 8.10x l0 "9 M, about 7.52x l0 "9 M, about 7.22x l0 "9 M, about 4.41 x l0 "9 M, or about 1.17x l0 "9 M.

[00280] In some embodiments, the antibody is characterized by a ratio of affinity for human EpCAM to affinity for cynomolgus EpCAM, each as determined by surface plasmon resonance at 25°C, and as indicated by K D . In some embodiments, the ratio is from about 0.029 to about 6.162. In some embodiments, the ratio is about 0.029, about 0.034, about 0.043, about 0.051, about 0.076, about 0.098, about 0.105, about 0.155, about 0.184, about 0.352, about 0.366, about 0.441, about 0.610, about 0.762, about 0.794, or about 6.162.

[00281] In some embodiments, the affinity of the antibody for cynomolgus EpCAM expressed on the surface of a cell, as indicated by K D , is between about 2.99 and about 0.66 nM. In some embodiments, the affinity of the antibody for cynomolgus EpCAM expressed on the surface of a cell is about 2.99 nM, about 2.5 nM, about 1.83 nM, about 1.79 nM, about 1.62 nM, about 1.59 nM, about 1.38 nM, about 1.35 nM, about 1.21 nM, about 1.2 nM, about 1.07 nM, about 0.99 nM, about 0.9 nM, about 0.87 nM, about 0.7 nM, or about 0.66 nM. In some embodiments, the cell is a CHO cell.

[00282] In some embodiments the antibody has a k a of at least about 10 4 M^xsec "1 . In some embodiments the antibody has a k a of at least about 10 5 M^xsec "1 . In some embodiments the antibody has a k a of at least about 10 6 M^xsec "1 . In some embodiments the antibody has a k a of between about 10 4 M^xsec "1 and about 10 5 M^xsec "1 . In some embodiments the antibody has a k a of between about 10 5 M^xsec "1 and about 10 6 M^xsec "1 .

[00283] In some embodiments the antibody has a k a when associating with human

EpCAM, as determined by surface plasmon resonance at 25°C, of between about 6.52xl0 4 M^xsec "1 and about 3.51 xlO 5 M^xsec "1 . In some embodiments the antibody has a k a when associating with human EpCAM of about 6.52xl0 4 M ' ^sec "1 , about 9.03xl0 4 M ' ^sec "1 , about 1.03x10 s M ' ^sec "1 , about 1.40x10 s M ' ^sec "1 , about 1.43x10 s M ' ^sec "1 , about 1.49x10 s M^xsec "1 , about 1.66x10 s M ' ^sec "1 , about 1.70x10 s M ' ^sec "1 , about 1.76x10 s M^xsec "1 , about 1.82x10 s M ' ^sec "1 , about 1.92x10 s M ' ^sec "1 , about 2.00x10 s M ' ^sec "1 , about 2.05x10 s M ' ^sec "1 , about 2.10x10 s M ' ^sec "1 , about 2.20x10 s M ' ^sec "1 , about 2.35x10 s M^xsec "1 , about 2.54x10 s M ' ^sec "1 , about 2.56x10 s M ' ^sec "1 , about 2.57x10 s M^xsec "1 , about 2.84x10 s M ' ^sec "1 , about 2.88x10 s M ' ^sec "1 , about 3.10x10 s M ' ^sec "1 , or about 3.51x10 s M ' ^sec "1 .

[00284] In some embodiments the antibody has a kd of about 10 "s sec "1 or less. In some embodiments the antibody has a kd of about 10 "4 sec "1 or less. In some embodiments the antibody has a kd of about 10 "3 sec "1 or less. In some embodiments the antibody has a kd of between about 10 "2 sec "1 and about 10 "s sec "1 . In some embodiments the antibody has a kd of between about 10 "2 sec "1 and about 10 "4 sec "1 . In some embodiments the antibody has a kd of between about 10 "3 sec "1 and about 10 "s sec "1 .

[00285] In some embodiments the antibody has a kd when dissociating from human

EpCAM, as determined by surface plasmon resonance at 25°C, of between about 1.75xl0 "3 sec "1 and about 1.74xl0 "s sec "1 . In some embodiments the antibody has a kd when dissociating from human EpCAM of about 1.75xl0 "3 sec "1 , about 1.69xl0 "3 sec "1 , about 1.58xl0 "3 sec "1 , about 1.23xl0 "3 sec "1 , about l.OOxlO "3 sec "1 , about 9.39xl0 "4 sec "1 , about 9.08xl0 "4 sec "1 , about 7.90xl0 "4 sec "1 , about 7.87xl0 "4 sec "1 , about 7.84xl0 "4 sec "1 , about 6.04xl0 "4 sec "1 , about 5.98xl0 "4 sec "1 , about 5.10xl0 "4 sec "1 , about 4.12xl0 "4 sec "1 , about 3.75xl0 "4 sec "1 , about 3.06xl0 "4 sec "1 , about 2.97xl0 "4 sec "1 , about 2.57xl0 "4 sec "1 , about 2.57xl0 "4 sec "1 , about 2.56xl0 "4 sec "1 , about 2.54x10 "4 sec "1 , about 1.97xl0 "4 sec "1 , or about 1.74xl0 "s sec "1 .

[00286] In some aspects, the K D, k a , and kd are determined at 25°C. In some embodiments, the K D, k a , and kd are determined by surface plasmon resonance. In some embodiments, the K D, k a , and !¾ are determined according to the methods described in the Examples provided herein.

5. Epitope Bins

[00287] In some embodiments, the antibody binds the same epitope as the scFv antibody provided in SEQ ID NO: 336. In some embodiments, the antibody binds to a different epitope from the scFv antibody provided in SEQ ID NO: 336. In some embodiments, the antibody binds to part of the epitope bound by the scFv antibody provided in SEQ ID NO: 336.

[00288] In some embodiments, the antibody binds to the same epitope as the scFv-Fc antibody provided in SEQ ID NO: 210, which binds to an epitope encoded by exons 4-7 of the EpCAM gene.

6. Glycosylation Variants

[00289] In certain embodiments, an antibody may be altered to increase, decrease or eliminate the extent to which it is glycosylated. Glycosylation of polypeptides is typically either "N-linked" or "O-linked."

[00290] "N-linked" glycosylation refers to the attachment of a carbohydrate moiety to the side chain of an asparagine residue. The tripeptide sequences asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain. Thus, the presence of either of these tripeptide sequences in a polypeptide creates a potential glycosylation site.

[00291] "O-linked" glycosylation refers to the attachment of one of the sugars

N-acetylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5 -hydroxy proline or 5-hydroxylysine may also be used.

[00292] Addition or deletion of N-linked glycosylation sites to the antibody may be accomplished by altering the amino acid sequence such that one or more of the above- described tripeptide sequences is created or removed. Addition or deletion of O-linked glycosylation sites may be accomplished by addition, deletion, or substitution of one or more serine or threonine residues in or to (as the case may be) the sequence of an antibody.

7. Fc Variants

[00293] In certain embodiments, amino acid modifications may be introduced into the

Fc region of an antibody provided herein to generate an Fc region variant. In certain embodiments, the Fc region variant possesses some, but not all, effector functions. Such antibodies may be useful, for example, in applications in which the half-life of the antibody in vivo is important, yet certain effector functions are unnecessary or deleterious. Examples of effector functions include complement-dependent cytotoxicity (CDC) and antibody-directed complement-mediated cytotoxicity (ADCC). Numerous substitutions or substitutions or deletions with altered effector function are known in the art.

[00294] An alteration in in CDC and/or ADCC activity can be confirmed using in vitro and/or in vivo assays. For example, Fc receptor (FcR) binding assays can be conducted to measure FcyR binding. The primary cells for mediating ADCC, NK cells, express FcyRIII only, whereas monocytes express FcyRI, FcyRII and FCYRIII. FCR expression on hematopoietic cells is summarized in Ravetch and Kinet, Ann. Rev. Immunol , 1991, 9:457-492, incorporated by reference in its entirety.

[00295] Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest are provided in U.S. Patent Nos. 5,500,362 and 5,821,337; Hellstrom et al., Proc. Natl. Acad. Sci. U.S.A. , 1986, 83:7059-7063; Hellstrom et al, Proc. Natl. Acad. Sci. U.S.A. , 1985, 82: 1499-1502; and Bruggemann et al, J. Exp. Med, 1987, 166: 1351-1361 ; each of which is incorporated by reference in its entirety. Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells. Alternatively, or additionally, ADCC activity of the molecule of interest may be assessed in vivo, using an animal model such as that disclosed in Clynes et al. Proc. Natl. Acad. Sci. U.S.A. , 1998, 95:652-656, incorporated by reference in its entirety.

[00296] Clq binding assays may also be carried out to confirm that the antibody is unable to bind Clq and hence lacks CDC activity. Examples of Clq binding assays include those described in WO 2006/029879 and WO 2005/100402, each of which is incorporated by reference in its entirety.

[00297] Complement activation assays include those described, for example, in

Gazzano-Santoro et al, J. Immunol. Methods, 1996, 202: 163-171 ; Cragg et al, Blood, 2003, 101 : 1045-1052; and Cragg and Glennie, Blood, 2004, 103:2738-2743; each of which is incorporated by reference in its entirety.

[00298] FcRn binding and in vivo clearance (half-life determination) can also be measured, for example, using the methods described in Petkova et al, Intl. Immunol, 2006, 18: 1759-1769, incorporated by reference in its entirety. 8. Preparation of Antibodies

8.1. Antigen Preparation

[00299] The EpCAM antigen to be used for isolation of the antibodies may be intact

EpCAM or a fragment of EpCAM. The intact EpCAM, or fragment of EpCAM, may be in the form of an isolated protein or protein expressed by a cell. Other forms of EpCAM useful for generating antibodies will be apparent to those skilled in the art.

8.2. Monoclonal Antibodies

[00300] Monoclonal antibodies may be obtained, for example, using the hybridoma method first described by Kohler et al, Nature, 1975, 256:495-497 (incorporated by reference in its entirety), and/or by recombinant DNA methods {see e.g., U.S. Patent No. 4,816,567, incorporated by reference in its entirety). Monoclonal antibodies may also be obtained, for example, using phage or yeast-based libraries. See e.g., U.S. Patent Nos. 8,258,082 and 8,691,730, each of which is incorporated by reference in its entirety.

[00301] In the hybridoma method, a mouse or other appropriate host animal is immunized to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the protein used for immunization. Alternatively, lymphocytes may be immunized in vitro. Lymphocytes are then fused with myeloma cells using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell. See Goding J.W., Monoclonal Antibodies: Principles and Practice 3 rd ed. (1986) Academic Press, San Diego, CA, incorporated by reference in its entirety.

[00302] The hybridoma cells are seeded and grown in a suitable culture medium that contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells. For example, if the parental myeloma cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT), the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (HAT medium), which substances prevent the growth of HGPRT-deficient cells.

[00303] Useful myeloma cells are those that fuse efficiently, support stable high-level production of antibody by the selected antibody-producing cells, and are sensitive media conditions, such as the presence or absence of HAT medium. Among these, preferred myeloma cell lines are murine myeloma lines, such as those derived from MOP-21 and MC- 11 mouse tumors (available from the Salk Institute Cell Distribution Center, San Diego, CA), and SP-2 or X63-Ag8-653 cells (available from the American Type Culture Collection, Rockville, MD). Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies. See e.g., Kozbor, J. Immunol , 1984, 133:3001, incorporated by reference in its entirety.

[00304] After the identification of hybridoma cells that produce antibodies of the desired specificity, affinity, and/or biological activity, selected clones may be subcloned by limiting dilution procedures and grown by standard methods. See Goding, supra. Suitable culture media for this purpose include, for example, D-MEM or RPMI-1640 medium. In addition, the hybridoma cells may be grown in vivo as ascites tumors in an animal.

[00305] DNA encoding the monoclonal antibodies may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the monoclonal antibodies). Thus, the hybridoma cells can serve as a useful source of DNA encoding antibodies with the desired properties. Once isolated, the DNA may be placed into expression vectors, which are then transfected into host cells such as bacteria (e.g., E. coli), yeast (e.g., Saccharomyces or Pichia sp.), COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce antibody, to produce the monoclonal antibodies.

8.3. Humanized Antibodies

[00306] Humanized antibodies may be generated by replacing most, or all, of the structural portions of a non-human monoclonal antibody with corresponding human antibody sequences. Consequently, a hybrid molecule is generated in which only the antigen-specific variable, or CDR, is composed of non-human sequence. Methods to obtain humanized antibodies include those described in, for example, Winter and Milstein, Nature, 1991, 349:293-299; Rader et al, Proc. Nat. Acad. Sci. U.S.A. , 1998, 95 :8910-8915; Steinberger et al, J. Biol. Chem. , 2000, 275 :36073-36078; Queen et al., Proc. Natl. Acad. Sci. U.S.A. , 1989, 86: 10029-10033; and U. S. Patent Nos. 5,585,089, 5,693,761 , 5,693,762, and 6, 180,370; each of which is incorporated by reference in its entirety.

8.4. Human Antibodies

[00307] Human antibodies can be generated by a variety of techniques known in the art, for example by using transgenic animals (e.g., humanized mice). See, e.g., Jakobovits et al, Proc. Natl. Acad. Sci. U.S.A., 1993, 90:2551 ; Jakobovits et al, Nature, 1993, 362:255- 258; Bruggermann et al, Year in Immuno. , 1993, 7:33; and U. S. Patent Nos. 5,591 ,669, 5,589,369 and 5,545,807; each of which is incorporated by reference in its entirety. Human antibodies can also be derived from phage-display libraries {see e.g., Hoogenboom et al, J. Mol. Biol , 1991 , 227:381-388; Marks et al, J. Mol. Biol , 1991 , 222:581-597; and U. S. Pat. Nos. 5,565,332 and 5,573,905; each of which is incorporated by reference in its entirety). Human antibodies may also be generated by in vitro activated B cells {see e.g., U.S. Patent. Nos. 5,567,610 and 5,229,275, each of which is incorporated by reference in its entirety). Human antibodies may also be derived from yeast-based libraries {see e.g., U. S. Patent No. 8,691,730, incorporated by reference in its entirety).

9. Vectors, Host Cells, and Recombinant Methods

[00308] The invention also provides isolated nucleic acids encoding anti-EpCAM antibodies, vectors and host cells comprising the nucleic acids, and recombinant techniques for the production of the antibodies.

[00309] For recombinant production of the antibody, the nucleic acid(s) encoding it may be isolated and inserted into a replicable vector for further cloning (i.e., amplification of the DNA) or expression. In some aspects, the nucleic acid may be produced by homologous recombination, for example as described in U.S. Patent No. 5,204,244, incorporated by reference in its entirety.

[00310] Many different vectors are known in the art. The vector components generally include, but are not limited to, one or more of the following: a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence, for example as described in U. S. Patent No. 5,534,615, incorporated by reference in its entirety.

[00311] Illustrative examples of suitable host cells are provided below, these host cells are not meant to be limiting.

[00312] Suitable host cells include any prokaryotic (e.g., bacterial), lower eukaryotic

(e.g., yeast), or higher eukaryotic (e.g., mammalian) cells. Suitable prokaryotes include eubacteria, such as Gram-negative or Gram-positive organisms, for example, Enterobacteriaceae such as Escherichia {E. coli), Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella {S. typhimurium), Serratia {S. marcescans), Shigella, Bacilli {B. subtilis and B. licheniformis), Pseudomonas {P. aeruginosa), and Streptomyces . One useful E. coli cloning host is E. coli 294, although other strains such as E. coli B, E. coli XI 776, and E. coli W31 10 are suitable. [00313] In addition to prokaryotes, eukaryotic microbes such as filamentous fungi or yeast are also suitable cloning or expression hosts for anti-EpCAM antibody-encoding vectors. Saccharomyces cerevisiae, or common baker's yeast, is a commonly used lower eukaryotic host microorganism. However, a number of other genera, species, and strains are available and useful, such as Schizosaccharomyces pombe, Kluyveromyces (K. lactis, K. fragilis, K. bulgaricus K. wickeramii, K. waltii, K. drosophilarum, K. thermotolerans , and K. marxianus), Yarrowia, Pichia pastoris, Candida (C. albicans), Trichoderma reesia, Neurospora crassa, Schwanniomyces (S. occidentalis), and filamentous fungi such as, for example Penicillium, Tolypocladium, and Aspergillus {A. nidulans and A. niger).

[00314] Useful mammalian host cells include COS-7 cells, HEK293 cells; baby hamster kidney (BHK) cells; Chinese hamster ovary (CHO); mouse Sertoli cells; African green monkey kidney cells (VERO-76), and the like.

[00315] The host cells used to produce the anti-EpCAM antibody of this invention may be cultured in a variety of media. Commercially available media such as, for example, Ham's F10, Minimal Essential Medium (MEM), RPMI-1640, and Dulbecco's Modified Eagle's Medium (DMEM) are suitable for culturing the host cells. In addition, any of the media described in Ham et al, Meth. Enz. , 1979, 58:44; Barnes et al, Anal. Biochem. , 1980, 102:255; and U.S. Patent Nos. 4,767,704, 4,657,866, 4,927,762, 4,560,655, and 5,122,469, or WO 90/03430 and WO 87/00195 may be used. Each of the foregoing references is incorporated by reference in its entirety.

[00316] Any of these media may be supplemented as necessary with hormones and/or other growth factors (such as insulin, transferrin, or epidermal growth factor), salts (such as sodium chloride, calcium, magnesium, and phosphate), buffers (such as HEPES), nucleotides (such as adenosine and thymidine), antibiotics, trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range), and glucose or an equivalent energy source. Any other necessary supplements may also be included at appropriate concentrations that would be known to those skilled in the art.

[00317] The culture conditions, such as temperature, pH, and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan.

[00318] When using recombinant techniques, the antibody can be produced intracellularly, in the periplasmic space, or directly secreted into the medium. If the antibody is produced intracellularly, as a first step, the particulate debris, either host cells or lysed fragments, is removed, for example, by centrifugation or ultrafiltration. For example, Carter et al. {Bio/Technology, 1992, 10: 163-167) describes a procedure for isolating antibodies which are secreted to the periplasmic space of E. coli. Briefly, cell paste is thawed in the presence of sodium acetate (pH 3.5), EDTA, and phenylmethylsulfonylfluoride (PMSF) over about 30 min. Cell debris can be removed by centrifugation.

[00319] In some embodiments, the antibody is produced in a cell-free system. In some aspects, the cell-free system is an in vitro transcription and translation system as described in Yin et al, mAbs, 2012, 4:217-225, incorporated by reference in its entirety. In some aspects, the cell-free system utilizes a cell-free extract from a eukaryotic cell or from a prokaryotic cell. In some aspects, the prokaryotic cell is E. coli. Cell-free expression of the antibody may be useful, for example, where the antibody accumulates in a cell as an insoluble aggregate, or where yields from periplasmic expression are low.

[00320] Where the antibody is secreted into the medium, supernatants from such expression systems are generally first concentrated using a commercially available protein concentration filter, for example, an Amicon® or Millipore® Pellcon® ultrafiltration unit. A protease inhibitor such as PMSF may be included in any of the foregoing steps to inhibit proteolysis and antibiotics may be included to prevent the growth of adventitious contaminants.

[00321] The antibody composition prepared from the cells can be purified using, for example, hydroxylapatite chromatography, gel electrophoresis, dialysis, and affinity chromatography, with affinity chromatography being a particularly useful purification technique. The suitability of protein A as an affinity ligand depends on the species and isotype of any immunoglobulin Fc domain that is present in the antibody. Protein A can be used to purify antibodies that are based on human γΐ , γ2, or γ4 heavy chains (Lindmark et al, J. Immunol. Meth. , 1983, 62: 1 -13, incorporated by reference in its entirety). Protein G is useful for all mouse isotypes and for human γ3 (Guss et al., EMBO J. , 1986, 5: 1567-1575, incorporated by reference in its entirety).

[00322] The matrix to which the affinity ligand is attached is most often agarose, but other matrices are available. Mechanically stable matrices such as controlled pore glass or poly(styrenedivinyl)benzene allow for faster flow rates and shorter processing times than can be achieved with agarose. Where the antibody comprises a CH3 domain, the BakerBond ABX ® resin is useful for purification.

[00323] Other techniques for protein purification, such as fractionation on an ion- exchange column, ethanol precipitation, Reverse Phase HPLC, chromatography on silica, chromatography on heparin Sepharose ® , chromatofocusing, SDS-PAGE, and ammonium sulfate precipitation are also available, and can be applied by one of skill in the art.

[00324] Following any preliminary purification step(s), the mixture comprising the antibody of interest and contaminants may be subjected to low pH hydrophobic interaction chromatography using an elution buffer at a pH between about 2.5 to about 4.5, generally performed at low salt concentrations (e.g., from about 0 to about 0.25 M salt).

10. Pharmaceutical Compositions and Methods of Administration

[00325] Any of the antibodies provided herein can be provided in any appropriate pharmaceutical composition and be administered by any suitable route of administration. Suitable routes of administration include, but are not limited to, the inhalation, intraarterial, intradermal, intramuscular, intraperitoneal, intravenous, nasal, parenteral, pulmonary, and subcutaneous routes.

[00326] The pharmaceutical composition may comprise one or more pharmaceutical excipients. Any suitable pharmaceutical excipient may be used, and one of ordinary skill in the art is capable of selecting suitable pharmaceutical excipients. Accordingly, the pharmaceutical excipients provided below are intended to be illustrative, and not limiting. Additional pharmaceutical excipients include, for example, those described in the Handbook of Pharmaceutical Excipients, Rowe et al. (Eds.) 6th Ed. (2009), incorporated by reference in its entirety.

[00327] In some embodiments, the pharmaceutical composition comprises an anti- foaming agent. Any suitable anti-foaming agent may be used. In some aspects, the anti- foaming agent is selected from an alcohol, an ether, an oil, a wax, a silicone, a surfactant, and combinations thereof. In some aspects, the anti-foaming agent is selected from a mineral oil, a vegetable oil, ethylene bis stearamide, a paraffin wax, an ester wax, a fatty alcohol wax, a long chain fatty alcohol, a fatty acid soap, a fatty acid ester, a silicon glycol, a fluorosilicone, a polyethylene glycol-polypropylene glycol copolymer, polydimethylsiloxane-silicon dioxide, ether, octyl alcohol, capryl alcohol, sorbitan trioleate, ethyl alcohol, 2-ethyl-hexanol, dimethicone, oleyl alcohol, simethicone, and combinations thereof. [00328] In some embodiments, the pharmaceutical composition comprises a cosolvent.

Illustrative examples of cosolvents include ethanol, poly(ethylene) glycol, butylene glycol, dimethylacetamide, glycerin, and propylene glycol.

[00329] In some embodiments, the pharmaceutical composition comprises a buffer.

Illustrative examples of buffers include acetate, borate, carbonate, lactate, malate, phosphate, citrate, hydroxide, diethanolamine, monoethanolamine, glycine, methionine, guar gum, and monosodium glutamate.

[00330] In some embodiments, the pharmaceutical composition comprises a carrier or filler. Illustrative examples of carriers or fillers include lactose, maltodextrin, mannitol, sorbitol, chitosan, stearic acid, xanthan gum, and guar gum.

[00331] In some embodiments, the pharmaceutical composition comprises a surfactant.

Illustrative examples of surfactants include c -alpha tocopherol, benzalkonium chloride, benzethonium chloride, cetrimide, cetylpyridinium chloride, docusate sodium, glyceryl behenate, glyceryl monooleate, lauric acid, macrogol 15 hydroxy stearate, myristyl alcohol, phospholipids, polyoxyethylene alkyl ethers, polyoxyethylene sorbitan fatty acid esters, polyoxyethylene stearates, polyoxylglycerides, sodium lauryl sulfate, sorbitan esters, and vitamin E poly ethylene(gly col) succinate.

[00332] In some embodiments, the pharmaceutical composition comprises an anti- caking agent. Illustrative examples of anti-caking agents include calcium phosphate (tribasic), hydroxymethyl cellulose, hydroxypropyl cellulose, and magnesium oxide.

[00333] Other excipients that may be used with the pharmaceutical compositions include, for example, albumin, antioxidants, antibacterial agents, antifungal agents, bioabsorbable polymers, chelating agents, controlled release agents, diluents, dispersing agents, dissolution enhancers, emulsifying agents, gelling agents, ointment bases, penetration enhancers, preservatives, solubilizing agents, solvents, stabilizing agents, and sugars. Specific examples of each of these agents are described, for example, in the Handbook of Pharmaceutical Excipients, Rowe et al. (Eds.) 6th Ed. (2009), The Pharmaceutical Press, incorporated by reference in its entirety.

[00334] In some embodiments, the pharmaceutical composition comprises a solvent. In some aspects, the solvent is saline solution, such as a sterile isotonic saline solution or dextrose solution. In some aspects, the solvent is water for injection. [00335] In some embodiments, the pharmaceutical compositions are in a particulate form, such as a microparticle or a nanoparticle. Microparticles and nanoparticles may be formed from any suitable material, such as a polymer or a lipid. In some aspects, the microparticles or nanoparticles are micelles, liposomes, or polymersomes.

[00336] Further provided herein are anhydrous pharmaceutical compositions and dosage forms comprising an antibody, since water can facilitate the degradation of some antibodies.

[00337] Anhydrous pharmaceutical compositions and dosage forms provided herein can be prepared using anhydrous or low moisture containing ingredients and low moisture or low humidity conditions. Pharmaceutical compositions and dosage forms that comprise lactose and at least one active ingredient that comprises a primary or secondary amine can be anhydrous if substantial contact with moisture and/or humidity during manufacturing, packaging, and/or storage is expected.

[00338] An anhydrous pharmaceutical composition should be prepared and stored such that its anhydrous nature is maintained. Accordingly, anhydrous compositions can be packaged using materials known to prevent exposure to water such that they can be included in suitable formulary kits. Examples of suitable packaging include, but are not limited to, hermetically sealed foils, plastics, unit dose containers (e.g., vials), blister packs, and strip packs.

10.1. Parenteral Dosage Forms

[00339] In certain embodiments, provided are parenteral dosage forms. Parenteral dosage forms can be administered to subjects by various routes including, but not limited to, subcutaneous, intravenous (including bolus injection), intramuscular, and intraarterial. Because their administration typically bypasses subjects' natural defenses against contaminants, parenteral dosage forms are typically, sterile or capable of being sterilized prior to administration to a subject. Examples of parenteral dosage forms include, but are not limited to, solutions ready for injection, dry products ready to be dissolved or suspended in a pharmaceutically acceptable vehicle for injection, suspensions ready for injection, and emulsions.

[00340] Suitable vehicles that can be used to provide parenteral dosage forms are well known to those skilled in the art. Examples include, but are not limited to: Water for Injection USP; aqueous vehicles such as, but not limited to, Sodium Chloride Injection, Ringer's Injection, Dextrose Injection, Dextrose and Sodium Chloride Injection, and Lactated Ringer's Injection; water miscible vehicles such as, but not limited to, ethyl alcohol, polyethylene glycol, and polypropylene glycol; and non-aqueous vehicles such as, but not limited to, corn oil, cottonseed oil, peanut oil, sesame oil, ethyl oleate, isopropyl myristate, and benzyl benzoate.

[00341] Excipients that increase the solubility of one or more of the antibodies disclosed herein can also be incorporated into the parenteral dosage forms.

10.2. Dosage and Unit Dosage Forms

[00342] In human therapeutics, the doctor will determine the posology which he considers most appropriate according to a preventive or curative treatment and according to the age, weight, condition and other factors specific to the subject to be treated.

[00343] In certain embodiments, a composition provided herein is a pharmaceutical composition or a single unit dosage form. Pharmaceutical compositions and single unit dosage forms provided herein comprise a prophylactically or therapeutically effective amount of one or more prophylactic or therapeutic antibodies.

[00344] The amount of the antibody or composition which will be effective in the prevention or treatment of a disorder or one or more symptoms thereof will vary with the nature and severity of the disease or condition, and the route by which the antibody is administered. The frequency and dosage will also vary according to factors specific for each subject depending on the specific therapy (e.g., therapeutic or prophylactic agents) administered, the severity of the disorder, disease, or condition, the route of administration, as well as age, body, weight, response, and the past medical history of the subject. Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems.

[00345] In certain embodiments, exemplary doses of a composition include milligram or microgram amounts of the antibody per kilogram of subject or sample weight (e.g. , about 10 micrograms per kilogram to about 50 milligrams per kilogram, about 100 micrograms per kilogram to about 25 milligrams per kilogram, or about 100 microgram per kilogram to about 10 milligrams per kilogram). In certain embodiment, the dosage of the antibody provided herein, based on weight of the antibody, administered to prevent, treat, manage, or ameliorate a disorder, or one or more symptoms thereof in a subject is 0.1 mg/kg, 1 mg/kg, 2 mg/kg, 3 mg/kg, 4 mg/kg, 5 mg/kg, 6 mg/kg, 10 mg/kg, or 15 mg/kg or more of a subject's body weight. In another embodiment, the dosage of the composition or a composition provided herein administered to prevent, treat, manage, or ameliorate a disorder, or one or more symptoms thereof in a subject is 0.1 mg to 200 mg, 0.1 mg to 100 mg, 0.1 mg to 50 mg, 0.1 mg to 25 mg, 0.1 mg to 20 mg, 0.1 mg to 15 mg, 0.1 mg to 10 mg, 0.1 mg to 7.5 mg, 0.1 mg to 5 mg, 0.1 to 2.5 mg, 0.25 mg to 20 mg, 0.25 to 15 mg, 0.25 to 12 mg, 0.25 to 10 mg, 0.25 mg to 7.5 mg, 0.25 mg to 5 mg, 0.25 mg to 2.5 mg, 0.5 mg to 20 mg, 0.5 to 15 mg, 0.5 to 12 mg, 0.5 to 10 mg, 0.5 mg to 7.5 mg, 0.5 mg to 5 mg, 0.5 mg to 2.5 mg, 1 mg to 20 mg, 1 mg to 15 mg, 1 mg to 12 mg, 1 mg to 10 mg, 1 mg to 7.5 mg, 1 mg to 5 mg, or 1 mg to 2.5 mg.

[00346] The dose can be administered according to a suitable schedule, for example, once, two times, three times, or for times weekly. It may be necessary to use dosages of the antibody outside the ranges disclosed herein in some cases, as will be apparent to those of ordinary skill in the art. Furthermore, it is noted that the clinician or treating physician will know how and when to interrupt, adjust, or terminate therapy in conjunction with subject response.

[00347] Different therapeutically effective amounts may be applicable for different diseases and conditions, as will be readily known by those of ordinary skill in the art. Similarly, amounts sufficient to prevent, manage, treat or ameliorate such disorders, but insufficient to cause, or sufficient to reduce, adverse effects associated with the antibodies provided herein are also encompassed by the herein described dosage amounts and dose frequency schedules. Further, when a subject is administered multiple dosages of a composition provided herein, not all of the dosages need be the same. For example, the dosage administered to the subject may be increased to improve the prophylactic or therapeutic effect of the composition or it may be decreased to reduce one or more side effects that a particular subject is experiencing.

[00348] In certain embodiments, treatment or prevention can be initiated with one or more loading doses of an antibody or composition provided herein followed by one or more maintenance doses.

[00349] In certain embodiments, a dose of an antibody or composition provided herein can be administered to achieve a steady-state concentration of the antibody in blood or serum of the subject. The steady-state concentration can be determined by measurement according to techniques available to those of skill or can be based on the physical characteristics of the subject such as height, weight and age. [00350] In certain embodiments, administration of the same composition may be repeated and the administrations may be separated by at least 1 day, 2 days, 3 days, 5 days, 10 days, 15 days, 30 days, 45 days, 2 months, 75 days, 3 months, or 6 months. In other embodiments, administration of the same prophylactic or therapeutic agent may be repeated and the administration may be separated by at least 1 day, 2 days, 3 days, 5 days, 10 days, 15 days, 30 days, 45 days, 2 months, 75 days, 3 months, or 6 months.

11. Therapeutic Applications

[00351] For therapeutic applications, the antibodies of the invention are administered to a mammal, generally a human, in a pharmaceutically acceptable dosage form such as those known in the art and those discussed above. For example, the antibodies of the invention may be administered to a human intravenously as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intra-cerebrospinal, subcutaneous, intra-articular, intrasynovial, intrathecal, or intratumoral routes. The antibodies also are suitably administered by peritumoral, intralesional, or perilesional routes, to exert local as well as systemic therapeutic effects. The intraperitoneal route may be particularly useful, for example, in the treatment of ovarian tumors.

[00352] The antibodies provided herein may be useful for the treatment of any disease or condition involving EpCAM. In some embodiments, the disease or condition is a disease or condition that can be diagnosed by overexpression of EpCAM. In some embodiments, the disease or condition is a disease or condition that can benefit from treatment with an anti- EpCAM antibody. In some embodiments, the disease or condition is a cancer.

[00353] Any suitable cancer may be treated with the antibodies provided herein.

Illustrative suitable cancers include, for example, acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), adrenocortical carcinoma, anal cancer, appendix cancer, astrocytoma, basal cell carcinoma, brain tumor, bile duct cancer, bladder cancer, bone cancer, breast cancer, bronchial tumor, carcinoma of unknown primary origin, cardiac tumor, cervical cancer, chordoma, colon cancer, colorectal cancer, craniopharyngioma, ductal carcinoma, embryonal tumor, endometrial cancer, ependymoma, esophageal cancer, esthesioneuroblastoma, fibrous histiocytoma, Ewing sarcoma, eye cancer, germ cell tumor, gallbladder cancer, gastric cancer, gastrointestinal carcinoid tumor, gastrointestinal stromal tumor, gestational trophoblastic disease, glioma, head and neck cancer, hepatocellular cancer, histiocytosis, Hodgkin lymphoma, hypopharyngeal cancer, intraocular melanoma, islet cell tumor, Kaposi sarcoma, kidney cancer, Langerhans cell histiocytosis, laryngeal cancer, lip and oral cavity cancer, liver cancer, lobular carcinoma in situ, lung cancer, macroglobulinemia, malignant fibrous histiocytoma, melanoma, Merkel cell carcinoma, mesothelioma, metastatic squamous neck cancer with occult primary, midline tract carcinoma involving NUT gene, mouth cancer, multiple endocrine neoplasia syndrome, multiple myeloma, mycosis fungoides, myelodysplastic syndrome, myelodysplastic/myeloproliferative neoplasm, nasal cavity and par nasal sinus cancer, nasopharyngeal cancer, neuroblastoma, non-small cell lung cancer, oropharyngeal cancer, osteosarcoma, ovarian cancer, pancreatic cancer, papillomatosis, paraganglioma, parathyroid cancer, penile cancer, pharyngeal cancer, pheochromocytomas, pituitary tumor, pleuropulmonary blastoma, primary central nervous system lymphoma, prostate cancer, rectal cancer, renal cell cancer, renal pelvis and ureter cancer, retinoblastoma, rhabdoid tumor, salivary gland cancer, Sezary syndrome, skin cancer, small cell lung cancer, small intestine cancer, soft tissue sarcoma, spinal cord tumor, stomach cancer, T-cell lymphoma, teratoid tumor, testicular cancer, throat cancer, thymoma and thymic carcinoma, thyroid cancer, urethral cancer, uterine cancer, vaginal cancer, vulvar cancer, and Wilms tumor.

[00354] In particular embodiments, the cancer is a cancer of epithelial origin. In some aspects, the cancer is a carcinoma. In some aspects, the cancer is selected from an adenocarcinoma, a squamous cell carcinoma, an adenosquamos carcinoma, an anaplastic carcinoma, a large cell carcinoma, small cell carcinoma, and carcinoma of unknown primary origin.

12. Diagnostic Applications

[00355] In some embodiments, the antibodies provided herein are used in diagnostic applications. For example, an ant-EpCAM antibody may be useful in assays for EpCAM protein. In some aspects the antibody can be used to detect the expression of EpCAM in various cells and tissues. These assays may be useful, for example, in making a diagnosis and/or prognosis for a disease, such as a cancer.

[00356] In some diagnostic and prognostic applications, the antibody may be labeled with a detectable moiety. Suitable detectable moieties include, but are not limited to radioisotopes, fluorescent labels, and enzyme-substrate labels. In another embodiment, the anti-EpCAM antibody need not be labeled, and the presence of the antibody can be detected using a labeled antibody which specifically binds to the anti-EpCAM antibody. 13. Affinity Purification Reagents

[00357] The antibodies of the invention may be used as affinity purification agents. In this process, the antibodies may be immobilized on a solid phase such a resin or filter paper, using methods well known in the art. The immobilized antibody is contacted with a sample containing the EpCAM protein (or fragment thereof) to be purified, and thereafter the support is washed with a suitable solvent that will remove substantially all the material in the sample except the EpCAM protein, which is bound to the immobilized antibody. Finally, the support is washed with another suitable solvent, such as glycine buffer, pH 5.0, that will release the EpCAM protein from the antibody.

14. Kits

[00358] In some embodiments, an anti -EpCAM antibody provided herein is provided in the form of a kit, i.e., a packaged combination of reagents in predetermined amounts with instructions for performing a procedure. In some embodiments, the procedure is a diagnostic assay. In other embodiments, the procedure is a therapeutic procedure.

[00359] In some embodiments, the kit further comprises a solvent for the reconstitution of the anti -EpCAM antibody. In some embodiments, the anti-EpCAM antibody is provided in the form of a pharmaceutical composition.

EXAMPLES

Example 1: Generation and Primary Screening of anti-EpCAM Antibodies

[00360] Antibody scFv libraries were constructed using a standard overlap extension

PCR protocol with mutagenic primers targeting complementary determining regions (CDRs). See Heckman and Pease, Nat. Protoc , 2007, 2:924-932, incorporated by reference in its entirety. Selections for novel antibodies were performed using standard ribosome display protocols. See Dreier and Pluckthun, Methods Mol. Biol , 2003, 687:283-306, Clifton, NJ, incorporated by reference in its entirety. scFv-based selection was performed according to published protocols. See Hanes and Pluckthun, Proc. Natl. Acad. Sci. U.S.A. , 1997, 94:4937- 4942, incorporated by reference in its entirety. After multiple rounds of selection, the DNA from RT-PCR output was cloned into an optimized vector for cell-free expression using standard molecular biology techniques. See Yin et al, mAbs, 2012, 4:217-225, incorporated by reference in its entirety. All constructs were HIS- and FLAG-tagged to streamline purification and testing during screening. [00361] Libraries of antibody variants generated by selection workflow were transformed into E. coli and grown on agar plates with antibiotic (kanamycin). Individual colonies were grown in liquid broth (TB + kanamycin), and used as a template for DNA amplification via rolling circle amplification (RCA). The variants were then expressed in cell-free protein synthesis reactions as described in Zawada et al, Biotechnol. Bioeng., 2011, 108: 1570-1578, incorporated by reference in its entirety.

[00362] Briefly, cell-free extracts were treated with 50 μΜ iodoacetamide for 30 min at room temperature (20°C) and added to a premix containing cell-free components {see Groff et al., mAbs, 2014, 6:671-678, incorporated by reference in its entirety) and 10% (v/v) RCA DNA template (approximately 10 μg/mL DNA) for variants of interest. Sixty microliters of cell-free reactions were incubated at 30°C for 12 hr on a shaker at 650 rpm in 96-well plates. Four hundred to one-thousand-five-hundred colonies were screened, depending on the predicted diversity of different selection campaigns.

[00363] Following synthesis, each reaction was diluted 1:50 into PBST (PBS at pH 7.4 with 0.2% Tween-20 + 0.2% BSA) and expressed variants were tested for functional activity via ELISA-based binding to recombinant human EpCAM extracellular domain (ECD) (Gin 24 - Lys 265; Aero Biosystems; Cat. No. EPM-H5223). Standard ELISA-based methods were employed. Specifically, 384-well plates were coated with 2 μg/mL recombinant EpCAM diluted in bicarbonate buffer, and then blocked with BSA. Antibody variants of interest were allowed to bind to the EpCAM-coated plates, and detected with secondary antibodies (e.g., HRP-conjugated anti-human Fc or anti-FLAG) and then detected with chemiluminescent substrate (Pierce ELISA SuperSignal™ Substrate). Chemiluminescence was quantified on a Molecular Devices SpectraMax ® M5 plate reader. Top hits were selected based on ELISA signal or signal/noise ratio and their nucleotides were sequenced. Based on functional activity and sequence analysis, a subset of variants was selected for further scale- up and characterization.

Example 2: Secondary Screening of Antibodies

[00364] The top leads from the initial round of screening were cultured and plasmid minipreps were performed using a QIAprep ® 96 Turbo miniprep kit (Qiagen) according to the manufacturer's instructions. 10 μg/mL miniprepped DNA was added to 4 mL cell-free reactions and incubated overnight for 12 hr at 30°C, at 650 rpm. [00365] Expressed variants from clarified cell-free reactions were purified via immobilized metal ion affinity chromatography (IMAC) purification using a semi-automated high throughput batch purification method. Briefly, purifications were performed in a 96-well plate format where 50 μίΛ βΙΙ of IMAC resin (Ni Sepharose High Performance, GE Healthcare) was equilibrated in IMAC binding buffer (50 mM Tris pH 8.0, 300 mM NaCl, 10 mM imidazole), incubated with 1 mL cell-free reaction for 15 minutes followed by two washes in IMAC binding buffer. His-tagged antibody variants were then eluted using 200 IMAC elution buffer (50 mM Tris pH 8.0, 300 mM NaCl, 500 mM imidazole) and buffer exchanged into PBS using a 96-well Zeba plate (7 kD MWCO, Thermo Fisher). Purified antibodies were quantified via high throughput capillary electrophoresis using the LabChip GXII (Perkin Elmer) against a Herceptin standard curve, according to the manufacturer's instructions.

Example 3: Affinity and Kinetic Binding Analyses

[00366] Monoclonal Anti-FLAG M2 IgG (Sigma-Aldrich # F9291) was immobilized onto a CM5 chip (GE Life Sciences) using amine coupling chemistry (from Amine Coupling Kit, GE Life Sciences). The immobilization steps were carried out at a flow rate of 25 μί/ιηίη in lx HBS-EP+ buffer (GE Life Sciences; lOx Stock diluted before use). The sensor surfaces were activated for 7 min with a mixture of NHS (0.05 M) and EDC (0.2 M). The Anti-Flag M2 IgG was injected over all 4 flow cells at a concentration of 25 μg/mL in 10 mM sodium acetate, pH 4.5, for 7 min. Ethanolamine (1 M, pH 8.5) was injected for 7 min to block any remaining activated groups. An average of 12,000 response units (RU) of capture antibody was immobilized on each flow cell.

[00367] Off-rate and Kinetic binding experiments were performed at 25°C using lx

HBS-EP+ buffer. Test and control antibodies were injected over the Anti-FLAG surface at concentrations of 5-10 μg/mL for 12 seconds at a flow rate of 10 μί/ιηίη on flow cells 2, 3 and 4, followed by a buffer wash for 30 seconds at the same flow rate. Kinetic characterization of antibody samples was carried out with a single concentration of antigen (for off-rate ranking) or a 1 :2 dilution series of antigen (for kinetic characterization) and 1 injection of 0 nM antigen. After capturing ligand (antibody) on the anti-FLAG surface, the analyte (human EpCAM-His) was bound at 50, 25, 12.5, 6.25 and 0 nM for 180 seconds, followed by a 600 second dissociation phase at a flow rate of 50 μΐ/min. Between each ligand capture and analyte binding cycle, regeneration was carried out using 2 injections of 10 mM glycine pH 2.0 for 30 seconds at 30 μί/ιηίη, followed by a 30 second buffer wash step. [00368] The data were fit with the Biacore T200 Evaluation software, using a 1 : 1

Langmuir binding model. K D (affinity, nM) was determined as a ratio of the kinetic rate constants calculated from the fits of the association and dissociation phases.

Example 4: EpCAM Epitope Binning ELISA

[00369] An anti-EpCAM antibody, 5-10 scFv-Fc (SEQ ID NO: 362), was adsorbed on

Nunc 384-well white Maxisorp plates at 2 μg/mL in in sodium bicarbonate buffer (pH 8.9) and incubated at 30°C for 1 hour or overnight at 4°C. The plate was washed 3 times with PBS pH 7.4 with 0.05% Tween and blocked with 2% bovine serum albumin (BSA) in PBS pH 7.4 + 0.1% Tween for 1 hour at 30°C. The block was removed by aspiration.

[00370] A dilution series of antibody was mixed with 1 nM biotinylated EpCAM-Fc

(R&D Systems) in 0.2% BSA in PBS pH 7.4 + 0.1% Tween (diluent buffer) and incubated at 30°C for 1 hour. The plate was washed, and streptavidin-HRP (horseradish peroxidase; Thermo Pierce) was diluted 1 : 10,000 in diluent buffer, added to each well, and incubated at 30°C for 1 hour. The plate was washed and detected by SuperSignal West Pico Chemiluminescent Substrate (Thermo Pierce). Luminescence was detected on a SpectraMax plate reader (Molecular Devices).

Example 5: Fluorescence-Assisted Cell Sorting (FACS)-based Cell Sorting

[00371] CHO-k cells were transfected to stably express EpCAM on the cell surface. CHO parental and stably transfected CHO-EpCAM (human, cynomolgus and mouse EpCAM-expressing cells) cells were washed with DPBS, detached with Accutase™ (BD Biosciences; San Jose, CA), and resuspended in ice-cold FACS buffer (DPBS buffer supplemented with 0.5% bovine serum albumin).

[00372] A total of 200,000 cells per 96-well were incubated on ice for 60 mins with

100 nM of test antibodies diluted in FACS buffer. Cells were washed twice with FACS buffer and incubated on ice for 30 mins with R-phycoerythrin AffiniPure F(ab')2 fragment, goat anti-Human IgG, Fey fragment specific secondary detection antibody (Jackson ImmunoResearch Laboratories, West Grove, PA) diluted at 1 :200 with FACS buffer. Cells were washed twice with FACS buffer, fixed in 4% paraformaldehyde in PBS (Santa Cruz Biotechnology; Dallas, TX) for 20 mins on ice in the dark, washed twice with FACS buffer and analyzed using the BD LSR II Flow Cytometer (BD Biosciences; San Jose, CA). Data were analyzed using FlowJo (FlowJo, LLC; Ashland, OR) to determine mean fluorescence intensities. Binding constants were calculated using the statistical software, GraphPad Prism (GraphPad Software; La Jolla, CA) using the nonlinear regression equation, one site - specific binding with Hill slope. Secondary antibody alone was used as a control, in addition to measuring non-specific EpCAM antibody binding to CHO parental cells. For some variants, binding to human tumor cells, HCT 116 and JIMT1 cells were also evaluated.

Example 6: Epitope Binding and Domain Mapping

[00373] The EpCAM domain bound by the anti-human EpCAM Abs was mapped by cell binding analysis on stably transfected CHO cells expressing human/mouse chimeric EpCAM constructs. Since anti-human EpCAM Abs do not have cross-reactive binding to mouse EpCAM, chimeric human/mouse EpCAM constructs were generated to map the binding region on human EpCAM. To make the expression constructs, human and mouse EpCAM amino acid sequences corresponding to exon 2, exon 3 and exons 4-9 were switched with the alternative mouse and human amino acid sequences, respectively. The following constructs were generated and expressed in CHO cells: 1) MHH, 2) HMH, 3) HHM, 4) HMM, 5) MHM and 6) MMH, where the three letters denote human (H) or mouse (M) amino acid sequences in exon 2, exon 3 and exons 4-9, respectively. EpCAM Abs were tested for binding to the different chimeric cell lines at a concentration of 10 μg/mL by FACS binding analysis.

[00374] The results show that the SRP1464-A08 and SRP1464-B04 antibodies provided herein bind an epitope on EpCAM that is encoded by exons 4-7 of the EpCAM gene. On the other hand, 1332-A05 binds to an epitope encoded by exon 2.

[00375] Based on sequence similarity, it is expected that other SRP1464- antibodies, as well as the (parent) SRP1304- antibodies and (child) SRP1557- antibodies also bind an epitope on EpCAM that is encoded by exons 4-7. Similarly, it is expected that other SRP1332- antibodies also bind an epitope encoded by exon 2.

[00376] Despite the fact that they bind epitopes encoded by different exons both the SRP1332-A05 antibody (exon 2) and the 1464-A08 and 1464-B04 antibodies (exons 4-7) competed with a known exon 2 binder (SEQ ID NO: 336) in an experiment where each antibody was tested for its ability to block binding of the known exon 2 binder. This suggests that the epitope encoded by exon 2 (bound by SRP1332- and SEQ ID NO: 336) and exons 4- 7 (bound by SRP1464-) are proximal to each other in the folded EpCAM structure, as expressed on the cell surface. Example 7: Refined Epitope Binding and Competition Assay

[00377] The EpCAM domain bound by the anti -human EpCAM Abs within exons 4-7 was mapped by additional cell binding analysis on stably transfected CHO cells expressing human/mouse chimeric EpCAM constructs for exons 4 and 5 only. To make the expression constructs, human EpCAM amino acid sequences within parts of exon 4 and/or exon5 were replaced with mouse EpCAM amino acid sequences. The following constructs were generated and expressed in CHO cells: 1) MH, 2) HM, and 3) MM, where the two letters denote human (H) or mouse (M) amino acid sequences within exons 4 and exon 5, respectively. EpCAM Abs were tested for binding to the different chimeric cell lines at a concentration of 10 μg/mL by FACS binding analysis.

[00378] The results show that the SRP1464-B04 and SRP1557-G01 antibodies provided herein bind an epitope on EpCAM that is encoded by exon 5 of the EpCAM gene. Positive control Adecatumumab (known to bind exon 5) also bound to exon 5 in the same assay. This is further confimed by competition binding experiment using CHO cells expressing human EpCAM, which showed that both SRP1464-B04 and SRP1557-G01 compete with Adecatumumab for binding to EpCAM.

[00379] Based on sequence similarity, it is expected that other SRP1464- antibodies, as well as the (parent) SRP1304- antibodies and other (child) SRP1557- antibodies also bind an epitope on EpCAM that is encoded by exon 5.

[00380] It should be noted that though the SRP1464-B04 and SRP1557-G01 antibodies bind to the same exon as, and compete for binding with, Adecatumumab, both SRP1464-B04 and SRP1557-G01 have siginificant binding affinity for cynomolgous EpCAM protein (see Tables 5 and 6, below), while Adecatumumab does not have significant binding affinity for cynomolgous EpCAM. See Miinz et al, Cancer Cell Int., 2010, 10:44. Cynomolgous cross- reactivity is advantageous because it evaluation of the toxicity of antibodies in a primate model, allowing such evaluation without exposing human subjects to molecules of unknown toxicity. Thus, the SRP1464-B04 and SRP1557-G01 antibodies demonstrate a significant and unexpected biological property not found in known antibodies binding exon 5 of human EpCAM.

Example 8: Characteristics of Illustrative Anti-EpCAM Antibodies

[00381] FIG. 1 provides an alignment of the "1304," "1464," and "1557" V H sequences provided herein. FIG. 2 provides an alignment of the "1332" VH sequences provided herein. FIG. 3 provides an alignment of the "1304," "1464," and "1557" V L sequences provided herein. FIG. 4 provides an alignment of the "1332" VL sequences provided herein.

[00382] Tables 5-7 show results obtained using the illustrative antibodies described herein.

[00383] Table 5 shows results obtained from certain antibodies provided herein.

Antibody SRP-1304-G11 was isolated from a naive library constructing using trinucleotides to introduce variability into CDRs. SRP-1464-A02, SRP-1464-A08, and SRP-1464-B04 were isolated from a first affinity maturation library that was based on SRP-1304-G11, and constructed using a soft randomization approach.

[00384] Briefly, during soft randomization, polynucleotides encoding the antibodies were synthesized by incorporating low levels (-30%) of non-parent nucleotides at each position within a CDR. For example, for a parent polynucleotide with A at a position to be soft randomized, a series of oligonucleotides were synthesized where about 70% have A at the position, 10% have C at the position, 10% have G at the position, and 10% have T at the position. As a result, when each position in a codon is soft randomized, approximately 34.3% of codons will remain unchanged, but any of the other 19 amino acids may also occur at the soft randomized position.

Table 5.

[00385] Table 6 shows results obtained from antibodies isolated from a second affinity matured library, constructed using soft randomization, based on the SRP1464-B04 antibody.

[00386] The "EC5 0 " value is the concentration of the antibody at which half-maximum signal is achieved in an ELISA assay where EpCAM protein is adsorbed onto a plate and then bound by the respective antibody provided herein. The anti-EpCAM antibody is detected with horseradish peroxidase (HRP)-conjugated anti-human Fc antibody.

Table 6. Results obtained from antibodies isolated from a first affinity matured library, based on the SRP1464-B04 antibody provided in Table 5.

[00387] Table 7 shows results obtained from antibodies isolated from a third affinity matured library constructed by performing soft randomization on a different antibody.

Table 7. Results obtained from antibodies isolated from a third affinity matured library.

Example 9: Sequences

[00388] Table 8 provides sequences referred to herein. In Table 8, the numbering scheme is indicated as Chothia or Kabat for the sequences where the scheme is significant, e.g., for CDR-Hl and CDR-H2 regions. Otherwise, the scheme is not indicated, and those of skill will recognize that either numbering scheme, or another, can apply.

Table 8. Sequences.

SEQ ID Molecule Region Scheme Sequence Length NO:

1 MAPPQVLAFGLLLAAATATFAAAQEECVCE

NYKLAVNCFVNNNRQCQCTSVGAQNTVICS KLAAKCLVMKAEMNGSKLGRRAKPEGALQN NDGLYDPDCDESGLFKAKQCNGTSTCWCVN TAGVRRTDKDTEITCSERVRTYWI IIELKH

h EpCAM KAREKPYDSKSLRTALQKEITTRYQLDPKF

ITSILYENNVITIDLVQNSSQKTQNDVDIA DVAYYFEKDVKGESLFHSKKMDLTVNGEQL DLDPGQTLIYYVDEKAPEFSMQGLKAGVIA VIWWIAWAGIWLVI SRKKRMAKYEKA EIKEMGEMHRELNA 314

2 MAQSGQQCLQEEQETSLQQHYSFFVFLNFL

ECVCENYKLAVNCFLNDNGQCQCTSIGAQN TVLCSKLAAKCLVMKAEMNGSKLGRRAKPE GALQN DGLYDPDCDESGLFKAKQCNGTST CWCVNTAGVRRTDKDTEITCSERVRTYWII

cEpCAM IELKHKAREKPYDVQSLRTALEEAIKTRYQ

LDPKFITNILYEDNVITI DLVQNSSQKTQN DVDIADVAYYFEKDVKGESLFHSKKMDLRV NGEQLDLDPGQTLIYYVDEKAPEFSMQGLK AGVIAVIWWIAIVAGIWLVISRKKRMA KYEKAEIKEMGEIHRELNA 319

3 MAGPQALAFGLLLAWTATLAAAQRDCVCD

mEpCAM NYKLATSCSLNEYGECQCTSYGTQNTVICS

KLASKCLAMKAEMTHSKSGRRIKPEGAIQN 315 NDGLYDPDCDEQGLFKAKQCNGTATCWCVN SEQID Molecule Region Scheme Sequence Length NO:

TAGVRRTDKDTEITCSERVRTYWIIIELKH KERESPYDHQSLQTALQEAFTSRYKLNQKF IK IMYENNVITIDLMQNSSQKTQDDVDIA DVAYYFEKDVKGESLFHSSKSMDLRVNGEP LDLDPGQTLIYYVDEKAPEFSMQGLTAGII AVIVWSLAVIAGIWLVISTRKKSAKYEK AEIKEMGEIHRELNA

4 1304-G11 CDR-H1 Chothia GFTFSGS 7

5 1332-A05 CDR-H1 Chothia DYAFANR 7

6 1332-COl CDR-H1 Chothia GYAFTNS 7

7 1332-F11 CDR-H1 Chothia GYAFANR 7

8 1464-A02 CDR-H1 Chothia GFTFGVE 7

9 1464-A08 CDR-H1 Chothia GFTFSGS 7

10 1464-B04 CDR-H1 Chothia GFTFSGS 7

11 1557-A04 CDR-H1 Chothia GFTFSGS 7

12 1557-A05 CDR-H1 Chothia GFTFGGS 7

13 1557-B03 CDR-H1 Chothia GFTFRSS 7

14 1557-B10 CDR-H1 Chothia GFTFSGC 7

15 1557-C06 CDR-H1 Chothia GFTFRGA 7

16 1557-E07 CDR-H1 Chothia GFTFSGS 7

17 1557-E08 CDR-H1 Chothia GFTFRAS 7

18 1557-E11 CDR-H1 Chothia GFTFRGS 7

19 1557-F01 CDR-H1 Chothia GFTFSGS 7

20 1557-F02 CDR-H1 Chothia GFTFRGS 7

21 1557-F03 CDR-H1 Chothia GFTFSGS 7

22 1557-F05 CDR-H1 Chothia GFTFRGS 7

23 1557-G01 CDR-H1 Chothia GFTFSVT 7

24 1557-G03 CDR-H1 Chothia GFTFGGS 7

25 1557-G04 CDR-H1 Chothia GFTFCGS 7 SEQID Molecule Region Scheme Sequence Length NO:

26 1557-G06 CDR-H1 Chothia GFTFSGF 7

27 1557-H04 CDR-H1 Chothia GFTFSVT 7

28 1557-H10 CDR-H1 Chothia GFTFSGS 7

29 1304-G11 CDR-H1 Kabat GSSMS 5

30 1332-A05 CDR-H1 Kabat NRWLG 5

31 1332-COl CDR-H1 Kabat NSWLG 5

32 1332-F11 CDR-H1 Kabat NRWLG 5

33 1464-A02 CDR-H1 Kabat VESMS 5

34 1464-A08 CDR-H1 Kabat GSSMS 5

35 1464-B04 CDR-H1 Kabat GSSMS 5

36 1557-A04 CDR-H1 Kabat GSSMS 5

37 1557-A05 CDR-H1 Kabat GSSMS 5

38 1557-B03 CDR-H1 Kabat SSSMS 5

39 1557-B10 CDR-H1 Kabat GCSMS 5

40 1557-C06 CDR-H1 Kabat GASMS 5

41 1557-E07 CDR-H1 Kabat GSSMS 5

42 1557-E08 CDR-H1 Kabat AS SMS 5

43 1557-E11 CDR-H1 Kabat GSSMS 5

44 1557-F01 CDR-H1 Kabat GSSMS 5

45 1557-F02 CDR-H1 Kabat GSSMS 5

46 1557-F03 CDR-H1 Kabat GSSMS 5

47 1557-F05 CDR-H1 Kabat GSSMS 5

48 1557-G01 CDR-H1 Kabat VTSMS 5

49 1557-G03 CDR-H1 Kabat GSSMS 5

50 1557-G04 CDR-H1 Kabat GSSMS 5 SEQ ID Molecule Region Scheme Sequence Length NO:

51 1557-G06 CDR-H 1 Kabat GFSMS 5

52 1557-H04 CDR-H 1 Kabat VTSMS 5

53 1557-H 10 CDR-H 1 Kabat GSSMS 5

54 1304-G11 CDR-H2 Chothia DGGDGY 6

55 1332-A05 CDR-H2 Chothia FPGSGN 6

56 1332-COl CDR-H2 Chothia FPGSGN 6

57 1332-F11 CDR-H2 Chothia FPGSGN 6

58 1464-A02 CDR-H2 Chothia DGGDGY 6

59 1464-A08 CDR-H2 Chothia AGGDGY 6

60 1464-B04 CDR-H2 Chothia DGGEGY 6

61 1557-A04 CDR-H2 Chothia DGGEGS 6

62 1557-A05 CDR-H2 Chothia GGGEGS 6

63 1557-B03 CDR-H2 Chothia GGHEGY 6

64 1557-B10 CDR-H2 Chothia AGGEGN 6

65 1557-C06 CDR-H2 Chothia DGSQGS 6

66 1557-E07 CDR-H2 Chothia DGGEGS 6

67 1557-E08 CDR-H2 Chothia DGGVGS 6

68 1557-E11 CDR-H2 Chothia DGGEGS 6

69 1557-F01 CDR-H2 Chothia DGGEGS 6

70 1557-F02 CDR-H2 Chothia DGGEGS 6

71 1557-F03 CDR-H2 Chothia AGGGGS 6

72 1557-F05 CDR-H2 Chothia DGGEGS 6

73 1557-G01 CDR-H2 Chothia AGGEGS 6

74 1557-G03 CDR-H2 Chothia GGGEGY 6

75 1557-G04 CDR-H2 Chothia DGGVGS 6 SEQ ID Molecule Region Scheme Sequence Length NO:

76 1557-G06 CDR-H2 Chothia DGGEGS 6

77 1557-H04 CDR-H2 Chothia AGGEGS 6

78 1557-H 10 CDR-H2 Chothia DGGEGS 6

79 1304-G11 CDR-H2 Kabat AIDGGDGYTNYADSVRG 17

80 1332-A05 CDR-H2 Kabat DIFPGSGNIHYNEKFKG 17

81 1332-COl CDR-H2 Kabat DIFPGSGNIHYNEKFKG 17

82 1332-F11 CDR-H2 Kabat DIFPGSGNIHYNEKFKG 17

83 1464-A02 CDR-H2 Kabat AIDGGDGYTGYADSVKD 17

84 1464-A08 CDR-H2 Kabat AIAGGDGYTGYADSVKG 17

85 1464-B04 CDR-H2 Kabat AIDGGEGYTSYADSVKG 17

86 1557-A04 CDR-H2 Kabat AIDGGEGSTAYADSVKG 17

87 1557-A05 CDR-H2 Kabat AIGGGEGSTGYADSVKG 17

88 1557-B03 CDR-H2 Kabat AIGGHEGYTGYADSVKG 17

89 1557-B10 CDR-H2 Kabat AIAGGEGNTGYADSVKG 17

90 1557-C06 CDR-H2 Kabat AIDGSQGSTGYADSVKG 17

91 1557-E07 CDR-H2 Kabat AIDGGEGSTGYADSVKG 17

92 1557-E08 CDR-H2 Kabat AIDGGVGSTGYADSVKG 17

93 1557-E11 CDR-H2 Kabat AIDGGEGSTGYADSVKG 17

94 1557-F01 CDR-H2 Kabat AIDGGEGSTGYADSVKG 17

95 1557-F02 CDR-H2 Kabat AIDGGEGSTGYADSVKG 17

96 1557-F03 CDR-H2 Kabat AIAGGGGSTGYADSVKG 17

97 1557-F05 CDR-H2 Kabat AIDGGEGSTGYADSVKG 17

98 1557-G01 CDR-H2 Kabat AIAGGEGSTGYADSVKG 17

99 1557-G03 CDR-H2 Kabat AIGGGEGYTGYADSVKG 17

100 1557-G04 CDR-H2 Kabat AIDGGVGSTGYADSVKG 17 SEQ ID Molecule Region Scheme Sequence Length NO:

101 1557-G06 CDR-H2 Kabat AI DGGE GSTGYADSVKG 17

102 1557-H04 CDR-H2 Kabat AIAGGE GSTGYADSVKG 17

103 1557-H 10 CDR-H2 Kabat AI DGGE GSTGYADSVKG 17

104 1304-G11 CDR-H3 GWHPQTYYGLDY 12

105 1332-A05 CDR-H3 LRNWEGPMDY 10

106 1332-COl CDR-H3 LRNWDMPMDY 10

107 1332-F11 CDR-H3 LRNWEGPMDY 10

108 1464-A02 CDR-H3 AWHPQTYYGVDY 12

109 1464-A08 CDR-H3 GWHRQDYYGQDY 12

110 1464-B04 CDR-H3 GWHPQT LYDLDY 12

111 1557-A04 CDR-H3 GWHPQTMYDLDY 12

112 1557-A05 CDR-H3 GWHDQS LYDRDY 12

113 1557-B03 CDR-H3 GWNPQT LYHLDY 12

114 1557-B10 CDR-H3 GWHPQT LYDLDY 12

115 1557-C06 CDR-H3 GWHPQTMYDLDY 12

116 1557-E07 CDR-H3 GWHPQT LYDLDY 12

117 1557-E08 CDR-H3 GWHPQT LYDLDY 12

118 1557-E11 CDR-H3 GWHPQS LYDLDY 12

119 1557-F01 CDR-H3 GWHPQT LYDLDY 12

120 1557-F02 CDR-H3 GWHPQTMYNLDY 12

121 1557-F03 CDR-H3 GWHPQT LYDLDY 12

122 1557-F05 CDR-H3 DWHPQT LYDLDY 12

123 1557-G01 CDR-H3 GWHPQT LYDLDY 12

124 1557-G03 CDR-H3 GWHPQT LYDLDY 12

125 1557-G04 CDR-H3 GWHPQT LYDLDY 12 SEQ ID Molecule Region Scheme Sequence Length NO:

126 1557-G06 CDR-H3 GWHPQTLYHLDY 12

127 1557-H04 CDR-H3 GWHPQTLYDLDY 12

128 1557-H 10 CDR-H3 GWHPQSMYDLDY 12

129 1304-G11 CDR-L1 RASQSVSSSYLA 12

130 1332-A05 CDR-L1 KSSQSLLNSGNQKNYLT 17

131 1332-COl CDR-L1 KSSQSLLNSGNQKNYLT 17

132 1332-F11 CDR-L1 KSSQSLLNSGNQKNYLT 17

133 1464-A02 CDR-L1 RASQSVSSSYLA 12

134 1464-A08 CDR-L1 RASQSVSSSYLA 12

135 1464-B04 CDR-L1 RASQSVSSSYLA 12

136 1557-A04 CDR-L1 RASQNVSTNYLA 12

137 1557-A05 CDR-L1 SASQTVSSSYIA 12

138 1557-B03 CDR-L1 RASQKCSSSSMA 12

139 1557-B10 CDR-L1 RASQGLASRYMA 12

140 1557-C06 CDR-L1 RASQRGTSSYLA 12

141 1557-E07 CDR-L1 RASQVLSSSSLA 12

142 1557-E08 CDR-L1 RASQGDSSSVLA 12

143 1557-E11 CDR-L1 RASQPVPNTTLA 12

144 1557-F01 CDR-L1 RASQSVSSSKLA 12

145 1557-F02 CDR-L1 RASQSVSSSYLA 12

146 1557-F03 CDR-L1 RASQSVKTSDLA 12

147 1557-F05 CDR-L1 RASQTVSPSVLA 12

148 1557-G01 CDR-L1 RASQVLSSSSLA 12

149 1557-G03 CDR-L1 RASQSVHSSYLA 12

150 1557-G04 CDR-L1 RASQSVSSSYLA 12 SEQ ID Molecule Region Scheme Sequence Length NO:

151 1557-G06 CDR-L1 RASQSIPSSYLA 12

152 1557-H04 CDR-L1 RASQSVSTGYLA 12

153 1557-H 10 CDR-L1 RASQVLSSSSLA 12

154 1304-G11 CDR-L2 GASSRAT 7

155 1332-A05 CDR-L2 WASTRES 7

156 1332-COl CDR-L2 WASTRES 7

157 1332-F11 CDR-L2 RASTRES 7

158 1464-A02 CDR-L2 GASSRAT 7

159 1464-A08 CDR-L2 GASSRAT 7

160 1464-B04 CDR-L2 GASSRAT 7

161 1557-A04 CDR-L2 GASSRAT 7

162 1557-A05 CDR-L2 GASSRAT 7

163 1557-B03 CDR-L2 GASSRAT 7

164 1557-B10 CDR-L2 GASSRAT 7

165 1557-C06 CDR-L2 GASSRAT 7

166 1557-E07 CDR-L2 GASSRAT 7

167 1557-E08 CDR-L2 GASSRAT 7

168 1557-E11 CDR-L2 GASSRAT 7

169 1557-F01 CDR-L2 GASSRAT 7

170 1557-F02 CDR-L2 GASSRAT 7

171 1557-F03 CDR-L2 GASSRAT 7

172 1557-F05 CDR-L2 GASSRAT 7

173 1557-G01 CDR-L2 GASSRAT 7

174 1557-G03 CDR-L2 GASSRAT 7

175 1557-G04 CDR-L2 GASSRAT 7 SEQ ID Molecule Region Scheme Sequence Length NO:

176 1557-G06 CDR-L2 GASSRAT 7

177 1557-H04 CDR-L2 GASSRAT 7

178 1557-H 10 CDR-L2 GASSRAT 7

179 1304-G11 CDR-L3 QQYWYGPPT 9

180 1332-A05 CDR-L3 QNDLSYPLT 9

181 1332-COl CDR-L3 QNDYRYPLT 9

182 1332-F11 CDR-L3 QNDSSYPLT 9

183 1464-A02 CDR-L3 QQTSEAPPT 9

184 1464-A08 CDR-L3 QQNQAAPAT 9

185 1464-B04 CDR-L3 QQLVTSPPT 9

186 1557-A04 CDR-L3 QQLVTNPPT 9

187 1557-A05 CDR-L3 QQLLTSPPT 9

188 1557-B03 CDR-L3 QQLQTSPPT 9

189 1557-B10 CDR-L3 QQVMTI PPT 9

190 1557-C06 CDR-L3 QQHVTSPPT 9

191 1557-E07 CDR-L3 QQRAAPPPT 9

192 1557-E08 CDR-L3 QQLVPSPPT 9

193 1557-E11 CDR-L3 QQLVPSPPT 9

194 1557-F01 CDR-L3 QQLETI PPT 9

195 1557-F02 CDR-L3 QQLFNSPPT 9

196 1557-F03 CDR-L3 QQLVSKPPT 9

197 1557-F05 CDR-L3 QQLVTNPPT 9

198 1557-G01 CDR-L3 QQLVTSPPT 9

199 1557-G03 CDR-L3 QQLLSSPPT 9

200 1557-G04 CDR-L3 QQDSFVPPT 9 SEQ ID Molecule Region Scheme Sequence Length NO:

201 1557-G06 CDR-L3 QQLATSPPT 9

202 1557-H04 CDR-L3 QQLVTRPPT 9

203 1557-H 10 CDR-L3 QQLVTAPPT 9

204 MEVQLLESGGGLVRPGGSLRLSCAASGFTF

SGSSMSWVRQAPGKGLEWVGAIDGGDGYTN YADSVRGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQTYYGLDYWGQGTLVTV SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL SPGERATLSCRASQSVSSSYLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSSSGTDFT LTISRLEPEDFAVYYCQQYWYGPPTFGQGT

1304-G11 scFv-Fc KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL

LGGSSVFLFPPKPKDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRWSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTI SKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGKGGSHHHHHH 492

205 MELVMTQSPSSLTVTAGEKVTMSCKSSQSL

LNSGNQKNYLTWYQQKPGQPPKLLIYWAST RESGVPDRFTGSGSGTDFTLTISSVQAEDL AVYYCQNDLSYPLTFGAGTKLEIKGGGGSG GGGSGGGGSEVQLLEQSGAELVRPGTSVKI SCKASDYAFANRWLGWVKQRPGHGLEWIGD IFPGSGNIHYNEKFKGKATLTADKSSSTAY MQLSSLTFEDSAVYFCARLRNWEGPMDYWG

1332-A05 scFv-Fc QGTTVTVSSAAGSDQEPKSSDKTHTCPPCS

APELLGGSSVFLFPPKPKDTLMISRTPEVT CVWDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRWSVLTVLHQDWLNGKEYK CKVSNKALPAPI EKTISKAKGQPREPQVYT LPPSRDELTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGKGSGDYKDDDDKGSGHHHHHH 507

206 MELVMTQSPSSLTVTAGEKVTMSCKSSQSL

LNSGNQKNYLTWYQQKPGQPPKLLIYWAST RESGVPDRFTGSGSGTDFTLTISSVQAEDL AVYYCQNDYRYPLTFGAGTKLEIKGGGGSG GGGSGGGGSEVQLLEQSGAELVRPGTSVKI SCKASGYAFTNSWLGWVKQRPGHGLEWIGD

1332-COl scFv-Fc IFPGSGNIHYNEKFKGKATLTADKSSSTAY

MQLSSLTFEDSAVYFCARLRNWDMPMDYWG QGTTVTVSSAAGSDQEPKSSDKTHTCPPCS APELLGGSSVFLFPPKPKDTLMISRTPEVT CVWDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRWSVLTVLHQDWLNGKEYK CKVSNKALPAPI EKTISKAKGQPREPQVYT 507 LPPSRDELTKNQVSLTCLVKGFYPSDIAVE SEQ ID Molecule Region Scheme Sequence Length NO:

WESNGQPENNYKTTPPVLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGKGSGDYKDDDDKGSGHHHHHH

207 MELVMTQSPSSLTVTAGEKVTMSCKSSQSL

LNSGNQKNYLTWYQQKPGQPPKLLIYRAST RESGVPDRFTGSGSGTDFTLTISSVQAEDL AVYYCQNDSSYPLTFGAGTKLEIKGGGGSG GGGSGGGGSEVQLLEQSGAELVRPGTSVKI SCKASGYAFANRWLGWVKQRPGHGLEWIGD IFPGSGNIHYNEKFKGKATLTADKSSSTAY MQLSSLTFEDSAVYFCARLRNWEGPMDYWG

1332-F11 scFv-Fc QGTTVTVSSAAGSDQEPKSSDKTHTCPPCS

APELLGGSSVFLFPPKPKDTLMISRTPEVT CVWDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRWSVLTVLHQDWLNGKEYK CKVSNKALPAPI EKTISKAKGQPREPQVYT LPPSRDELTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGKGSGDYKDDDDKGSGHHHHHH 507

208 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

GVESMSWVRQAPGKGLEWVGAIDGGDGYTG YADSVKDRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKAWHPQTYYGVDYWGQGTLVTV SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL SPGERATLSCRASQSVSSSYLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQTSEAPPTFGQGT

1464-A02 scFv-Fc KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL

LGGSSVFLFPPKPKDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRWSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTI SKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGKGSGDYKDDDDKGSGHHHHHH 503

209 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

SGSSMSWVRQAPGKGLEWVGAIAGGDGYTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHRQDYYGQDYWGQGTLVTV SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL SPGERATLGCRASQSVSSSYLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT

1464-A08 scFv-Fc LTISRLEPEDFAVYYCQQNQAAPATFGQGT

KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL LGGSSVFLFPPKPKDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRWSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTI SKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDK 503 SRWQQGNVFSCSVMHEALHNHYTQKSLSLS SEQ ID Molecule Region Scheme Sequence Length NO:

PGKGSGDYKDDDDKGSGHHHHHH

210 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

SGSSMSWVRQAPGKGLEWVGAIDGGEGYTS YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL SPGERATLSCRASQSVSSSYLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQLVTSPPTFGQGT

1464-B04 scFv-Fc KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL

LGGSSVFLFPPKPKDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRWSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTI SKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGKGSGDYKDDDDKGSGHHHHHH 503

211 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

SGSSMSWVRQAPGKGLEWVGAIDGGEGSTA YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQTMYDLDYWGQGTLVTV SSGGGGSGGGGSGGGGNEIVLTQSPGTLSL SPGERATLSCRASQNVSTNYLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQLVTNPPTFGQGT

1557-A04 scFv-Fc KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL

LGGSSVFLFPPKPKDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRWSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTI SKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGKGSGDYKDDDDKGSGHHHHHH 503

212 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

GGSSMSWVRQAPGKGLEWVGAIGGGEGSTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHDQSLYDRDYWGQGTLVTV SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL SPGERATLSCSASQTVSSSYIAWYQQKPGQ APRLLIYGASSRATGIPDRFGGSGSGTDFT LTISRLEPEDFAVYYCQQLLTSPPTFGQGT

1557-A05 scFv-Fc KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL

LGGSSVFLFPPKPKDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRWSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTI SKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGKGSGDYKDDDDKGSGHHHHHH 503 SEQ ID Molecule Region Scheme Sequence Length NO:

213 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

RSSSMSWVRQAPGKGLEWVGAIGGHEGYTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWNPQTLYHLDYWGQGTLVTV SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL SPGERATLSCRASQKCSSSSMAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQLQTSPPTFGQGT

1557-B03 scFv-Fc KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL

LGGSSVFLFPPKPKDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRWSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTI SKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGKGSGDYKDDDDKGSGHHHHHH 503

214 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

SGCSMSWVRQAPGKGLEWVGAIAGGEGNTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL SPGERATLSCRASQGLASRYMAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQVMTIPPTFGQGT

1557-B10 scFv-Fc KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL

LGGSSVFLFPPKPKDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRWSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTI SKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGKGSGDYKDDDDKGSGHHHHHH 503

215 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

RGASMSWVRQAPGKGLEWVGAIDGSQGSTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQTMYDLDYWGQGTLVTV SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL SPGERATLSCRASQRGTSSYLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQHVTSPPTFGQGT

1557-C06 scFv-Fc KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL

LGGSSVFLFPPKPKDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRWSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTI SKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGKGSGDYKDDDDKGSGHHHHHH 503

216 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

1557-E07 scFv-Fc SGSSMSWVRQAPGKGLEWVGAIDGGEGSTG 503

YADSVKGRFTISRDNSKNTLYLQMNSLRAE SEQ ID Molecule Region Scheme Sequence Length NO:

DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL SPGERATMSCRASQVLSSSSLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFA LTISRLEPEDFAVYYCQQRAAPPPTFGQGT KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL LGGSSVFLFPPKPKDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRWSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTI SKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGKGSGDYKDDDDKGSGHHHHHH

217 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

RASSMSWMRQAPGKGLEWVGAIDGGVGSTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL SPGERATLSCRASQGDSSSVLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQLVPSPPTFGQGT

1557-E08 scFv-Fc KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL

LGGSSVFLFPPKPKDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRWSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTI SKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGKGSGDYKDDDDKGSGHHHHHH 503

218 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

RGSSMSWVRQAPGKGLEWVGAIDGGEGSTG YADSVKGRFTINRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQSLYDLDYWGQGTLVTV SSGGGGSGGGDSGGGGSEIVLTQSPGTLSL SPGERATLSCRASQPVPNTTLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAAYYCQQLVPSPPTFGQGT

1557-E11 scFv-Fc KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL

LGGSSVFLFPPKPKDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRWSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTI SKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGKGSGDYKDDDDKGSGHHHHHH 503

219 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

SGSSMSWVRQAPGKGLEWVGAIDGGEGSTG

1557-F01 scFv-Fc YADSVKGRFTISRDNSKNTLYLQMNSLRAE

DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL 503 SPGERATLSCRASQSVSSSKLAWYQQKPGQ SEQ ID Molecule Region Scheme Sequence Length NO:

APRLLIYGASSRATGIPDRFSGYGSGTDFT LTISRLEPEDFAVYYCQQLETIPPTFGQGT KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL LGGSSVFLFPPKPKDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRWSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTI SKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGKGSGDYKDDDDKGSGHHHHHH

220 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

RGSSMSWVRQAPGKGLEWVGAIDGGEGSTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQTMYNLDYWGQGTLVTV SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL SPGERATLSCRASQSVSSSYLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQLFNSPPTFGQGT

1557-F02 scFv-Fc KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL

LGGSSVFLFPPKPKDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRWSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTI SKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGKGSGDYKDDDDKGSGHHHHHH 503

221 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

SGSSMSWVRQAPGKGLEWVGAIAGGGGSTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL SPGERATLSCRASQSVKTSDLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQLVSKPPTFGQGT

1557-F03 scFv-Fc KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL

LGGSSVFLFPPKPKDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRWSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTI SKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGKGSGDYKDDDDKGSGHHHHHH 503

222 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

RGSSMSWVRQAPGKGLEWVGAIDGGEGSTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKDWHPQTLYDLDYWGQGTLVTV

1557-F05 scFv-Fc SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL

SPGERATLSCRASQTVSPSVLAWYQQKPGQ APRLLIYGASSRATGIPGRFSGSGSGTDFT LTISRLEPEDFAVYYCQQLVTNPPTFGQGT 503 KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL SEQ ID Molecule Region Scheme Sequence Length NO:

LGGSSVFLFPPKPKDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRWSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTI SKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGKGSGDYKDDDDKGSGHHHHHH

223 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

SVTSMSWMRQAPGKGLEWVGAIAGGEGSTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL SPGERATMSCRASQVLSSSSLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQLVTSPPTFGQGT

1557-G01 scFv-Fc KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL

LGGSSVFLFPPKPKDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRWSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTI SKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGKGSGDYKDDDDKGSGHHHHHH 503

224 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

GGSSMSWVRQAPGKGLEWVGAIGGGEGYTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL SPGERATLSCRASQSVHSSYLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQLLSSPPTFGQGT

1557-G03 scFv-Fc KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL

LGGSSVFLFPPKPKDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRWSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTI SKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGKGSGDYKDDDDKGSGHHHHHH 503

225 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

CGSSMSWVRQAPGKGLEWVGAIDGGVGSTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV SSGGGDSGGGGSGGGGSEIVLTQSPGTLSL

1557-G04 scFv-Fc SPGERATLSCRASQSVSSSYLAWYQQKPGQ

APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQDSFVPPTFGQGT KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL LGGSSVFLFPPKPKDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREE 503 QYNSTYRWSVLTVLHQDWLNGKEYKCKVS SEQ ID Molecule Region Scheme Sequence Length NO:

NKALPAPIEKTI SKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGKGSGDYKDDDDKGSGHHHHHH

226 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

SGFSMSWVRQAPGKGLEWVGAIDGGEGSTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQTLYHLDYWGQGTLVTV SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL SPGERATLSCRASQSIPSSYLAWYQQEPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQLATSPPTFGQGT

1557-G06 scFv-Fc KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL

LGGSSVFLFPPKPKDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRWSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTI SKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGKGSGDYKDDDDKGSGHHHHHH 503

227 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

SVTSMSWMRQAPGKGLEWVGAIAGGEGSTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV SSGGGGSDGGGSGGGGSEIVLTQGPSTLSL SPGERATLSCRASQSVSTGYLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQLVTRPPTFGQGT

1557-H04 scFv-Fc KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL

LGGSSVFLFPPKPKDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRWSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTI SKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGKGSGDYKDDDDKGSGHHHHHH 503

228 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

SGSSMSWVRQAPGKGLEWVGAIDGGEGSTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQSMYDLDYWGQGTLVTV SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL SPGERATMSCRASQVLSSSSLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT

1557-H 10 scFv-Fc LTISRLEPEDFAVYYCQQLVTAPPTFGQGT

KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL LGGSSVFLFPPKPKDTLMISRTPEVTCVW DVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRWSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTI SKAKGQPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESN 503 GQPENNYKTTPPVLDSDGSFFLYSKLTVDK SEQ ID Molecule Region Scheme Sequence Length NO:

SRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGKGSGDYKDDDDKGSGHHHHHH

229 EVQLLESGGGLVRPGGSLRLSCAASGFTFS

GSSMSWVRQAPGKGLEWVGAIDGGDGYTNY

1304-G11 VH ADSVRGRFTISRDNSKNTLYLQMNSLRAED

TAVYYCAKGWHPQTYYGLDYWGQGTLVTVS

S 121

230 EVQLLEQSGAELVRPGTSVKISCKASDYAF

ANRWLGWVKQRPGHGLEWIGDIFPGSGNIH

1332-A05 VH

YNEKFKGKATLTADKSSSTAYMQLSSLTFE DSAVYFCARLRNWEGPMDYWGQGTTVTVSS 120

231 EVQLLEQSGAELVRPGTSVKISCKASGYAF

TNSWLGWVKQRPGHGLEWIGDIFPGSGNIH

1332-COl VH

YNEKFKGKATLTADKSSSTAYMQLSSLTFE DSAVYFCARLRNWDMPMDYWGQGTTVTVSS 120

232 EVQLLEQSGAELVRPGTSVKISCKASGYAF

ANRWLGWVKQRPGHGLEWIGDIFPGSGNIH

1332-F11 VH

YNEKFKGKATLTADKSSSTAYMQLSSLTFE DSAVYFCARLRNWEGPMDYWGQGTTVTVSS 120

233 EVQLLESGGGLVQPGGSLRLSCAASGFTFG

VESMSWVRQAPGKGLEWVGAIDGGDGYTGY

1464-A02 VH ADSVKDRFTISRDNSKNTLYLQMNSLRAED

TAVYYCAKAWHPQTYYGVDYWGQGTLVTVS

S 121

234 EVQLLESGGGLVQPGGSLRLSCAASGFTFS

GSSMSWVRQAPGKGLEWVGAIAGGDGYTGY

1464-A08 VH ADSVKGRFTISRDNSKNTLYLQMNSLRAED

TAVYYCAKGWHRQDYYGQDYWGQGTLVTVS

S 121

235 EVQLLESGGGLVQPGGSLRLSCAASGFTFS

GSSMSWVRQAPGKGLEWVGAIDGGEGYTSY

1464-B04 VH ADSVKGRFTISRDNSKNTLYLQMNSLRAED

TAVYYCAKGWHPQTLYDLDYWGQGTLVTVS

S 121

236 EVQLLESGGGLVQPGGSLRLSCAASGFTFS

GSSMSWVRQAPGKGLEWVGAIDGGEGSTAY

1557-A04 VH ADSVKGRFTISRDNSKNTLYLQMNSLRAED

TAVYYCAKGWHPQTMYDLDYWGQGTLVTVS

S 121

237 EVQLLESGGGLVQPGGSLRLSCAASGFTFG

GSSMSWVRQAPGKGLEWVGAIGGGEGSTGY

1557-A05 VH ADSVKGRFTISRDNSKNTLYLQMNSLRAED

TAVYYCAKGWHDQSLYDRDYWGQGTLVTVS

S 121

238 EVQLLESGGGLVQPGGSLRLSCAASGFTFR

1557-B03 VH SSSMSWVRQAPGKGLEWVGAIGGHEGYTGY

ADSVKGRFTISRDNSKNTLYLQMNSLRAED 121 TAVYYCAKGWNPQTLYHLDYWGQGTLVTVS SEQ ID Molecule Region Scheme Sequence Length NO:

s

239 EVQLLESGGGLVQPGGSLRLSCAASGFTFS

GCSMSWVRQAPGKGLEWVGAIAGGEGNTGY

1557-B10 VH ADSVKGRFTISRDNSKNTLYLQMNSLRAED

TAVYYCAKGWHPQTLYDLDYWGQGTLVTVS

S 121

240 EVQLLESGGGLVQPGGSLRLSCAASGFTFR

GASMSWVRQAPGKGLEWVGAIDGSQGSTGY

1557-C06 VH ADSVKGRFTISRDNSKNTLYLQMNSLRAED

TAVYYCAKGWHPQTMYDLDYWGQGTLVTVS

S 121

241 EVQLLESGGGLVQPGGSLRLSCAASGFTFS

GSSMSWVRQAPGKGLEWVGAIDGGEGSTGY

1557-E07 VH ADSVKGRFTISRDNSKNTLYLQMNSLRAED

TAVYYCAKGWHPQTLYDLDYWGQGTLVTVS

S 121

242 EVQLLESGGGLVQPGGSLRLSCAASGFTFR

ASSMSWMRQAPGKGLEWVGAIDGGVGSTGY

1557-E08 VH ADSVKGRFTISRDNSKNTLYLQMNSLRAED

TAVYYCAKGWHPQTLYDLDYWGQGTLVTVS

S 121

243 EVQLLESGGGLVQPGGSLRLSCAASGFTFR

GSSMSWVRQAPGKGLEWVGAIDGGEGSTGY

1557-E11 VH ADSVKGRFTINRDNSKNTLYLQMNSLRAED

TAVYYCAKGWHPQSLYDLDYWGQGTLVTVS

S 121

244 EVQLLESGGGLVQPGGSLRLSCAASGFTFS

GSSMSWVRQAPGKGLEWVGAIDGGEGSTGY

1557-F01 VH ADSVKGRFTISRDNSKNTLYLQMNSLRAED

TAVYYCAKGWHPQTLYDLDYWGQGTLVTVS

S 121

245 EVQLLESGGGLVQPGGSLRLSCAASGFTFR

GSSMSWVRQAPGKGLEWVGAIDGGEGSTGY

1557-F02 VH ADSVKGRFTISRDNSKNTLYLQMNSLRAED

TAVYYCAKGWHPQTMYNLDYWGQGTLVTVS

S 121

246 EVQLLESGGGLVQPGGSLRLSCAASGFTFS

GSSMSWVRQAPGKGLEWVGAIAGGGGSTGY

1557-F03 VH ADSVKGRFTISRDNSKNTLYLQMNSLRAED

TAVYYCAKGWHPQTLYDLDYWGQGTLVTVS

S 121

247 EVQLLESGGGLVQPGGSLRLSCAASGFTFR

GSSMSWVRQAPGKGLEWVGAIDGGEGSTGY

1557-F05 VH ADSVKGRFTISRDNSKNTLYLQMNSLRAED

TAVYYCAKDWHPQTLYDLDYWGQGTLVTVS

S 121 SEQ ID Molecule Region Scheme Sequence Length NO:

248 EVQLLESGGGLVQPGGSLRLSCAASGFTFS

VTSMSWMRQAPGKGLEWVGAIAGGEGSTGY

1557-G01 VH ADSVKGRFTISRDNSKNTLYLQMNSLRAED

TAVYYCAKGWHPQTLYDLDYWGQGTLVTVS

S 121

249 EVQLLESGGGLVQPGGSLRLSCAASGFTFG

GSSMSWVRQAPGKGLEWVGAIGGGEGYTGY

1557-G03 VH ADSVKGRFTISRDNSKNTLYLQMNSLRAED

TAVYYCAKGWHPQTLYDLDYWGQGTLVTVS

S 121

250 EVQLLESGGGLVQPGGSLRLSCAASGFTFC

GSSMSWVRQAPGKGLEWVGAIDGGVGSTGY

1557-G04 VH ADSVKGRFTISRDNSKNTLYLQMNSLRAED

TAVYYCAKGWHPQTLYDLDYWGQGTLVTVS

S 121

251 EVQLLESGGGLVQPGGSLRLSCAASGFTFS

GFSMSWVRQAPGKGLEWVGAIDGGEGSTGY

1557-G06 VH ADSVKGRFTISRDNSKNTLYLQMNSLRAED

TAVYYCAKGWHPQTLYHLDYWGQGTLVTVS

S 121

252 EVQLLESGGGLVQPGGSLRLSCAASGFTFS

VTSMSWMRQAPGKGLEWVGAIAGGEGSTGY

1557-H04 VH ADSVKGRFTISRDNSKNTLYLQMNSLRAED

TAVYYCAKGWHPQTLYDLDYWGQGTLVTVS

S 121

253 EVQLLESGGGLVQPGGSLRLSCAASGFTFS

GSSMSWVRQAPGKGLEWVGAIDGGEGSTGY

1557-H10 VH ADSVKGRFTISRDNSKNTLYLQMNSLRAED

TAVYYCAKGWHPQSMYDLDYWGQGTLVTVS

S 121

254 EIVLTQSPGTLSLSPGERATLSCRASQSVS

SSYLAWYQQKPGQAPRLLIYGASSRATGIP

1304-G11 VL

DRFSGSSSGTDFTLTISRLEPEDFAVYYCQ QYWYGPPTFGQGTKVEIK 108

255 ELVMTQSPSSLTVTAGEKVTMSCKSSQSLL

NSGNQKNYLTWYQQKPGQPPKLLIYWASTR

1332-A05 VL

ESGVPDRFTGSGSGTDFTLTISSVQAEDLA VYYCQNDLSYPLTFGAGTKLEIK 113

256 ELVMTQSPSSLTVTAGEKVTMSCKSSQSLL

NSGNQKNYLTWYQQKPGQPPKLLIYWASTR

1332-COl VL

ESGVPDRFTGSGSGTDFTLTISSVQAEDLA VYYCQNDYRYPLTFGAGTKLEIK 113

257 ELVMTQSPSSLTVTAGEKVTMSCKSSQSLL

NSGNQKNYLTWYQQKPGQPPKLLIYRASTR

1332-F11 VL

ESGVPDRFTGSGSGTDFTLTISSVQAEDLA VYYCQNDSSYPLTFGAGTKLEIK 113 SEQ ID Molecule Region Scheme Sequence Length NO:

258 EIVLTQSPGTLSLSPGERATLSCRASQSVS

SSYLAWYQQKPGQAPRLLIYGASSRATGIP

1464-A02 VL

DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ QTSEAPPTFGQGTKVEIK 108

259 EIVLTQSPGTLSLSPGERATLGCRASQSVS

SSYLAWYQQKPGQAPRLLIYGASSRATGIP

1464-A08 VL

DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ QNQAAPATFGQGTKVEIK 108

260 EIVLTQSPGTLSLSPGERATLSCRASQSVS

SSYLAWYQQKPGQAPRLLIYGASSRATGIP

1464-B04 VL

DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ QLVTSPPTFGQGTKVEIK 108

261 EIVLTQSPGTLSLSPGERATLSCRASQNVS

TNYLAWYQQKPGQAPRLLIYGASSRATGIP

1557-A04 VL

DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ QLVTNPPTFGQGTKVEIK 108

262 EIVLTQSPGTLSLSPGERATLSCSASQTVS

SSYIAWYQQKPGQAPRLLIYGASSRATGIP

1557-A05 VL

DRFGGSGSGTDFTLTISRLEPEDFAVYYCQ QLLTSPPTFGQGTKVEIK 108

263 EIVLTQSPGTLSLSPGERATLSCRASQKCS

SSSMAWYQQKPGQAPRLLIYGASSRATGIP

1557-B03 VL

DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ QLQTSPPTFGQGTKVEIK 108

264 EIVLTQSPGTLSLSPGERATLSCRASQGLA

SRYMAWYQQKPGQAPRLLIYGASSRATGIP

1557-B10 VL

DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ QVMTIPPTFGQGTKVEIK 108

265 EIVLTQSPGTLSLSPGERATLSCRASQRGT

SSYLAWYQQKPGQAPRLLIYGASSRATGIP

1557-C06 VL

DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ QHVTSPPTFGQGTKVEIK 108

266 EIVLTQSPGTLSLSPGERATMSCRASQVLS

SSSLAWYQQKPGQAPRLLIYGASSRATGIP

1557-E07 VL

DRFSGSGSGTDFALTISRLEPEDFAVYYCQ QRAAPPPTFGQGTKVEIK 108

267 EIVLTQSPGTLSLSPGERATLSCRASQGDS

SSVLAWYQQKPGQAPRLLIYGASSRATGIP

1557-E08 VL

DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ QLVPSPPTFGQGTKVEIK 108

268 EIVLTQSPGTLSLSPGERATLSCRASQPVP

NTTLAWYQQKPGQAPRLLIYGASSRATGIP

1557-E11 VL

DRFSGSGSGTDFTLTISRLEPEDFAAYYCQ QLVPSPPTFGQGTKVEIK 108

269 EIVLTQSPGTLSLSPGERATLSCRASQSVS

1557-F01 VL SSKLAWYQQKPGQAPRLLIYGASSRATGIP 108

DRFSGYGSGTDFTLTISRLEPEDFAVYYCQ SEQ ID Molecule Region Scheme Sequence Length NO:

QLETIPPTFGQGTKVEIK

270 EIVLTQSPGTLSLSPGERATLSCRASQSVS

SSYLAWYQQKPGQAPRLLIYGASSRATGIP

1557-F02 VL

DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ QLFNSPPTFGQGTKVEIK 108

271 EIVLTQSPGTLSLSPGERATLSCRASQSVK

TSDLAWYQQKPGQAPRLLIYGASSRATGIP

1557-F03 VL

DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ QLVSKPPTFGQGTKVEIK 108

272 EIVLTQSPGTLSLSPGERATLSCRASQTVS

PSVLAWYQQKPGQAPRLLIYGASSRATGIP

1557-F05 VL

GRFSGSGSGTDFTLTISRLEPEDFAVYYCQ QLVTNPPTFGQGTKVEIK 108

273 EIVLTQSPGTLSLSPGERATMSCRASQVLS

SSSLAWYQQKPGQAPRLLIYGASSRATGIP

1557-G01 VL

DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ QLVTSPPTFGQGTKVEIK 108

274 EIVLTQSPGTLSLSPGERATLSCRASQSVH

SSYLAWYQQKPGQAPRLLIYGASSRATGIP

1557-G03 VL

DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ QLLSSPPTFGQGTKVEIK 108

275 EIVLTQSPGTLSLSPGERATLSCRASQSVS

SSYLAWYQQKPGQAPRLLIYGASSRATGIP

1557-G04 VL

DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ QDSFVPPTFGQGTKVEIK 108

276 EIVLTQSPGTLSLSPGERATLSCRASQSIP

SSYLAWYQQEPGQAPRLLIYGASSRATGIP

1557-G06 VL

DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ QLATSPPTFGQGTKVEIK 108

277 EIVLTQGPSTLSLSPGERATLSCRASQSVS

TGYLAWYQQKPGQAPRLLIYGASSRATGIP

1557-H04 VL

DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ QLVTRPPTFGQGTKVEIK 108

278 EIVLTQSPGTLSLSPGERATMSCRASQVLS

SSSLAWYQQKPGQAPRLLIYGASSRATGIP

1557-H 10 VL

DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ QLVTAPPTFGQGTKVEIK 108

279 ASTKGPSVFPLAPSSKSTSGGTAALGCLVK

DYFPEPVTVSW SGALTSGVHTFPAVLQSS GLYSLSSWTVPSSSLGTQTYICNV HKPS

IgGl NTKVDKKVEPKSCDKTHTCPPCPAPELLGG Constant PSVFLFPPKPKDTLMISRTPEVTCVWDVS

HEDPEVKFNWYVDGVEVHNAKTKPREEQYN

Region

STYRWSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSREE MTKNQVSLTCLVKGFYPSDIAVEWESNGQP 330 ENNYKTTPPVLDSDGSFFLYSKLTVDKSRW SEQ ID Molecule Region Scheme Sequence Length NO:

QQGNVFSCSVMHEALHNHYTQKSLSLSPGK

280 AAGSDQEPKSSDKTHTCPPCSAPELLGGSS

VFLFPPKPKDTLMISRTPEVTCVWDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNST YRWSVLTVLHQDWLNGKEYKCKVSNKALP

IgGl Fc from

APIEKTISKAKGQPREPQVYTLPPSRDELT

scFv-Fc KNQVSLTCLVKGFYPSDIAVEWESNGQPEN

NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPGKGS GDYKDDDDKGSG 252

281 Lambda GQPKAAPSVTLFPPSSEELQANKATLVCLI

SDFYPGAVTVAWKADSSPVKAGVETTTPSK

Constant

QSNNKYAASSYLSLTPEQWKSHRSYSCQVT

Region HEGSTVEKTVAPTECS 106

282 Kappa RTVAAPSVFIFPPSDEQLKSGTASWCLLN

NFYPREAKVQWKVDNALQSGNSQESVTEQD

Constant

SKDSTYSLSSTLTLSKADYEKHKVYACEVT

Region HQGLSSPVTKSFNRGEC 107

283 Linker GGGGSGGGGSGGGGS 15

284 Linker AAGSDQ 6

285 His Tag with

Linker GSGDYKDDDDKGSGHHHHHH 20

286 mAb_3-l CDR-H 1 Chothia GYAFTNY 7

287 mAb_3-5 CDR-H 1 Chothia GYTFTSY 7

288 mAb_4-l CDR-H 1 Chothia GYAFTNY 7

289 mAb_4-7 CDR-H 1 Chothia GYTFTNY 7

290 mAb_5-10 CDR-H 1 Chothia GYAFTNY 7

291 mAb_3-l CDR-H 1 Kabat NYWLG 5

292 mAb_3-5 CDR-H 1 Kabat SYGLS 5

293 mAb_4-l CDR-H 1 Kabat NYWLG 5

294 mAb_4-7 CDR-H 1 Kabat NYGLS 5

295 mAb_5-10 CDR-H 1 Kabat NYWLG 5

296 mAb_3-l CDR-H2 Chothia FPGSGN 6

297 mAb_3-5 CDR-H2 Chothia YPRIGN 6 SEQ ID Molecule Region Scheme Sequence Length NO:

298 mAb_4-l CDR-H2 Chothia FPGSGN 6

299 mAb_4-7 CDR-H2 Chothia YPRIGN 6

300 mAb_5-10 CDR-H2 Chothia FPGSGN 6

301 mAb_3-l CDR-H2 Kabat DLFPGSGNTHYNERFRG 17

302 mAb_3-5 CDR-H2 Kabat EVYPRIGNAYYNEKFKG 17

303 mAb_4-l CDR-H2 Kabat DIFPGSGNAHYNEKFKG 17

304 mAb_4-7 CDR-H2 Kabat EVYPRIGNAYYNEKFKG 17

305 mAb_5-10 CDR-H2 Kabat DIFPGSGNIHYNEKFKG 17

306 mAb_3-l CDR-H3 LRNWDEAMDY 10

307 mAb_3-5 CDR-H3 RGSYGSNYDWYFDV 14

308 mAb_4-l CDR-H3 LRNWDEAMDY 10

309 mAb_4-7 CDR-H3 RGSYDTNYDWYFDV 14

310 mAb_5-10 CDR-H3 LRNWDEPMDY 10

311 mAb_3-l CDR-L1 RASKSI SKYLA 1 1

312 mAb_3-5 CDR-L1 RSSQSLVHSNGNTYLH 16

313 mAb_4-l CDR-L1 KSSQSLLNSGNQKNYLA 17

314 mAb_4-7 CDR-L1 RSSQSLVHSNGNTYLH 16

315 mAb_5-10 CDR-L1 KSSQSLLNSGNQKNYLT 17

316 mAb_3-l CDR-L2 SGSTLQS 7

317 mAb_3-5 CDR-L2 KVSNRFS 7

318 mAb_4-l CDR-L2 GASTRES 7

319 mAb_4-7 CDR-L2 KVSNRFS 7

320 mAb_5-10 CDR-L2 WASTRES 7

321 mAb_3-l CDR-L3 QQHNEYPYT 9

322 mAb_3-5 CDR-L3 SQSTHVPYT 9 SEQ ID Molecule Region Scheme Sequence Length NO:

323 mAb_4-l CDR-L3 QNDYSYPYT 9

324 mAb_4-7 CDR-L3 SQSTHVPYT 9

325 mAb_5-10 CDR-L3 QNDYSYPLT 9

326 EVQLLEQSGAELVKPGASVKISCKASGYAF

TNYWLGWVKQRPGHGLEWIGDLFPGSGNTH

mAb_3-l VH

YNERFRGKATLTADKSSSTAFMQLSSLTSE DSAVYFCARLRNWDEAMDYWGQGTTVTVSS

327 EVQLLEQSGAELVRPGTSVKLSCKASGYTF

TSYGLSWVKQRTGQGLEWIGEVYPRIGNAY

mAb_3-5 VH YNEKFKGKATLTADKSSSTASMELRSLTSE

DSAVYFCARRGSYGSNYDWYFDVWGQGTTV TVSS

328 EVQLLEQSGAELVRPGTSVKISCKASGYAF

T YWLGWVKQRPGHGLEWVGDIFPGSGNAH

mAb_4-l VH

YNEKFKGKATLTADKSSYTAYMQLSSLTSE DSAVYFCARLRNWDEAMDYWGQGTTVTVSS

329 EVQLLEQSGAELARPGASVKLSCKASGYTF

TNYGLSWVKQRPGQVLEWIGEVYPRIGNAY

mAb_4-7 VH YNEKFKGKATLTADKSSSTASMELRSLTSE

DSAVYFCARRGSYDTNYDWYFDVWGQGTTV TVSS

330 EVQLLEQSGAELVRPGTSVKISCKASGYAF

TNYWLGWVKQRPGHGLEWIGDIFPGSGNIH

mAb_5-10 VH

YNEKFKGKATLTADKSSSTAYMQLSSLTFE DSAVYFCARLRNWDEPMDYWGQGTTVTVSS

331 ELVMTQSPSYLAASPGETITINCRASKSIS

KYLAWYQEKPGKTNKLLIYSGSTLQSGIPS

mAb_3-l VL

RFSGSGSGTDFTLTISSLEPEDFAMYYCQQ HNEYPYTFGGGTKLEIK

332 ELVMTQTPLSLPVSLGDQASISCRSSQSLV

HSNGNTYLHWYLQKPGQSPKLLIYKVSNRF

mAb_3-5 VL

SGVPDRFSGSGSGTDFTLKISRVEAEDLGV YFCSQSTHVPYTFGGGTKLEIK

333 ELVMTQSPSSLSVSAGEKVTMSCKSSQSLL

NSGNQKNYLAWYQQKPGQPPKLLIYGASTR

mAb_4-l VL

ESGVPDRFTGSGSGTDFTLTISSVQAEDLA VYYCQNDYSYPYTFGGGTKLEIK

334 ELVMTQTPLSLPVSLGDQASISCRSSQSLV

HSNGNTYLHWYLQKPGQSPKLLIYKVSNRF

mAb_4-7 VL

SGVPDRFSGSGSGTDFTLKISRVEAEDLGV YFCSQSTHVPYTFGGGTKLEIK

335 ELVMTQSPSSLTVTAGEKVTMSCKSSQSLL

mAb_5-10 VL NSGNQKNYLTWYQQKPGQPPKLLIYWASTR

ESGVPDRFTGSGSGTDFTLTISSVQAEDLA SEQ ID Molecule Region Scheme Sequence Length NO:

VYYCQNDYSYPLTFGAGTKLEIK

336 ELVMTQSPSSLTVTAGEKVTMSCKSSQSLL

NSGNQKNYLTWYQQKPGQPPKLLIYWAST

RESGVPDRFTGSGSGTDFTLTISSVQAEDL

AVYYCQNDYSYPLTFGAGTKLEIKGGGGSG

mAB_5-10 scFv GGGSGGGGSEVQLLEQSGAELVRPGTSVKI

SCKASGYAFTNYWLGWVKQRPGHGLEWIGD

IFPGSGNIHYNEKFKGKATLTADKSSSTAY

MQLSSLTFEDSAVYFCARLRNWDEPMDYWG

QGTTVTVSS

337 MEVQLLESGGGLVRPGGSLRLSCAASGFTF

SGSSMSWVRQAPGKGLEWVGAIDGGDGYTN YADSVRGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQTYYGLDYWGQGTLVTV

1304-G11 scFv SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL

SPGERATLSCRASQSVSSSYLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSSSGTDFT LTISRLEPEDFAVYYCQQYWYGPPTFGQGT KVEIK 245

338 MELVMTQSPSSLTVTAGEKVTMSCKSSQSL

LNSGNQKNYLTWYQQKPGQPPKLLIYWAST RESGVPDRFTGSGSGTDFTLTISSVQAEDL AVYYCQNDLSYPLTFGAGTKLEIKGGGGSG

1332-A05 scFv GGGSGGGGSEVQLLEQSGAELVRPGTSVKI

SCKASDYAFANRWLGWVKQRPGHGLEWIGD IFPGSGNIHYNEKFKGKATLTADKSSSTAY MQLSSLTFEDSAVYFCARLRNWEGPMDYWG QGTTVTVSS 249

339 MELVMTQSPSSLTVTAGEKVTMSCKSSQSL

LNSGNQKNYLTWYQQKPGQPPKLLIYWAST RESGVPDRFTGSGSGTDFTLTISSVQAEDL AVYYCQNDYRYPLTFGAGTKLEIKGGGGSG

1332-COl scFv GGGSGGGGSEVQLLEQSGAELVRPGTSVKI

SCKASGYAFTNSWLGWVKQRPGHGLEWIGD IFPGSGNIHYNEKFKGKATLTADKSSSTAY MQLSSLTFEDSAVYFCARLRNWDMPMDYWG QGTTVTVSS 249

340 MELVMTQSPSSLTVTAGEKVTMSCKSSQSL

LNSGNQKNYLTWYQQKPGQPPKLLIYRAST RESGVPDRFTGSGSGTDFTLTISSVQAEDL AVYYCQNDSSYPLTFGAGTKLEIKGGGGSG

1332-F11 scFv GGGSGGGGSEVQLLEQSGAELVRPGTSVKI

SCKASGYAFANRWLGWVKQRPGHGLEWIGD IFPGSGNIHYNEKFKGKATLTADKSSSTAY MQLSSLTFEDSAVYFCARLRNWEGPMDYWG QGTTVTVSS 249

341 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

GVESMSWVRQAPGKGLEWVGAIDGGDGYTG

1464-A02 scFv YADSVKDRFTISRDNSKNTLYLQMNSLRAE

DTAVYYCAKAWHPQTYYGVDYWGQGTLVTV 245 SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL SEQ ID Molecule Region Scheme Sequence Length NO:

SPGERATLSCRASQSVSSSYLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQTSEAPPTFGQGT KVEIK

342 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

SGSSMSWVRQAPGKGLEWVGAIAGGDGYTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHRQDYYGQDYWGQGTLVTV

1464-A08 scFv SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL

SPGERATLGCRASQSVSSSYLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQNQAAPATFGQGT KVEIK 245

343 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

SGSSMSWVRQAPGKGLEWVGAIDGGEGYTS YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV

1464-B04 scFv SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL

SPGERATLSCRASQSVSSSYLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQLVTSPPTFGQGT KVEIK 245

344 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

SGSSMSWVRQAPGKGLEWVGAIDGGEGSTA YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQTMYDLDYWGQGTLVTV

1557-A04 scFv SSGGGGSGGGGSGGGGNEIVLTQSPGTLSL

SPGERATLSCRASQNVSTNYLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQLVTNPPTFGQGT KVEIK 245

345 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

GGSSMSWVRQAPGKGLEWVGAIGGGEGSTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHDQSLYDRDYWGQGTLVTV

1557-A05 scFv SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL

SPGERATLSCSASQTVSSSYIAWYQQKPGQ APRLLIYGASSRATGIPDRFGGSGSGTDFT LTISRLEPEDFAVYYCQQLLTSPPTFGQGT KVEIK 245

346 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

RSSSMSWVRQAPGKGLEWVGAIGGHEGYTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWNPQTLYHLDYWGQGTLVTV

1557-B03 scFv SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL

SPGERATLSCRASQKCSSSSMAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQLQTSPPTFGQGT KVEIK 245

347 1557-B10 scFv MEVQLLESGGGLVQPGGSLRLSCAASGFTF 245

SGCSMSWVRQAPGKGLEWVGAIAGGEGNTG SEQ ID Molecule Region Scheme Sequence Length NO:

YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL SPGERATLSCRASQGLASRYMAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQVMTIPPTFGQGT KVEIK

348 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

RGASMSWVRQAPGKGLEWVGAIDGSQGSTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQTMYDLDYWGQGTLVTV

1557-C06 scFv SSGGCGSGGGGSGGGGSEIVLTQSPGTLSL

SPGERATLSCRASQRGTSSYLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQHVTSPPTFGQGT KVEIK 245

349 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

SGSSMSWVRQAPGKGLEWVGAIDGGEGSTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV

1557-E07 scFv SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL

SPGERATMSCRASQVLSSSSLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFA LTISRLEPEDFAVYYCQQRAAPPPTFGQGT KVEIK 245

350 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

RASSMSWMRQAPGKGLEWVGAIDGGVGSTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV

1557-E08 scFv SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL

SPGERATLSCRASQGDSSSVLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQLVPSPPTFGQGT KVEIK 245

351 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

RGSSMSWVRQAPGKGLEWVGAIDGGEGSTG YADSVKGRFTINRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQSLYDLDYWGQGTLVTV

1557-E11 scFv SSGGGGSGGGDSGGGGSEIVLTQSPGTLSL

SPGERATLSCRASQPVPNTTLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAAYYCQQLVPSPPTFGQGT KVEIK 245

352 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

SGSSMSWVRQAPGKGLEWVGAIDGGEGSTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE

1557-F01 scFv DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV

SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL SPGERATLSCRASQSVSSSKLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGYGSGTDFT 245 LTISRLEPEDFAVYYCQQLETIPPTFGQGT SEQ ID Molecule Region Scheme Sequence Length NO:

KVEIK

353 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

RGSSMSWVRQAPGKGLEWVGAIDGGEGSTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQTMYNLDYWGQGTLVTV

1557-F02 scFv SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL

SPGERATLSCRASQSVSSSYLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQLFNSPPTFGQGT KVEIK 245

354 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

SGSSMSWVRQAPGKGLEWVGAIAGGGGSTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV

1557-F03 scFv SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL

SPGERATLSCRASQSVKTSDLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQLVSKPPTFGQGT KVEIK 245

355 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

RGSSMSWVRQAPGKGLEWVGAIDGGEGSTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKDWHPQTLYDLDYWGQGTLVTV

1557-F05 scFv SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL

SPGERATLSCRASQTVSPSVLAWYQQKPGQ APRLLIYGASSRATGIPGRFSGSGSGTDFT LTISRLEPEDFAVYYCQQLVTNPPTFGQGT KVEIK 245

356 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

SVTSMSWMRQAPGKGLEWVGAIAGGEGSTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV

1557-G01 scFv SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL

SPGERATMSCRASQVLSSSSLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQLVTSPPTFGQGT KVEIK 245

357 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

GGSSMSWVRQAPGKGLEWVGAIGGGEGYTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV

1557-G03 scFv SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL

SPGERATLSCRASQSVHSSYLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQLLSSPPTFGQGT KVEIK 245

358 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

CGSSMSWVRQAPGKGLEWVGAIDGGVGSTG

1557-G04 scFv YADSVKGRFTISRDNSKNTLYLQMNSLRAE

DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV 245 SSGGGDSGGGGSGGGGSEIVLTQSPGTLSL SEQ ID Molecule Region Scheme Sequence Length NO:

SPGERATLSCRASQSVSSSYLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQDSFVPPTFGQGT KVEIK

359 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

SGFSMSWVRQAPGKGLEWVGAIDGGEGSTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQTLYHLDYWGQGTLVTV

1557-G06 scFv SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL

SPGERATLSCRASQSIPSSYLAWYQQEPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQLATSPPTFGQGT KVEIK 245

360 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

SVTSMSWMRQAPGKGLEWVGAIAGGEGSTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV

1557-H04 scFv SSGGGGSDGGGSGGGGSEIVLTQGPSTLSL

SPGERATLSCRASQSVSTGYLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQLVTRPPTFGQGT KVEIK 245

361 MEVQLLESGGGLVQPGGSLRLSCAASGFTF

SGSSMSWVRQAPGKGLEWVGAIDGGEGSTG YADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYCAKGWHPQSMYDLDYWGQGTLVTV

1557-H 10 scFv SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL

SPGERATMSCRASQVLSSSSLAWYQQKPGQ APRLLIYGASSRATGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQLVTAPPTFGQGT KVEIK 245

362 MELVMTQSPSSLTVTAGEKVTMSCKSSQSL

LNSGNQKNYLTWYQQKPGQPPKLLIYWAST RESGVPDRFTGSGSGTDFTLTISSVQAEDL AVYYCQNDYSYPLTFGAGTKLEIKGGGGSG GGGSGGGGSEVQLLEQSGAELVRPGTSVKI SCKASGYAFTNYWLGWVKQRPGHGLEWIGD IFPGSGNIHYNEKFKGKATLTADKSSSTAY MQLSSLTFEDSAVYFCARLRNWDEPMDYWG

mAB_5-10 scFv-Fc QGTTVTVSSAAGSDQEPKSSDKTHTCPPCS

APELLGGSSVFLFPPKPKDTLMISRTPEVT CVWDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRWSVLTVLHQDWLNGKEYK CKVSNKALPAPI EKTISKAKGQPREPQVYT LPPSRDELTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGKGGSHHHHHH Equivalents

[00389] The disclosure set forth above may encompass multiple distinct inventions with independent utility. Although each of these inventions has been disclosed in its preferred form(s), the specific embodiments thereof as disclosed and illustrated herein are not to be considered in a limiting sense, because numerous variations are possible. The subject matter of the inventions includes all novel and nonobvious combinations and subcombinations of the various elements, features, functions, and/or properties disclosed herein. The following claims particularly point out certain combinations and subcombinations regarded as novel and nonobvious. Inventions embodied in other combinations and subcombinations of features, functions, elements, and/or properties may be claimed in this application, in applications claiming priority from this application, or in related applications. Such claims, whether directed to a different invention or to the same invention, and whether broader, narrower, equal, or different in scope in comparison to the original claims, also are regarded as included within the subject matter of the inventions of the present disclosure.




 
Previous Patent: COMPOUNDS, COMPOSITIONS AND METHODS FOR PREVENTION OR TREATMENT OF LIVER AND LIPID-RELATED CONDITION...

Next Patent: UNIQUE REFLECTIVE LENSES TO AUTO-CALIBRATE EYE TRACKING SYSTEM