WENDISCH VOLKER (DE)
HENKE NADJA ALINA (DE)
WO2007141111A2 | 2007-12-13 |
US20090221027A1 | 2009-09-03 | |||
US20090221027A1 | 2009-09-03 |
BELVIRANLI; OKUDAN: "Antioxidants in Sport Nutrition", 2015, TAYLOR & FRANCIS GROUP, LLC
LI, ZHU ET AL., BIOTECHNOL. ADV., vol. 29, no. 6, 2011, pages 568 - 574
CUTZU, COI ET AL., WORLD J MICROBIOL BIOTECHNOL, vol. 77, no. 3, 2013, pages 505 - 512
RODRIGUEZ-SAIZ, DE LA FUENTE ET AL., APPL MICROBIOL BIOTECHNOL, vol. 88, no. 3, 2010, pages 645 - 658
GASSEL, SCHEWE ET AL., BIOTECHNOLOGY LETTERS, vol. 35, no. 4, 2013, pages 565 - 569
ZELCBUCH, ANTONOVSKY ET AL., NUCLEIC ACIDS RES, vol. 41, no. 9, 2013, pages e98
RODRIGUEZ-CONCEPCION; BORONAT, PLANT PHYSIOL., vol. 130, no. 3, 2002, pages 1079 - 1089
KIRBY; KEASLING, ANNU REF PLANT BIOL., vol. 60, 2009, pages 335 - 355
HUNTER, J BIOL CHEM, vol. 282, no. 30, 2007, pages 21573 - 21577
KINOSHITA, UDAKA ET AL., J GEN APPLMICROBIOL, vol. 3, 1957, pages 193 - 205
HEIDER ET AL., FRONTIERS IN BIOENGINEERING AND BIOTECHNOLOGY, vol. 2, 2014
THOMPSON ET AL., NUCLEIC ACIDS RES., vol. 22, 1994, pages 4673 - 4680
HOLM, J. MOL. BIOL., vol. 233, 1993, pages 123 - 38
HOLM, TRENDS BIOCHEM. SCI., vol. 20, 1995, pages 478 - 480
HOLM, NUCLEIC ACID RES., vol. 26, 1998, pages 316 - 9
ABBES, M.; BAATI, H.; GUERMAZI, S.; MESSINA, C.; SANTULLI, A.; GHARSALLAH, N.; AMMAR, E.: "Biological properties of carotenoids extracted from Halobacterium halobium isolated from a Tunisian solar saltern.", BMC COMPLEMENTARY AND ALTERNATIVE MEDICINE, vol. 13, 2013, pages 255, XP021163976, DOI: doi:10.1186/1472-6882-13-255
AGRANOFF: "Isopentenol pyrophsophate isomerase", JOURNAL OF THE AMERICAN CHEMICAL SOCIETY, vol. 81, no. 5, 1959, pages 1254 - 1255
"Analysts' Meeting for FY2015 Consolidated Results", 2015, AJINOMOTO CO.
"Food Products Business", 2016, AJINOMOTO CO.
"Life Support Business", 2016, AJINOMOTO CO.
ARMSTRONG, G. A.: "Eubacteria show their true colors: Genetics of carotenoid pigment biosynthesis from microbes to plants", JOURNAL OF BACTERIOLOGY, vol. 176, no. 16, 1994, pages 4795 - 4802, XP002977725
ASAI, T.; AIDA, K.; OISHI, K.: "On L-Glutamic Acid Fermentation", BULLETIN OF THE AGRICULTURAL CHEMICAL SOCIETY OF JAPAN, vol. 21, no. 2, 1957, pages 134 - 135
BAUMGART, M.; UNTHAN, S.; RUCKERT, C.; SIVALINGAM, J.; GRUNBERGER, A.; KALINOWSKI, J.; BOTT, M.; NOACK, S.; FRUNZKE, J.: "Construction of a Prophage-Free Variant of Corynebacterium glutamicum ATCC 13032 for Use as a Platform Strain for Basic Research and Industrial Biotechnology", APPLIED AND ENVIRONMENTAL MICROBIOLOGY, vol. 79, no. 19, 2013, pages 6006 - 6015
"The Global Market for Carotenoids - FOD025E", 2015, BBC RESEARCH
BHOSALE, P.; BERNSTEIN, P. S.: "Microbial xanthophylls", APPLIED MICROBIOLOGY AND BIOTECHNOLOGY, 2005, pages 445 - 455, XP019331947, DOI: doi:10.1007/s00253-005-0032-8
BISWAL, S.: "Oxidative stress and astaxanthin: The novel supernutrient carotenoid", INTERNATIONAL JOURNAL OF HEALTH & ALLIED SCIENCES, vol. 3, no. 3, 2014, pages 147
BJERKENG, B.: "Carotenoid pigmentation of salmonid fishes - recent progress", AVANCES EN NUTRICIDN ACUFCOLA V. MEMORIAS DEL V SIMPOSIUM INTERNACIONAL DE NUTRICIDN ACUICOLA, vol. 19-22, 2000, pages 71 - 89
BLOMBACH, B.; EIKMANNS, B. J.: "Current knowledge on isobutanol production with Escherichia coli, Bacillus subtilis and Corynebacterium glutamicum", BIOENGINEERED BUGS, vol. 2, no. 6, 2011, pages 346 - 350, XP002685598, DOI: doi:10.4161/BBUG.2.6.17845
BLOMBACH, B.; SEIBOLD, G. M.: "Carbohydrate metabolism in Corynebacterium glutamicum and applications for the metabolic engineering of I-lysine production strains", APPLIED MICROBIOLOGY AND BIOTECHNOLOGY, vol. 86, no. 5, 2010, pages 1313 - 1322, XP019800020
BORMANN-EI; KHOLY, E. R.; EIKMANNS, B. J.; GUTMANN, M.; SAHM, H.: "Glutamate dehydrogenase is not essential for glutamate formation by Corynebacterium glutamicum", APPLIED AND ENVIRONMENTAL MICROBIOLOGY, vol. 59, no. 7, 1993, pages 2329 - 2331
BREITMAIER, E.; JUNG, G.: "Organische Chemie: Grundlagen, Verbindungsklassen, Reaktionen, Konzepte, Molekulstruktur, Naturstoffe, Syntheseplanung, Nachhaltigkeit", 2012, THIEME, article "Terpene"
BRITTON, G.; LIAAEN-JENSEN, S.; PFANDER, H., CAROTENOIDS: NATURAL FUNCTIONS, BIRKHAUSER BASEL, 2008
BUNCH, P. K.; MAT-JAN, F.; LEE, N.; CLARK, D. P.: "The IdhA gene encoding the fermentative lactate dehydrogenase of Escherichia coli", MICROBIOLOGY, vol. 143, 1997, pages 187 - 195, XP000996645
BURTON, G. W.; INGOLD, K. U.: "Beta-Carotene: An Unusual Type of Lipid Antioxidant", SCIENCE, vol. 224, no. 4649, 1984, pages 569 - 73
BYRNE, J., GLOBAL BIOCHEM TO PUT THE BRAKES ON LYSINE PRODUCTION, 2014, Retrieved from the Internet
CAMPBELL, N. A.; REECE, J. B.: "Biologie", 2009, PEARSON STUDIUM, article "Die Ernahrung der Tiere", pages: 1211 - 1241
CAMPBELL, N. A.; REECE, J. B.: "Biologie", 2009, PEARSON STUDIUM, article "Neurone, Synapsen und Signalgebung", pages: 1410 - 1431
CAMPBELL, N. A.; REECE, J. B.: "Biologie", 2009, PEARSON STUDIUM, article "Photosynthese", pages: 251 - 278
CAMPBELL, N. A.; REECE, J. B.: "Biologie", 2016, PEARSON STUDIUM, article "Proteine: Funktionsvielfalt durch Strukturvielfalt", pages: 94 - 123
CHOI, S. K.; HARADA, H.; MATSUDA, S.; MISAWA, N.: "Characterization of two β-carotene ketolases, CrtO and CrtW, by complementation analysis in Escherichia coli", APPLIED MICROBIOLOGY AND BIOTECHNOLOGY, vol. 75, no. 6, 2007, pages 1335 - 1341, XP019513781, DOI: doi:10.1007/s00253-007-0967-z
CHOI, S. K.; MATSUDA, S.; HOSHINO, T.; PENG, X.; MISAWA, N.: "Characterization of bacterial β-carotene 3,3'-hydroxylases, CrtZ, and P450 in astaxanthin biosynthetic pathway and adonirubin production by gene combination in Escherichia coli", APPLIED MICROBIOLOGY AND BIOTECHNOLOGY, vol. 72, no. 6, 2006, pages 1238 - 1246, XP019441701, DOI: doi:10.1007/s00253-006-0426-2
CREMER, J.; EGGELING, L.; SAHM, H.: "Control of the lysine biosynthesis sequence in Corynebacterium glutamicum as analyzed by overexpression of the individual corresponding genes", APPLIED AND ENVIRONMENTAL MICROBIOLOGY, vol. 57, no. 6, 1991, pages 1746 - 1752, XP000616281
CUNNINGHAM, F. X.; GANTT, E.: "GENES AND ENZYMES OF CAROTENOID BIOSYNTHESIS IN PLANTS", ANNU. REV. PLANT PHYSIOL. PLANT MOL. BIOL, vol. 49, 1998, pages 557 - 83
CUNNINGHAM, F. X.; POGSON, B.; SUN, Z.; MCDONALD, K. A.; DELLAPENNA, D.; GANTT, E.: "Functional Analysis of the B and E Lycopene Cyclase Enzymes of Arabidopsis Reveals a Mechanism for Control of Cyclic Carotenoid Formation", THE PLANT CELL AMERICAN SOCIETY OF PLANT PHYSIOLOGLSTS, vol. 8, September 1996 (1996-09-01), pages 1613 - 1626
EGGELING, L.; SAHM, H.: "L-glutamate and L-lysine: Traditional products with impetuous developments", APPLIED MICROBIOLOGY AND BIOTECHNOLOGY, vol. 52, no. 2, 1999, pages 146 - 153, XP002197906, DOI: doi:10.1007/s002530051501
EIKMANNS, B. J.; METZGER, M.; REINSCHEID, D.; KIRCHER, M.; SAHM, H.: "Amplification of three threonine biosynthesis genes in Corynebacterium glutamicum and its influence on carbon flux in different strains", APPLIED MICROBIOLOGY AND BIOTECHNOLOGY, vol. 34, no. 5, 1991, pages 617 - 622
ENGELS, V.; WENDISCH, V. F.: "The DeoR-type regulator SugR represses expression of ptsG in Corynebacterium glutamicum", JOURNAL OF BACTERIOLOGY, vol. 189, no. 8, 2007, pages 2955 - 2966, XP055214570, DOI: doi:10.1128/JB.01596-06
FISCHER, E.: "Untersuchungen uber Aminosauren, Polypeptide und Proteine", BERICHTE DER DEUTSCHEN CHEMISCHEN GESELLSCHAFT, vol. 39, no. 1, 1906, pages 530 - 610
GASSEL, S.; SCHEWE, H.; SCHMIDT, I.; SCHRADER, J.; SANDMANN, G.: "Multiple improvement of astaxanthin biosynthesis in Xanthophyllomyces dendrorhous by a combination of conventional mutagenesis and metabolic pathway engineering", BIOTECHNOLOGY LETTERS, vol. 35, no. 4, 2013, pages 565 - 569, XP055249657, DOI: doi:10.1007/s10529-012-1103-4
GEORGI, T.; RITTMANN, D.; WENDISCH, V. F.: "Lysine and glutamate production by Corynebacterium glutamicum on glucose, fructose and sucrose: Roles of malic enzyme and fructose-1,6-bisphosphatase", METABOLIC ENGINEERING, vol. 7, no. 4, 2005, pages 291 - 301, XP005052640, DOI: doi:10.1016/j.ymben.2005.05.001
GIACOMETTI, T.: "Free and Bound Glutamate in Natural Products", GLUTAMIC ACID: ADVANCES IN BIOCHEMISTRY AND PHYSIOLOGY, 1979, pages 25 - 34
"Beta Carotene Market Size, Industry Analysis Report, Regional Outlook, Application Development Potential, Price Trend, Competitive Market Share & Forecast, 2016 - 2023", 2015, GLOBAL MARKET INSIGHTS
"Glutamic Acid and Monosodium Glutamate (MSG) Market Size, Potential, Industry Outlook, Regional Analysis, Application Development, Competitive Landscape & Forecast, 2016-2023", 2016, GLOBAL MARKET INSIGHTS
GOLDSTEIN, J. L.; BROWN, M. S.: "Regulation of the mevalonate pathway", NATURE, vol. 343, 1990, pages 425 - 430, XP002920021, DOI: doi:10.1038/343425a0
GOODWIN, T. W.; C. B. E.; F. R. S.: "The Biochemistry of the Carotenoids: Volume I Plants", vol. I, 1980, article "Biosynthesis of Carotenoids", pages: 33 - 76
GOODWIN, T. W.; C. B. E.; F. R. S.: "The Biochemistry of the Carotenoids: Volume I Plants", 1980, SPRINGER, article "Nature and Properties", pages: 1 - 32
GOPINATH, V.; MEISWINKEL, T. M.; WENDISCH, V. F.; NAMPOOTHIRI, K. M.: "Amino acid production from rice straw and wheat bran hydrolysates by recombinant pentose-utilizing Corynebacterium glutamicum", APPLIED MICROBIOLOGY AND BIOTECHNOLOGY, vol. 92, no. 5, 2011, pages 985 - 996
"Global Amino Acids Market by Product (L-Glutamate, Lysine, Methionine, Threonine, Tryptophan, Leucine, Iso-Leucine, Valine, Glutamine, Arginine), By Source, By Application Expected to Reach USD 35.40 Billion By 2022", 2015, GRAND VIEW RESEARCH
GUERIN, M.; HUNTLEY, M. E.; OLAIZOLA, M.: "Haematococcus astaxanthin: Applications for human health and nutrition", TRENDS IN BIOTECHNOLOGY, vol. 21, no. 5, 2003, pages 210 - 216, XP004422156, DOI: doi:10.1016/S0167-7799(03)00078-7
HAN, J. E. S.: "Monosodium Glutamate as a Chemical Condiment", INDUSTRIAL & ENGINEERING CHEMISTRY, vol. 21, no. 10, 1929, pages 984 - 987
HARKER, M.; BRAMLEY, P. M.: "Expression of prokaryotic 1-deoxy-D-xylulose-5-phosphatases in Escherichia coli increases carotenoid and ubiquinone biosynthesis", FEBS LETT., vol. 448, 1999, pages 115 - 119, XP004259477, Retrieved from the Internet
HEIDER, S. A. E.; PETERS-WENDISCH, P.; NETZER, R.; STAFNES, M.; BRAUTASET, T.; WENDISCH, V. F.: "Production and glucosylation of C50 and C40 carotenoids by metabolically engineered Corynebacterium glutamicum", APPLIED MICROBIOLOGY AND BIOTECHNOLOGY, vol. 98, no. 3, 2014, pages 1223 - 1235
HEIDER, S. A E.; WOLF, N.; HOFEMEIER, A.; PETERS-WENDISCH, P.; WENDISCH, V. F.: "Optimization of the IPP Precursor Supply for the Production of Lycopene, Decaprenoxanthin and Astaxanthin by Corynebacterium glutamicum", FRONTIERS IN BIOENGINEERING AND BIOTECHNOLOGY, vol. 2, August 2014 (2014-08-01), pages 28
HENKE, N. A.; HEIDER, S. A. E.; PETERS-WENDISCH, P.; WENDISCH, V. F.: "Production of the marine carotenoid astaxanthin by metabolically engineered Corynebacterium glutamicum", MARINE DRUGS, vol. 14, no. 7, 2016, pages 124, XP055381125, DOI: doi:10.3390/md14070124
HUNTER, W. N.: "The non-mevalonate pathway of isoprenoid precursor biosynthesis", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 282, no. 30, 2007, pages 21573 - 21577
INUI, M.; MURAKAMI, S.; OKINO, S.; KAWAGUCHI, H.; VERTES, A. A.; YUKAWA, H.: "Metabolic analysis of Corynebacterium glutamicum during lactate and succinate productions under oxygen deprivation conditions", JOURNAL OF MOLECULAR MICROBIOLOGY AND BIOTECHNOLOGY, vol. 7, no. 4, 2004, pages 182 - 196
JAGER, W.; SCHAFER, A.; PUHLER, A.; LABES, G.; WOHLLEBEN, W.: "Expression of the Bacillus subtilis sacB gene leads to sucrose sensitivity in the gram-positive bacterium Corynebacterium glutamicum but not in Streptomyces lividans", JOURNAL OF BACTERIOLOGY, vol. 174, no. 16, 1992, pages 5462 - 5465
KAJIWARA, S.; KAKIZONO, T.; SAITO, T.; KONDO, K.; OHTANI, T.; NISHIO, N.; NAGAI, S.; MISAWA, N.: "Isolation and functional identification of a novel cDNA for astaxanthin biosynthesis from Haematococcus pluvialis, and astaxanthin synthesis in Escherichia coli", PLANT MOLECULAR BIOLOGY, vol. 29, no. 2, 1995, pages 343 - 352, XP009050418, DOI: doi:10.1007/BF00043657
KALINOWSKI, J.; BATHE, B.; BARTELS, D.; BISCHOFF, N.; BOTT, M.; BURKOVSKI, A.; DUSCH, N.; EGGELING, L.; EIKMANNS, B. J.; GAIGALAT,: "The complete Corynebacterium glutamicum ATCC 13032 genome sequence and its impact on the production of L-aspartate-derived amino acids and vitamins", JOURNAL OF BIOTECHNOLOGY, 2003, pages 5 - 25, XP002371548, DOI: doi:10.1016/S0168-1656(03)00154-8
KALINOWSKI, J.; CREMER, J.; BACHMANN, B.; EGGELING, L.; SAHM, H.; PUHLER, A.: "Genetic and biochemical analysis of the aspartokinase from Corynebacterium glutamicum", MOL MICROBIOL, vol. 5, no. 5, 1991, pages 1197 - 1204, XP002929074, DOI: doi:10.1111/j.1365-2958.1991.tb01893.x
KIM, S.-W.; KEASLING, J. D.: "Metabolic engineering of the nonmevalonate isopentenyl diphosphate synthesis pathway in Escherichia coli enhances lycopene production", BIOTECHNOL. BIOENG., vol. 72, 2001, pages 408 - 415, XP002908420, Retrieved from the Internet
KINOSHITA, S.; KINOSHITA, S.; UDAKA, S.; SHIMONO, M.: "Studies on the Amino Acid Fermentation", THE JOURNAL OF GENERAL AND APPLIED MICROBIOLOGY, vol. 3, no. 3, 1957, pages 193 - 205, XP001320031
KINOSHITA, S.; NAKAYAMA, K.; AKITA, S.: "Taxonomical Study of Glutamic Acid Accumulating Bacteria", MICROCOCCUS GLUTAMICUS NOV. SP.', BULLETIN OF THE AGRICULTURAL CHEMICAL SOCIETY OF JAPAN, vol. 22, no. 3, 1958, pages 176 - 185
KINOSHITA, S.; NAKAYAMA, K.; KITADA, S., L-LYSINE PRODUCTION USING AUXOTROPH ( PRELIMINARY REPORT, vol. 2, 1958, pages 2 - 3
KIRBY, J.; KEASLING, J. D.: "Biosynthesis of plant isoprenoids: perspectives for microbial engineering", ANNU REV PLANT BIOL, vol. 60, 2009, pages 335 - 55, XP009143317, DOI: doi:10.1146/annurev.arplant.043008.091955
KIRCHER, M.; PFEFFERLE, W.: "The fermentative production of L-lysine as an animal feed additive", CHEMOSPHERE, vol. 43, no. 1, 2001, pages 27 - 31
KOLLER, M.; MUHR, A.; BRAUNEGG, G.: "Microalgae as versatile cellular factories for valued products", ALGAL RESEARCH, vol. 6, 2014, pages 52 - 63
KRUBASIK, P.; KOBAYASHI, M.; SANDMANN, G.: "Expression and functional analysis of a gene cluster involved in the synthesis of decaprenoxanthin reveals the mechanisms for C50 carotenoid formation", EUROPEAN JOURNAL OF BIOCHEMISTRY, vol. 268, no. 13, 2001, pages 3702 - 3708, XP002283022, DOI: doi:10.1046/j.1432-1327.2001.02275.x
KRUBASIK, P.; TAKAICHI, S.; MAOKA, T.; KOBAYASHI, M.; MASAMOTO, K.; SANDMANN, G.: "Detailed biosynthetic pathway to decaprenoxanthin diglucoside in Corynebacterium glutamicum and identification of novel intermediates", ARCHIVES OF MICROBIOLOGY, vol. 176, no. 3, 2001, pages 217 - 223, XP055380099, DOI: doi:10.1007/s002030100315
KURIHARA, K.: "Glutamate: From discovery as a food flavor to role as a basic taste (umami", AMERICAN JOURNAL OF CLINICAL NUTRITION, vol. 90, no. 3, 2009, pages 1 - 3, XP055043517, DOI: doi:10.3945/ajcn.2009.27462D
DE LA FUENTE, J. L.; RODRIGUEZ-SAIZ, M.; SCHLEISSNER, C.; DIEZ, B.; PEIRO, E.; BARREDO, J. L.: "High-titer production of astaxanthin by the semi-industrial fermentation of Xanthophyllomyces dendrorhous", JOURNAL OF BIOTECHNOLOGY, vol. 148, no. 2-3, 2010, pages 144 - 146, XP027119984
LEUCHTENBERGER, W.; HUTHMACHER, K.; DRAUZ, K.: "Biotechnological production of amino acids and derivatives: Current status and prospects", APPLIED MICROBIOLOGY AND BIOTECHNOLOGY, vol. 69, no. 1, 2005, pages 1 - 8, XP019331980, DOI: doi:10.1007/s00253-005-0155-y
LI, J.; ZHU, D.; NIU, J.; SHEN, S.; WANG, G.: "An economic assessment of astaxanthin production by large scale cultivation of Haematococcus pluvialis", BIOTECHNOLOGY ADVANCES, 2011, pages 568 - 574
LIEBL, W.: "Handbook of Corynebacterium glutamicum", 2005, CRC PRESS, article "Corynebacterium Taxonomy", pages: 9 - 34
LORENZ, R. T.; CYSEWSKI, G. R.: "Commercial potential for Haematococcus microalgae as a natural source of astaxanthin", TRENDS IN BIOTECHNOLOGY, vol. 18, no. 4, 2000, pages 160 - 167, XP004194004, DOI: doi:10.1016/S0167-7799(00)01433-5
LOTAN, T.; HIRSCHBERG, J.: "Cloning and expression in Escherichia coli of the gene encoding β-C-4-oxygenase, that converts β-carotene to the ketocarotenoid canthaxanthin in Haematococcus pluvialis", FEBS LETTERS, vol. 364, no. 2, 1995, pages 125 - 128
MALIN, G. M.; BOURD, G. I.: "Journal of Applied Bacteriology", vol. 71, 1991, WILEY ONLINE LIBRARY, article "Phosphotransferase-dependent glucose transport in Corynebacterium glutamicum", pages: 517 - 523
MAT-JAN, F.; ALAM, K. Y.; CLARK, D. P.: "Mutants of Escherichia coli deficient in the fermentative lactic dehydrogenase", J.BACTERIOL., vol. 171, no. 1, 1989, pages 342 - 348, XP002045722
MAZUR, R. H.: "Aspartame: Physiology and Biochemistry", 1984, CRC PRESS, article "Discovery of Aspartame", pages: 3 - 10
MEISWINKEL, T. M.; RITTMANN, D.; LINDNER, S. N.; WENDISCH, V. F.: "Crude glycerol-based production of amino acids and putrescine by Corynebacterium glutamicum", BIORESOURCE TECHNOLOGY, vol. 145, 2013, pages 254 - 258, XP028706153, DOI: doi:10.1016/j.biortech.2013.02.053
MELDRUM, B. S.: "Glutamate as a neurotransmitter in the brain: review of physiology and pathology", THE JOURNAL OF NUTRITION, vol. 130, no. 4S, 2000, pages 1007S - 15S, XP001097318
MIMITSUKA, T.; SAWAI, H.; HATSU, M.; YAMADA, K.: "Metabolic engineering of Corynebacterium glutamicum for cadaverine fermentation", BIOSCIENCE, BIOTECHNOLOGY, AND BIOCHEMISTRY, vol. 71, no. 9, 2007, pages 2130 - 2135, XP002479568, DOI: doi:10.1271/bbb.60699
MISAWA, N.; KAJIWARA, S.; KONDO, K.; YOKOYAMA, A.; SATOMI, Y.; SAITO, T.; MIKI, W.; OHTANI, T.: "Canthaxanthin biosynthesis by the conversion of methylene to keto groups in a hydrocarbon beta-carotene by a single gene", BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS, 1995, pages 867 - 76, XP002264744, DOI: doi:10.1006/bbrc.1995.1579
MISAWA, N.; SATOMI, Y.; KONDO, K.; YOKOYAMA, A.; KAJIWARA, S.; SAITO, T.; OHTANI, T.; MIKI, W.: "Structure and functional analysis of a marine bacterial carotenoid biosynthesis gene cluster and astaxanthin biosynthetic pathway proposed at the gene level", JOURNAL OF BACTERIOLOGY, vol. 177, no. 22, 1995, pages 6575 - 6584
MORTENSEN, A; SKIBSTED, L. H.: "Importance of Carotenoid Structure in Radical-Scavenging Reaction", JOURNAL OF AGRICULTURAL AND FOOD CHEMISTRY, vol. 45, 1997, pages 2970 - 2977
MORTENSEN, A.; SKIBSTED, L. H.; SAMPSON, J.; RICE-EVANS, C.; EVERETT, S. A.: "FEBS Letters", vol. 418, 1997, FEDERATION OF EUROPEAN BIOCHEMICAL SOCIETIES, article "Comparative mechanisms and rates of free radical scavenging by carotenoid antioxidants", pages: 91 - 97
MUELLER, U.; HUEBNER, S.: "Economic aspects of amino acids production", ADVANCES IN BIOCHEMICAL ENGINEERING/BIOTECHNOLOGY, vol. 79, 2003, pages 137 - 70, Retrieved from the Internet
NAKAYAMA, K.; KITADA, S.; KINOSHITA, S.: "Studies on Lysine Fermentation I. the Control Mechanism on Lysine Accumulation By Homoserine and Threonine", THE JOURNAL OF GENERAL AND APPLIED MICROBIOLOGY, vol. 7, no. 3, 1961, pages 145 - 154, XP001021039, Retrieved from the Internet
NOGUCHI, N.; NIKI, E.; PAPAS, A.: "Antioxidant status, diet, nutrition, and ....", 1998, CRC PRESS, article "Chemistry of Active Oxygen Species and Antioxidants", pages: 3 - 20
NORRIS, S. R.; BARRETTE, T. R.; DELLAPENNA, D.: "Genetic dissection of carotenoid synthesis in arabidopsis defines plastoquinone as an essential component of phytoene desaturation", THE PLANT CELL, vol. 7, December 1995 (1995-12-01), pages 2139 - 2149, XP002041909, DOI: doi:10.1105/tpc.7.12.2139
OLAIZOLA, M.; HUNTLEY, M. E.: "Recent advances in commercial production of astaxanthin from microalgae", RECENT ADVANCES IN MARINE BIOTECHNOLOGY. VOLUME 9: BIOMATERIALS AND BIOPROCESSING., vol. 9, January 2003 (2003-01-01), pages 143 - 164
OSBORNE, T. B.; MENDEL, L. B.: "Amino-Acids in Nutrition and Growth", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 17, 1914, pages 325 - 349
OVIE, S. O.; EZE, S. S.: "Lysine Requirement and its Effect on the Body Composition of Oreochromis niloticous Fingerlings", FISHERIES AND AQUATIC SCIENCE, vol. 6, no. 2, 2011, pages 186 - 193
PEREZ-GARCIA, F.; PETERS-WENDISCH, P.; WENDISCH, V. F.: "Engineering Corynebacterium glutamicum for fast production of I-lysine and I-pipecolic acid", APPLIED MICROBIOLOGY AND BIOTECHNOLOGY. APPLIED MICROBIOLOGY AND BIOTECHNOLOGY, vol. 100, no. 18, 2016, pages 8075 - 8090
PETERS-WENDISCH, P.; GOTKER, S.; HEIDER, S. A. E.; KOMATI REDDY, G.; NGUYEN, A. Q.; STANSEN, K. C.; WENDISCH, V. F.: "Journal of Biotechnology", vol. 192, 2014, ELSEVIER B.V., article "Engineering biotin prototrophic Corynebacterium glutamicum strains for amino acid, diamine and carotenoid production", pages: 346 - 354
PFEFFERLE, W.; MOCKEL, B.; BATHE, B.; MARX, A.: "Biotechnological manufacture of lysine", ADVANCES IN BIOCHEMICAL ENGINEERING/BIOTECHNOLOGY, vol. 79, 2003, pages 59 - 112, XP008032623
PFEIFER, E.; HUNNEFELD, M.; POPA, O.; POLEN, T.; KOHLHEYER, D.; BAUMGART, M.; FRUNZKE, J.: "Silencing of cryptic prophages in Corynebacterium glutamicum", NUCLEIC ACIDS RESEARCH, 2016, pages 1 - 15
PORTER, J. W.; ANDERSON, D. G.: "The biosynthesis of carotenes", ARCHIVES OF BIOCHEMISTRY AND BIOPHYSICS, vol. 97, no. 3, 1962, pages 520 - 528
RADMACHER, E.; STANSEN, K. C.; BESRA, G. S.; ALDERWICK, L. J.; MAUGHAN, W. N.; HOLLWEG, G.; SAHM, H.; WENDISCH, V. F.; EGGELING, L: "Ethambutol, a cell wall inhibitor of Mycobacterium tuberculosis, elicits L-glutamate efflux of Corynebacterium glutamicum", MICROBIOLOGY, vol. 151, no. 5, 2005, pages 1359 - 1368, XP002735505, DOI: doi:10.1099/mic.0.27804-0
REARDON, J. E.; ABELES, R. H.: "Mechanism of action of isopentenyl pyrophosphate isomerase: evidence for a carbonium ion intermediate", BIOCHEMISTRY, vol. 25, no. 19, 1986, pages 5609 - 16, XP002251142, DOI: doi:10.1021/bi00367a040
RODRIGUEZ-CONCEPCION, M.; BORONAT, A.: "Elucidation of the methylerythritol phosphate pathway for isoprenoid biosynthesis in bacteria and plastids. A metabolic milestone achieved through genomics", PLANT PHYSIOLOGY, vol. 130, no. 3, 2002, pages 1079 - 1089, XP002697712, DOI: doi:10.1104/PP.007138
RONEN, G.; COHEN, M.; ZAMIR, D.; HIRSCHBERG, J.: "Regulation of carotenoid biosynthesis during tomato fruit development: expression of the gene for lycopene epsilon cyclase is down- regulated during ripening and is elevated in the mutant Delta", THE PLANT JOURNAL, vol. 17, no. 4, 1999, pages 341 - 351, XP002123127, DOI: doi:10.1046/j.1365-313X.1999.00381.x
SAHM, H.; ANTRANIKIAN, G.; STAHMANN, K.-P.; TAKORS, R.: "Industrielle Mikrobiologie", 2013, SPRINGER SPEKTRUM, article "Aminosauren", pages: 109 - 126
SAKAI, S.; TSUCHIDA, Y.; OKINO, S.; ICHIHASHI, O.; KAWAGUCHI, H.; WATANABE, T.; INUI, M.; YUKAWA, H.: "Effect of lignocellulose-derived inhibitors on growth of and ethanol production by growth-arrested Corynebacterium glutamicum R", APPLIED AND ENVIRONMENTAL MICROBIOLOGY, vol. 73, no. 7, 2007, pages 2349 - 2353, XP002536040, DOI: doi:10.1128/AEM.02880-06
SANDMANN, G.; YUKAWA, H.: "Handbook of Corynebacterium glutamicum", 2005, CRC PRESS, article "Vitamin synthesis: carotenoids, biotin and pantothenate", pages: 399 - 417
SCHAFER, A.; TAUCH, A.; JAGER, W.; KALINOWSKI, J.; THIERBACH, G.; PUHLER, A.: "Small mobilizable multi-purpose cloning vectors derived from the Escherichia coli plasmids pK18 and pK19: selection of defined deletions in the chromosome of Corynebacterium glutamicum", GENE, vol. 145, no. 1, 1994, pages 69 - 73, XP023540831, DOI: doi:10.1016/0378-1119(94)90324-7
SCHNEIDER, J.; WENDISCH, V. F.: "Putrescine production by engineered Corynebacterium glutamicum", APPLIED MICROBIOLOGY AND BIOTECHNOLOGY, vol. 88, no. 4, 2010, pages 859 - 868, XP019841775
SCHNEIDER, J.; NIERMANN, K.; WENDISCH, V.F.: "Production of the amino acids L-glutamate, L-lysine, L-ornithine and L-arginine from arabinose by recombinant Corynebacterium glutamicum", J. BIOTECHNOL., vol. 154, no. 2-3, 2011, pages 191 - 198, XP055126161, DOI: doi:10.1016/j.jbiotec.2010.07.009
SCHRUMPF, B.; EGGELING, L.; SAHM, H.: "Isolation and prominent characteristics of an L-lysine hyperproducing strain of Corynebacterium glutamicum", APPLIED MICROBIOLOGY AND BIOTECHNOLOGY, vol. 37, no. 5, 1992, pages 566 - 571, XP000979296, DOI: doi:10.1007/BF00240726
SEIBOLD, G.; AUCHTER, M.; BERENS, S.; KALINOWSKI, J.; EIKMANNS, B. J.: "Utilization of soluble starch by a recombinant Corynebacterium glutamicum strain: Growth and lysine production", JOURNAL OF BIOTECHNOLOGY, vol. 124, no. 2, 2006, pages 381 - 391, XP024956737, DOI: doi:10.1016/j.jbiotec.2005.12.027
SEIBOLD, G. M.; WURST, M.; EIKMANNS, B. J.: "Roles of maltodextrin and glycogen phosphorylases in maltose utilization and glycogen metabolism in Corynebacterium glutamicum", MICROBIOLOGY, vol. 155, no. 2, 2009, pages 347 - 358
SHIIO, B. I.; OTSUKA, S.; TAKAHASHI, M., EFFECT OF BIOTIN ON THE BACTERIAL FORMATION OF GLUTAMIC ACID AS THE BIOTIN CONCENTRATION IN THE CULTURE EFFECT OF BIOTIN ON GLUTAMATE FORMATION MEDIUM INCREASED , THE AMOUNT OF L-GLUTAMATE PRODUCED IN THE MEDIUM DECREASED , BUT THE OF GLUTAMATE IN TH, vol. 51, no. 1, 1962
SIMON, R.; PRIEFER, U.; PUHLER, A.: "A Broad Host Range Mobilization System for In Vivo Genetic Engineering: Transposon Mutagenesis in Gram Negative Bacteria", NAT BIOTECHNOL, vol. 1, no. 9, 1983, pages 784 - 789
SONG, Y.; MATSUMOTO, K.; TANAKA, T.; KONDO, A.; TAGUCHI, S.: "Single-step production of polyhydroxybutyrate from starch by using a-amylase cell-surface displaying system of Corynebacterium glutamicum", SEIBUTSU-KOGAKU KAISHI, vol. 115, no. 1, 2013, pages 12 - 14
"Astaxanthin", SPEKTRUM - LEXIKON DER BIOCHEMIE, 1999, Retrieved from the Internet
"Astaxanthin", SPEKTRUM - LEXIKON DER BIOLOGIE, 1999, Retrieved from the Internet
"Lysin", SPEKTRUM - LEXIKON DER BIOLOGIE, 1999, Retrieved from the Internet
"Minimumgesetz", SPEKTRUM - LEXIKON DER BIOLOGIE, 1999, Retrieved from the Internet
"Lysin", SPEKTRUM - LEXIKON DER CHEMIE, 1998, Retrieved from the Internet
SUTCLIFFE, J. G.: "Complete nucleotide sequence of the Escherichia coli plasmid pBR322", COLD SPRING HARBOR SYMPOSIA ON QUANTITATIVE BIOLOGY, vol. 43, no. 1, 1979, pages 77 - 90, XP002915924
THULASIRAM, H. V; ERICKSON, H. K.; POULTER, C. D.: "Chimeras of Two Isoprenoid Synthases in Isoprenoid Biosynthesis", SCIENCE, vol. 73, 2007, pages 73 - 76
TOBIAS, A. V.; ARNOLD, F. H.: "Biosynthesis of novel carotenoid families based on unnatural carbon backbones: A model for diversification of natural product pathways", BIOCHIMICA ET BIOPHYSICA ACTA (BBA) - MOLECULAR AND CELL BIOLOGY OF LIPIDS, vol. 1761, no. 2, 2006, pages 235 - 246, XP025180685
TSUCHIDATE, T.; TATENO, T.; OKAI, N.; TANAKA, T.; OGINO, C.; KONDO, A: "Glutamate production from β-giucan using endoglucanase-secreting Corynebacterium glutamicum", APPLIED MICROBIOLOGY AND BIOTECHNOLOGY, vol. 90, no. 3, 2011, pages 895 - 901
UHDE, A.; YOUN, J. W.; MAEDA, T.; CLERMONT, L.; MATANO, C.; KRAMER, R.; WENDISCH, V. F.; SEIBOLD, G. M.; MARIN, K.: "Glucosamine as carbon source for amino acid-producing Corynebacterium glutamicum", APPLIED MICROBIOLOGY AND BIOTECHNOLOGY, vol. 97, no. 4, 2013, pages 1679 - 1687
UNTHAN, S.; BAUMGART, M.; RADEK, A.; HERBST, M.; SIEBERT, D.; BRUHL, N.; BARTSCH, A.; BOTT, M.; WIECHERT, W.; MARIN, K.: "Chassis organism from Corynebacterium glutamicum - a top-down approach to identify and delete irrelevant gene clusters", BIOTECHNOLOGY JOURNAL, vol. 10, no. 2, 2015, pages 290 - 301, XP002762894
VERSHININ, A.: "Biological functions of carotenoids - diversity and evolution", BIOFACTORS (OXFORD, ENGLAND), vol. 10, no. 2-3, 1999, pages 99 - 104
WENDISCH, V.F.; JORGE, J.M.; PEREZ-GARCIA, F.; SGOBBA, E.: "Updates on industrial production of amino acids using Corynebacterium glutamicum", WORLD J. MICROBIOL. BIOTECHNOL., vol. 32, no. 6, 2016, pages 105
WINK, M: "Molekulare Biotechnologie", 2011, WILEY-VCH, article "Biokatalyse in der chemischen Industrie: Konzepte, Methoden und Anwendungen", pages: 481 - 504
WISNIEWSKA, A.; SUBCZYNSKI, W. K.: "Effects of polar carotenoids on the shape of the hydrophobic barrier of phospholipid bilayers", BIOCHIMICA ET BIOPHYSICA ACTA - BIOMEMBRANES, vol. 1368, no. 2, 1998, pages 235 - 246
WU, G.: "Amino acids: Metabolism, functions, and nutrition", AMINO ACIDS, vol. 37, no. 1, 2009, pages 1 - 17, XP008114871, DOI: doi:10.1007/s00726-009-0269-0
YOKOTA, A.; LINDLEY, N.: "Handbook of Corynebacterium glutamicum", 2005, CRC PRESS, article "Central Metabolism: Sugar Uptake and Conversion", pages: 215 - 240
Claims A process for the preparation of astaxanthin and lysine in recombinant C. glutamicum, wherein in the genome of said recombinant C. glutamicum crtR, crtY from C. glutamicum and crtEb were deleted and crtEBI, crtYPa and at least one recombinant sequence which comprises a nucleic acid sequence encoding for a crtZ- protein (crtZ-nucleic acid sequence), preferably from F. pelagi (crtZFp-nucleic acid sequence) and at least one recombinant sequence which comprises a nucleic acid sequence encoding for a crtW-protein (crtW-nucleic acid sequence), preferably from F. pelagi (crtWFp-nucleic acid sequence), B.aurantiaca (crtWBa-nucleic acid sequence) or S. astaxanthinifaciens (crtWSa-nucleic acid sequence) were introduced. The process according to claim 1 , wherein the crtZFp-nucleic acid sequence is SEQ ID NO.: 1 , or a nucleic acid sequence having at least 80% identity as set forth with SEQ ID NO.: 1 , or a nucleic acid sequence that hybridizes with the complement of a nucleic acid sequence according to SEQ ID NO.: 1 under the following hybridization conditions: 0,1 x SSC, 0,1 % SDS, 65 °C and wash conditions 2x SSC, 0,1 % SDS, 65 °C , followed by 0,1 x SSC, 0,1 % SDS, 65 °C (high stringency conditions), or a nucleic acid sequence encoding for an amino acid sequence having at least 80% identity with SEQ ID NO.: 2 and which amino acid sequence shows crtZ activity. The process according to claim 2, wherein the crtZFp-nucleic acid sequence is SEQ ID NO.: 1 . The process according to claim 1 or claim 2, wherein the crtW-nucleic acid sequence is SEQ ID NO.: 3 or SEQ ID NO.: 5 or is a nucleic acid sequence having at least 80% identity as set forth with SEQ ID NO.: 3 or 5, respectively, or a nucleic acid sequence that hybridizes with the complement of a nucleic acid sequence according to SEQ ID NO.: 3 or 5, respectively, under the following hybridization conditions: 0,1 x SSC, 0,1 % SDS, 65 °C and wash conditions 2x SSC, 0,1 % SDS, 65 °C , followed by 0,1 x SSC, 0,1 % SDS, 65 °C (high stringency conditions), or is a nucleic acid sequence encoding for an amino acid sequence having at least 80% identity with SEQ ID NO.: 4 or 6, respectively, and which amino acid sequence shows crtW activity; or is SEQ ID NO.: 7 or is a nucleic acid sequence having at least 80% identity as set forth with SEQ ID NO.: 7, or a nucleic acid sequence that hybridizes with the complement of a nucleic acid sequence according to SEQ ID NO.: 7 under the following hybridization conditions: 0,1 x SSC, 0,1 % SDS, 65 °C and wash conditions 2x SSC, 0,1 % SDS, 65 °C , followed by 0,1 x SSC, 0,1 % SDS, 65 °C (high stringency conditions), or a nucleic acid sequence encoding for an amino acid sequence having at least 80% identity with SEQ ID NO.: 8 and which amino acid sequence shows crtW activity; or is SEQ ID NO.: 9, or is a nucleic acid sequence having at least 80% identity as set forth with SEQ ID NO.: 9, or a nucleic acid sequence that hybridizes with the complement of a nucleic acid sequence according to SEQ ID NO.: 9 under the following hybridization conditions: 0,1 x SSC, 0,1 % SDS, 65 °C and wash conditions 2x SSC, 0,1 % SDS, 65 °C , followed by 0,1 x SSC, 0,1 % SDS, 65 °C (high stringency conditions), or a nucleic acid sequence encoding for an amino acid sequence having at least 80% identity with SEQ ID NO.: 10 and which amino acid sequence shows crtW activity. 5. The process according to any one of the claims 1 to 3, wherein the crtW-protein is of SEQ ID NO.: 4, 6, 8 or 10. 6. The process according to any of the preceding claims, wherein said recombinant C. glutamicum comprises a nucleic acid sequence encoding for a promotor 1 which is operatively linked to a crtZFp-nucleic acid sequence according to claim 2 or claim 3. 7. The process according to any of the preceding claims, wherein said recombinant C. glutamicum comprises a nucleic acid sequence encoding for a promotor 2 which is operatively linked to a crtWFp-, crtWBa-, or crtWSa-nucleic acid sequence according to claim 4 or 5. 8. The process according to any one of the preceding claims, wherein the promotor 1 and the promotor 2 are not induced by the same inducing compound. 9. The process according to any one of the preceding claims, wherein promotor 2 is a constitutively expressing promotor. 10. The process according to any one of the preceding claims, wherein induction of promotor activity of promotor 1 and induction of promotor activity of promotor 2 occur at different times. 1 1 . The process according to any one of the preceding claims, wherein induction of promotor activity of promotor 1 occurs at the beginning of the cultivation, in the exponential growth phase within the first 6 hours. 12. The process according to any one of claims 1 to 7 and 8 to 10, wherein promotorl and promotor 2 are constitutively expressing promotors. 13. The process according to any one of the preceding claims, wherein said recombinant C. glutamicum is GRLyslAsugRAIdhA. 14. A recombinant C. glutamicum, wherein said recombinant C. glutamicum comprises a crtY-nucleic acid sequence, preferably a crtYPa-nucleic acid sequence, further comprises a crtZ-nucleic acid sequence, which is not from C. glutamicum, preferably a crtZpp-nucleic acid sequence, and further comprises a crtW-nucleic acid sequence, preferably a crtWFp-, crtWBa-, or crtWSa-nucleic acid sequence; more preferably, in the genome of said recombinant C. glutamicum crtR, crtY from C. glutamicum and crtEb were deleted and crtEBI, crtYPa and at least one recombinant sequence which comprises a nucleic acid sequence encoding for a crtZ-protein, preferably from F. pelagi (crtZFp-nucleic acid sequence) and at least one recombinant sequence which comprises a nucleic acid sequence encoding for a crtW-protein, preferably from F. pelagi (crtWFp-nucleic acid sequence), B.aurantiaca (crtWBa-nucleic acid sequence) or S. astaxanthinifaciens (crtWSa-nucleic acid sequence) were introduced. 15. The recombinant C. glutamicum, according to claim 15, wherein the nucleic acid sequence encoding for a crtZ-protein is a nucleic acid sequence according to claim 2 or 3 and the nucleic acid sequence encoding for a crtW-protein is a nucleic acid sequence according to claim 4 or 5. |
glutamicum
Background
Carotenoids are natural pigments that can be ubiquitously found in plants, algae, fungi and bacteria. These pigments form a subfamily of the large and diverse group of terpenoids. Carotenoids can be categorized according to the length of their carbon backbone. Most carotenoids possess a C40 backbone but C30 and C50 carotenoids also occur.
Carotenoids become more important for the health industry due to their beneficial effects on health and their possible pharmaceutical, medical and nutraceutical applications (Belviranli and Okudan, 2015, Antioxidants in Sport Nutrition, M. Lamprecht, Boca Raton FL, by Taylor & Francis Group, LLC). These days, carotenoids are especially used as food and beverage colorants, animal feed and nutraceuticals.
Although the chemical synthesis of astaxanthin from petrochemical precursors is so far more cost-efficient and more dominant on the market (Li, Zhu et al. 201 1 , Biotechnol. Adv. 29 (6), 568-574), the demand for naturally produced carotenoids is increasing. The synthetic astaxanthin is a mixture of R- and S-enantiomers, which is significantly inferior to natural- based astaxanthin and thus might not be suitable as a nutraceutical supplement without further complex and cost-intensive purification steps before application. Consequently, the demand for an efficient and environmentally friendly production of natural astaxanthin, and carotenoids in general, by microbial hosts is increasing (Cutzu, Coi et al. 2013, World J Microbiol Biotechnol, 77 (3), 505-512). The green freshwater microalgae Haematococcus pluvialis and the red yeast Pfaffia rhodozyma are established hosts for a commercial production of astaxanthin (Rodriguez-Saiz, de la Fuente et al. 2010, Appl Microbiol Biotechnol, 88 (3), 645-658) but it can also be produced by other microalgae and marine bacteria. The highest production titer of 9.7 mg/g CDW was achieved by a metabolically engineered P. rhodozyma strain (Gassel, Schewe et al. 2013, Biotechnology Letters, 35 (4), 565-569), while the highest titer of 5.8 mg/g CDW was produced by a recombinant E. coli strain for which a combinatorial approach was used (Zelcbuch, Antonovsky et al. 2013, Nucleic Acids Res, 41 (9), e98).
Carotenoids, like all terpenoids, derive from the C5 precursor isopentenyl pyrophosphate (IPP) and its isomer dimethylallyl pyrophosphate (DMAPP). IPP is synthesized either by the mevalonic acid (MVA) pathway or the methylerythritol phosphate (MEP) pathway, also known as Sahm-Rohmer pathway or non-mevalonate pathway (Rodriguez-Concepcion and Boronat 2002, Plant Physiol. 130(3):1079-1089). The MVA -pathway is mainly present in eukaryotes, archaea and a small number of bacteria. In the MVA -pathway IPP is synthesized from the primary educt acetyl-CoA via the intermediate mevalonate. In the alternative MEP -pathway, found in most bacteria as well as in plant plastids, IPP is synthesized from pyruvate and glyceraldehyde 3-phosphate (GAP) via the intermediate methylerythritol 4-phosphate (Kirby and Keasling 2009, Annu Ref Plant Biol. 60: 335-355). The MEP-pathway consists of nine enzymatic steps depending on eight enzymes (Hunter, 2007, J Biol Chem, 282 (30), 21573-21577) (Figure 1 a). The initial condensation of pyruvate and glyceraldehyde 3-phosphate is catalyzed by thiamine pyrophosphate-dependent 1 - deoxy-D-xylulose 5-phosphate synthase [EC2.2.1.7] encoded by c/xs-nucleic acid sequence leading to 1 -deoxy-d-xylulose-5-phospate (DXP). Subsequently DXP is converted to MEP by DXP-reductoisomerase [EC1 .1.1.267] encoded by dxp-nucleic acid sequence. MEP is transformed to 2-C-methyl-d-erythritol-2,4-cyclodiphosphate (ME-cPP) through three enzymatic steps catalyzed by 2-C-methylerythritol 4-phosphate cytidylyltransferase (IspD) encoded by ispD-nucleic acid sequence, 2-C-methylerythritol 4-diphosphocytidyl kinase (IspE) encoded by ispE-nucleic acid sequence and 2-C-methylerythritol 2,4-cyclodiphosphate synthases (IspF) encoded by ispF-nucleic acid sequence using CTP and ATP as cofactors. 4-Hydroxy-3-methyl-2-(E)-butenyl-4-diphosphate synthase IspG encoded by /spG-nucleic acid sequence catalyzes the conversion of ME-cPP to 4-hydroxy-3-methyl-2-(E)-butenyl-4- diphosphate (HMBPP). Finally, HMBPP can be reduced to IPP or DMAPP by 4-Hydroxy-3- methyl-2-(E)-butenyl-4-diphosphate reductase IspH encoded by ispH-sequence. IPP and DMAPP can be isomerized by isopentenly diphosphate isomerase Idi encoded by idi. The C5 compounds IPP and DMAPP can be condensed by several chain elongation reactions catalyzed by prenyltransferases. The first condensation reaction results in the C10 compound geranyl diphosphate (GPP), the precursor of monoterpenes. The C15 compound farnesyl diphosphate (FPP) represents the precursor of sesquiterpenes and C30 carotenoids. All C40 and C50 carotenoids are derived from the C20 compound geranylgeranyl disphosphate (GGPP) synthesized from one molecule of DMAPP and three molecules of IPP by GGPP synthase. Lycopene can be converted to β-carotene by a lycopene cyclase (CrtY) [EC5.5.1.19]. β-carotene can be further functionalized to astaxanthin by hydroxylation and oxygenation. The 4,4"-beta-ionone ring ketolase [EC1 .14.1 1.B16], encoded by crtW-nucleic acid sequence, and the 3,3"-beta-ionone ring hydroxylase [EC1.14.13.129], encoded by crtZ-nucleic acid sequence, are the most common enzymes responsible for astaxanthin synthesis. Corynebacterium glutamicum is a Gram-positive soil bacterium. It belongs to the Corynebacterineae within the order Actinomycetales and the class of Actinobacteria. C. glutamicum was used in biotechnological as a natural glutamate producer (Kinoshita, Udaka et al. 1957, J Gen ApplMicrobiol, 3, 193-205). Furthermore, it is used for million ton scale production of different amino acids such as L-Lysin (see, e.g., WO 2007/141 1 1 1 ). There are several methods for cultivation, characterization and genetic engineering, such as chromosomal deletions, integrations and expression vector design, which allow straightforward handling. The bacterium has the ability to grow aerobically on a variety of carbon sources like glucose, fructose, sucrose, mannitol, propionate and acetate. In addition it has been engineered to grow on alternative carbon sources such as glycerol, pentoses, amino sugars, β-glucans and starch.
In the past, several metabolic engineering strategies were applied to convert C. glutamicum into a carotenoid producer. To engineer C. glutamicum for C40 carotenoid production, the conversion of lycopene to decaprenoxanthin needs to be avoided through the inactivation of its lycopene elongase and ε-cyclase. The deletion of the respective genes crtYe/fEb resulted in the accumulation of the intermediate lycopene and a slight red color of the cells (Heider et al. ((2014), Frontiers in Bioengineering and Biotechnology, Vo. 2, Article 28). When overexpressing the endogenous genes crtE, crtB and crtl in C. glutamicum AcrtEb the red phenotype intensified because of a better conversion of GGPP to the red chromophore lycopene. Heterologous expression of crtY from Pantoea ananatis (crtY Pa ) in the lycopene accumulating strain yielded the yellow pigment β-carotene. In the same study the production of small amounts of zeaxanthin was achieved by the additional expression of crtZ from P. ananatis (crtZ Pa ). The document also discloses a recombinant C. glutamicum strain in which a crtY-gene (from P. ananatis), a crtW-gene (from Brevundimonas aurantiaca) and a crtZ- gene (from P. ananatis) were overexpressed. However, this combination only resulted in astaxanthin titer of 0,14±0,01 mg/g DCW.
Amino acids are organic substances which contain amino and acid groups which are linked to an asymmetric carbon atom (Wu, 2009; Campbell and Reece, 2016). In nature, there are more than 300 amino acids existing but only 20 are used as building blocks for proteins. All the proteinogenic amino acids are oenantiomers with ^configuration, except for proline (Wu, 2009; Campbell and Reece, 2016). Humans and animals are not able to synthesize all amino acids, so that they have to obtain them through their diet. These amino acids are called essential amino acids (EAA). The eight essential amino acids are L -valine, L -leucine, L - isoleucine, L -methionine, ^phenylalanine, L -tryptophan, L -threonine and L -lysine (Leuchtenberger, Huthmacher and Drauz, 2005; Sahm et al., 2013). Amino acids are biotechnologically produced for the food, pharmaceutical and feed market (Mueller and Huebner, 2003). For the food market produced amino acids mainly are L -aspartic acid, L - phenylalanine and L -glutamic acid. L -Aspartic acid, ^phenylalanine are used to produce the peptide sweetener L -aspartyl L -phenylalanyl methyl ester (Aspartame) (Mazur, 1984). This product is used to sweeten beverages (Leuchtenberger, Huthmacher and Drauz, 2005). L - glutamic acid is being produced in the form of monosodium glutamate (MSG), which is used as a flavour enhancer (Kinoshita et al., 1957; Leuchtenberger, Huthmacher and Drauz, 2005). The amino acids DL -methionine, L -tryptophan, L -threonine and L -lysine have been produced over the last 30 years for the feed market and they hold a share of 56 % of the total amino acid market (Leuchtenberger, Huthmacher and Drauz, 2005). The global market value for amino acids is expected to reach US$ 35.4 billion with a production of 10 million tons by 2022 (Grand View Research, 2015).
The amino acid glutamate has an important role in the central nervous system of vertebrates; it is an excitatory neurotransmitter (Meldrum, 2000; Campbell and Reece, 2009b). In 1908 Kikunae Ikeda discovered that the sodium salt of glutamic acid is the reason for the taste of kelp (konbu), which was later on called "umami" and is the fifth taste quality besides sweet, sour, bitter and salty (Kurihara, 2009). Glutamic acid tastes insipid and slightly sour (Fischer, 1906), while the salt elicits the typical umami taste (Kurihara, 2009). Free glutamate is present in many foodstuffs, e.g. tomato, potato, parmesan cheese, mushroom (Psalliota campestris), broccoli, and various fruits (e.g. strawberry, grape, peach) (Giacometti, 1979). Glutamate has been used as a flavour enhancer in Japan in the early 20 th century. It elicits a meat-like taste and is therefore often used to improve the vegetarian diet of the Japanese or Asian people in general. Since production of glutamate by hydrolysis of proteins (e.g. gluten, soy bean) (Han, 1929) was rather expensive and labourous, an alternative glutamate source was sought for. Microorganisms of many genera are able to accumulate L -glutamate in their medium during fermentation, whereas C. glutamicum secreted the highest level of the amino acid (Asai, Aida and Oishi, 1957). From this time on, C. glutamicum was used for the fermentative production of glutamate (Kinoshita et al., 1957). About 3.1 million tons of glutamate have been produced in 2015 (Ajinomoto Co., 2016a) and the market is expected to reach 4 million tons by 2023 with a value of US$ 15.5 billion and a CAGR of 7.5 % up to the year 2023 (Global Market Insights, 2016).
C. glutamicum is able to synthesize a huge amount of glutamate under specific conditions, e.g. biotin limitation of the medium (Shiio, Otsuka and Takahashi, 1962) or the addition of antibiotics (e.g. ethambutol; EMB) (Radmacher et al., 2005) or detergents (e.g. tween 40) (Eggeling and Sahm, 1999). Glutamate is derived from 2-oxoglutarate, which is an intermediate of the TCA cycle. The glutamate dehydrogenase converts 2-oxoglutarate to glutamate under the consumption of NADPH (Bormann-EI Kholy et al., 1993). The amino acid is transported out of the cell by the transporter YggB (Sahm et al., 2013).
The amino acid lysine is one of the essential amino acids which needs to be obtained through diet by humans and animals (Campbell and Reece, 2009a). It is important for the bone development, the cell division and the synthesis of nucleotides. In hospitals it is used in infusions (Spektrum - Lexikon der Chemie, 1998). Furthermore it is significant for a healthy development and growth in animals (e.g. fish) (Ovie and Eze, 201 1 ).
The barrel principle explains that the growth factor, in this case amino acid, which is present in the least amount, limits the growth of the organism. Only when the need of the amino acid is met, the organism is able to grow until the next amino acid is limiting (Spektrum - Lexikon der Biologie, 1999c). The addition of L -lysine to the feed leads to a decreased amount of feed and a reduction of nitrogen release of 60 % (Kircher and Pfefferle, 2001 ). Lysine is the first limiting amino acid in swine and the second in poultry (Ajinomoto Co., 2016b). Furthermore, L-lysine is an important component for growth in animals. When L -lysine was missing from the diet, the tested animals were not able to grow. But when L -lysine was added, they were able to grow at a normal rate (Osborne and Mendel, 1914). The amount of L -lysine in used feed (e.g. barley, wheat bran, corn germ meal) is generally low (Kircher and Pfefferle, 2001 ). 50 kg of soybean as feed can be replaced by 48.5 kg of corn plus 1 .5 kg of lysine. Using this feed composition, the use of 1 ton of lysine would replace 33 tons of soybean (Ajinomoto Co., 2016b). Therefore a procedure to produce L -lysine needed to be invented. In 1958 a mutant strain of C. glutamicum with the ability to accumulate lysine was discovered (Kinoshita, Nakayama and Kitada, 1958). A homoserine-less mutant of C. glutamicum was able to accumulate 20 mg/ml L -lysine by fermentation and further experiments showed the inhibition of L -lysine production in the presence of homoserine and threonine (Nakayama, Kitada and Kinoshita, 1961 ). The large scale production of L -lysine started in 1958 and has grown since then (Pfefferle et al., 2003). In 2015, 2.2 million tons of L -lysine were produced for the global market and the demand is expected to reach 2.5 million tons by 2018 with a CAGR of 5.8 % (from 2012 - 2018) (Byrne, 2014; Ajinomoto Co., 2016b). The global market value was US$ 3.5 billion in 201 1 and the expectation for 2018 is an increase to US$ 5.9 billion with a CAGR of 9.1 % (from 2012 - 2018) (Byrne, 2014).
Oxaloacetate is the central intermediate from which lysine is produced. First a transaminase converts lysine to L -aspartate. The reduction of L -aspartate by aspartate kinase (Ask, LysC) and aspartate semialdehyde dehydrogenase (Asd) leads to aspartate semialdehyde. This is a branching point (Wink, 201 1 ). The homoserine dehydrogenase (Horn) (Sahm et al., 2013) converts aspartate semialdehyde to homoserine, which can be metabolised to L -methionine, L-threonine and L -isoleucine (Wink, 201 1 ). At the other branch the enzyme dihydrodipicolinate synthase (DapA) converts the aspartate semialdehyde to dihydrodipicolinate which is converted to L -piperideine-2,6-dicarboxylate (Wink, 201 1 ; Sahm et al., 2013). This is another branching point, where the second amino group is added to L - piperideine-2,6-dicarboxylate (Sahm et al., 2013).
Henke et al., 2016 disclose a method for production of lysine in C. glutamicum. However, no information or incentive is provided that the disclosed C. glutamicum strain is suitable for the simultaneous production of carotenoids and amino acids. US 2009/0221027 discloses that a heterologous metl overexpression in connection with the disruption of marR (denoted as crtR herein) may be used for production of methionine and carotenoids, but provides no further information, especially on the production of lysine and astaxanthine.
The markets for amino acids and carotenoids are growing and the demand for naturally produced carotenoids is increasing but hitherto only organisms which are able to produce either amino acids or carotenoids are known. There is a need for further and even better processes to produce carotenoids and amino acids from natural sources. The development of a C. glutamicum strain which can produce carotenoids and amino acids simultaneously is the main objective of this invention.
Summary One aspect of the present invention refers to a process for the preparation of astaxanthin and lysine in recombinant C. glutamicum, wherein in the genome of said recombinant C. glutamicum crtR, crtY from C. glutamicum and crtEb were deleted and crtEBI, crtY Pa and at least one recombinant sequence which comprises a nucleic acid sequence encoding for a crtZ-protein (crtZ-nucleic acid sequence), preferably from F. pelagi (crtZ Fp -nucleic acid sequence) and at least one recombinant sequence which comprises a nucleic acid sequence encoding for a crtW-protein (crtW-nucleic acid sequence), preferably from F. pelagi (crtW Fp -nucleic acid sequence), B.aurantiaca (crtW Ba -nucleic acid sequence) or Sphingomonas astaxanthinifaciens (crtW Sa -nucleic acid sequence) were introduced.
One preferred embodiment refers to a process according to the invention, wherein the crtZ Fp - nucleic acid sequence is SEQ ID NO.: 1 , or a nucleic acid sequence having at least 80% identity as set forth with SEQ ID NO.: 1 , or a nucleic acid sequence that hybridizes with the complement of a nucleic acid sequence according to SEQ ID NO.: 1 under the following hybridization conditions: 0,1 x SSC, 0,1 % SDS, 65 °C and wash conditions 2x SSC, 0,1 % SDS, 65 °C , followed by 0,1x SSC, 0,1 % SDS, 65 °C (high stringency conditions), or a nucleic acid sequence encoding for an amino acid sequence having at least 80% identity with SEQ ID NO.: 2 and which amino acid sequence shows crtZ activity.
A further preferred embodiment refers to a process according to the invention, wherein the crtZ F p-nucleic acid sequence is SEQ ID NO.: 1.
A further preferred embodiment refers to a process according to the invention, wherein the crtW-nucleic acid sequence is SEQ ID NO.: 3 or SEQ ID NO.: 5 or is a nucleic acid sequence having at least 80% identity as set forth with SEQ ID NO.: 3 or 5, respectively, or a nucleic acid sequence that hybridizes with the complement of a nucleic acid sequence according to SEQ ID NO.: 3 or 5, respectively, under the following hybridization conditions: 0,1 x SSC, 0,1 % SDS, 65 °C and wash conditions 2x SSC, 0,1 % SDS, 65 °C , followed by 0,1 x SSC, 0,1 % SDS, 65 °C (high stringency conditions), or is a nucleic acid sequence encoding for an amino acid sequence having at least 80% identity with SEQ ID NO.: 4 or 6, respectively, and which amino acid sequence shows crtW activity; or is SEQ ID NO.: 7 or is a nucleic acid sequence having at least 80% identity as set forth with SEQ ID NO.: 7, or a nucleic acid sequence that hybridizes with the complement of a nucleic acid sequence according to SEQ ID NO.: 7 under the following hybridization conditions: 0,1 x SSC, 0,1 % SDS, 65 °C and wash conditions 2x SSC, 0,1 % SDS, 65 °C , followed by 0,1x SSC, 0,1 % SDS, 65 °C (high stringency conditions), or a nucleic acid sequence encoding for an amino acid sequence having at least 80% identity with SEQ ID NO.: 8 and which amino acid sequence shows crtW activity; or is SEQ ID NO.: 9, or is a nucleic acid sequence having at least 80% identity as set forth with SEQ ID NO.: 9, or a nucleic acid sequence that hybridizes with the complement of a nucleic acid sequence according to SEQ ID NO.: 9 under the following hybridization conditions: 0,1 x SSC, 0,1 % SDS, 65 °C and wash conditions 2x SSC, 0,1 % SDS, 65 °C , followed by 0,1 x SSC, 0,1 % SDS, 65 °C (high stringency conditions), or a nucleic acid sequence encoding for an amino acid sequence having at least 80% identity with SEQ ID NO.: 10 and which amino acid sequence shows crtW activity.
A further preferred embodiment refers to a process according to the invention, wherein the crtW-protein is of SEQ ID NO.: 2, 4, 6 or 8.
A further preferred embodiment refers to a process according to the invention, wherein said recombinant C. glutamicum comprises a nucleic acid sequence encoding for a promotor 1 which is operatively linked to a crtZ Fp -nucleic acid sequence according to claim 2 or claim 3.
A further preferred embodiment refers to a process according to the invention, wherein said recombinant C. glutamicum comprises a nucleic acid sequence encoding for a promotor 2 which is operatively linked to a crtW F p-, crtW B a-, or crtW Sa -nucleic acid sequence according to claim 4 or 5.
A further preferred embodiment refers to a process according to the invention, wherein the promotor 1 and the promotor 2 are not induced by the same inducing compound.
A further preferred embodiment refers to a process according to the invention, wherein promotor 2 is a constitutively expressing promotor.
A further preferred embodiment refers to a process according to the invention, wherein induction of promotor activity of promotor 1 and induction of promotor activity of promotor 2 occur at different times. A further preferred embodiment refers to a process according to the invention, wherein induction of promotor activity of promotor 1 occurs at the beginning of the cultivation, in the exponential growth phase within the first 6 hours.
A further preferred embodiment refers to a process according to the invention, wherein promotorl and promotor 2 are constitutively expressing promotors.
A further preferred embodiment refers to a process according to the invention, wherein said recombinant C. glutamicum produces L-lysine.
A further preferred embodiment refers to a process according to the invention, wherein said recombinant C. glutamicum is GRLyslAsugRAIdhA. In one embodiment, said recombinant C. glutamicum is LYS as described herein. In a further embodiment, said recombinant C. glutamicum includes the genetic modifications of GRLyslAsugRAIdhA.
A further preferred embodiment refers to a process according to the invention, wherein said recombinant C. glutamicum comprises the following modifications: deletion of sugR and deletion of LdhA, deletion of crtR insertion of crtEBI deletion of genes crtYe, crtYf and crtEb insertion of crt Y Pa , preferably as Ptuf-crtY Pa , insertion of crtZ Fp , preferably as pECXT99a_crtZ Fp , insertion of crtW Fp , preferably as pSH1 -crtW Fp . In one embodiment, said recombinant C. glutamicum is ASTA LYS as described herein.
Another aspect of the present invention refers to A recombinant C. glutamicum, wherein said recombinant C. glutamicum comprises a crtY-nucleic acid sequence, preferably a crtY Pa - nucleic acid sequence, further comprises a crtZ-nucleic acid sequence, which is not from C. glutamicum, preferably a crtZ Fp -nucleic acid sequence, and further comprises a crtW-nucleic acid sequence, preferably a crtW Fp -, crtW Ba -, or crtW Sa -nucleic acid sequence; more preferably, in the genome of said recombinant C. glutamicum crtR, crtY from C. glutamicum and crtEb were deleted and crtEBI, crtY Pa and at least one recombinant sequence which comprises a nucleic acid sequence encoding for a crtZ-protein, preferably from F. pelagi (crtZ Fp -nucleic acid sequence) and at least one recombinant sequence which comprises a nucleic acid sequence encoding for a crtW-protein, preferably from F. pelagi (crtW Fp -nucleic acid sequence), B.aurantiaca (crtW Ba -nucleic acid sequence) or S. astaxanthinifaciens (crtW Sa -nucleic acid sequence) were introduced.
A preferred embodiment refers to a recombinant C. glutamicum according to the invention, wherein the nucleic acid sequence encoding for a crtZ-protein is a preferred crtZ-protein encoding nucleic acid sequence as described herein and the nucleic acid sequence encoding for a crtW-protein is a preferred crtW-protein encoding nucleic acid sequence as described herein.
A further preferred embodiment refers to a recombinant C. glutamicum comprising the following modifications: deletion of sugR and deletion of LdhA, deletion of crtR insertion of crtEBI deletion of genes crtYe, crtYf and crtEb insertion of crt Y Pa , preferably as Ptuf-crtY Pa , insertion of crtZ Fp , preferably as pECXT99a_crtZ Fp , insertion of crtW Fp , preferably as pSH1 - crtW F p. In one embodiment, said recombinant C. glutamicum is ASTA LYS as described herein.
Definitions
BHT 2, 6-Di-tert-Butyl-4-methylphenol bp base pair
CAGR Compound annual growth rate
CDW Cell dry weight
DMAPP Dimethylallyl pyrophosphate
DNA Desoxyribonucleic acid
DXP 1 -deoxy-D-xylulose-5-phosphate
DXS 1 -deoxy-D-xylulose 5-phosphate synthase e.g. exempli gratia
EAA Essential amino acid
EDTA Ethylenediaminetetraacetate
EMB Ethambutol
FR Flanking region
GAP Glyceraldehyde 3-phosphate
GGPP Geranylgeranyl pyrophosphate
GRAS Generally recognized as safe
HPLC High performance liquid chromatography
IPP Isopentenyl pyrophosphate
IPTG lsopropyl-D-3-thiogalactopyranoside kbp Kilo base pair
MCS Multiple cloning site
MEP Methylerythritol 4-phosphate
MOPS 3-(N-morpholino) propanesulfonic acid
MSG Monosodium glutamate
MVA Mevalonic acid
NADPH Nicotinamide adenine dinucleotide phosphate
OD Optical density
OTC Over-the-counter
PCR Polymerase chain reaction
PKS Protocatechuic acid
PTS Phosphotransferase system rDNA Ribosomal DNA
RNA Ribonucleic acid rpm Revolutions per minute rRNA Ribosomal RNA t Time
TCA Tricarboxylic acid cycle
UV Ultraviolet
Vis Visible
WT Wild type
SugR refers to a nucleic acid sequence encoding for protein SugR which regulates the uptake of the carbon sources glucose, sucrose and fructose by repressing the glycolysis in C. glutamicum (see, e.g., SEQ ID NO: 61 )..
CrtR, also known as marR-type regulator or cg0725, refers to a nucleic acid sequence encoding a putative transcriptional regulator (Pfeiffer et al, 2016) (see, e.g., SEQ ID NO: 37)
CrtEBI refers to a nucleic acid sequence encoding an artificial operon. crtEBI was introduced into organisms according to the invention in form of, e.g., Ptuf-crtEBI (see, e.g., SEQ ID NO: 36), comprising the nucleic acid sequences Tuf, crtE, crtB and crtl (see, e.g., SEQ ID NOs: 29, 30, 32 and 34).
CrtY refers to a nucleic acid sequence encoding a lycopene cyclase [EC 5.5.1.19] from C. glutamicum (see, e.g., SEQ ID NOs: 23 and 25).
CrtYp a refers to a nucleic acid sequence encoding a lycopene cyclase from Pantoea ananatis (see, e.g., SEQ ID NO: 39).
CrtEb refers to a nucleic acid sequence encoding lycopene elongase [EC 2.5.1 .-] (see, e.g., SEQ ID NO: 27).
LdhA refers to a nucleic acid sequence encoding a lactate dehydrogenase [EC 1 .1 .1.27] (see, e.g., SEQ ID NO: 59). CrtB refers to a nucleic acid sequence encoding a phytoene synthase [EC 2.5.1.32] (see, e.g., SEQ ID NO: 32).
CrtW a "crtW-nucleic acid sequence" or "crtW-gene" refers to a nucleic acid sequence encoding for an amino acid sequence having 4,4"-beta-ionone ring ketolase activity (see, e.g., SEQ ID NOs: 3, 5, 7, 9, 1 1 ).
"crtW-protein" refers to a protein having 4,4"-beta-ionone ring ketolase [EC1.14.1 1 .B16] activity (see, e.g., SEQ ID NOs: 4, 6 ,8, 10 and 12). "crtW activity" refers to the ability of an enzyme to catalyze the reaction of zeaxanthin to astaxanthin or/and beta-carotene to canthaxanthin . CrtZ refers to a nucleic acid sequence encoding a β-carotene hydroxylase [EC 1.14.13.129] (see, e.g., SEQ ID NO: 1 , 13, 15, 17).
"crtZ-protein" refers to a protein having 3,3"-beta-ionone ring hydroxylase [EC1.14.13.129] activity (see, e.g., SEQ ID NO: 2, 14, 16, 18). "crtZ activity" refers to the ability of an enzyme to catalyze the reaction of β-carotene to zeaxanthin.
A "crtZ-nucleic acid sequence" or "crtZ-gene" refers to a nucleic acid sequence (see, e.g., SEQ ID NO: 1 , 13, 15, 17) encoding for an amino acid sequence having 3,3"-beta-ionone ring hydroxylase activity.
The term "a" as used herein has the meaning of "one or more" or "at least one". The skilled person understands that in one preferred embodiment, this term refers to "one". As defined herein, "overexpressing" an enzyme may be by any means known in the art, such as by introducing a gene (or put more generally, a nucleic acid molecule comprising a nucleic acid sequence) encoding gen such as crtW or crtZ, e.g. at least one copy of the gene, for example expressed from a stronger or unregulated promoter relative to the native gene, and/or by introducing multiple copies of said gene such as an crtW- or crtZ-encoding nucleic acid molecule /gene. As referred to herein, a strong promoter is one which expresses a gene at a high level, or at least at a higher level than effected by its native promoter. The term "strong promoter" is a term well known and widely used in the art and many strong promoters are known in the art, or can be identified by routine experimentation. The use of a non-native promoter may advantageously have the effect of relieving a gene such as the crtW- or crtZ- encoding gene of transcriptional repression, as at least some of any repressive elements will be located in the native promoter region. By replacing the native promoter with a non-native promoter devoid of repressive elements responsive to the effects of pathway products, the gene, such as crtW- or crtZ-encoding gene, will be at least partly relieved of transcriptional repression.
A sequence is "operatively linked" to a promotor sequence (promotor) (or vice versa) when the expression of said gene is triggered/controlled by said promotor.
The term "overproduction" refers to the production of a recombinant protein, which is based on the overexpression of the corresponding, said protein encoding recombinant nucleotide sequence.
Recombinant nucleotide sequence as used herein are nucleotide sequences formed by laboratory methods of genetic recombination (such as molecular cloning) to bring together genetic material from multiple sources, creating sequences that would not otherwise be found in the genome. The term "recombinant" in connection with proteins refers to proteins of which said protein encoding sequences are part of a recombinant nucleotide sequence.
A "recombinant gram-positive bacterium" as used herein refers to a gram-positive bacterium which comprises a recombinant nucleotide sequence comprising at least one crtZ-nucleic acid sequence and at least one crtW-nucleic acid sequence. Notably, said sequences in the recombinant sequence can originate from the genome of the recombinant host cell or can originate from the genome of a different bacterium.
It is understood that all embodiments of the present invention can be combined as long as such a combination does not contradict any law of nature. Of course, such combinations are excluded.
Sequences
SEQ ID NO.: 1 - a crtZ-encoding nucleic acid sequence from F. pelagi (a crtZ Fp -gene):
ATGACGATCTGGACTCTCTACTACGTCTGTCTCACCCTCGTCACGATCGGTTTGATG GA GGTTTATGCATGGTGGGCGCACAAGTTCATCATGCATGGCAAATTCGGTTGGGGCTGG CATAAGTCCCACCACGAGGAAACCGAAGGGTGGTTCGAGAAGAACGATCTCTACGCTG TCGTTTTCGCCGGCTTCGCGATAGCGCTGTTCATGGTCGGACATTTCCTTTCTCCGACC CTGCTCGCCATCGCCTGGGGCATCACGCTTTACGGATTACTCTACTTCGTTGCCCATGA TGGACTTGTCCATCAGCGCTGGCCGTTCAACTACGTGCCGCATCGAGGTTATGCAAAAC GCCTGGTTCAAGCTCATCGTCTGCACCATGCGGTGGAAGGCCGCGAGCACTGCGTCTC GTTCGGCTTTCTCTATGCGCCGCCGATTGAAAAGCTGAAGCGCGATTTGCGTGAGTCC GGAATTCTCGAACGGGAGCGCATCGAGCGGTCTCTGGACCAGCAAGGCTCCGCCCAC GCGCCGGTTCGGTAA SEQ ID NO.: 2 - a crtZ-protein from F. pelagi encoded by SEQ ID NO.: 1 (a crtZ F p-protein):
MTIWTLYYVCLTLVTIGLMEVYAWWAHKFIMHGKFGWGWHKSHHEETEGWFEKNDLY AW FAGFAIALFMVGHFLSPTLLAIAWGITLYGLLYFVAHDGLVHQRWPFNYVPHRGYAKRLV QA HRLHHAVEGREHCVSFGFLYAPPIEKLKRDLRESGILERERIERSLDQQGSAHAPVR *
SEQ ID NO.: 3 - a crtW-encoding nucleic acid sequence from F. pelagi (a crtW1 F -gene):
ATGACCCTCAGCCCAACCTCACGCCTGATCCCGGCAAGTGCGTTACCGCGATCCACA C CCGCCGACTCACCCAAAATCAGACCCTACCAAACGACGATTGGCCTGACGCTCTGTGC CGTGCTGCTGGCATCGTGGTTCGCAATACACGTCTCAGCGATATTCTTCCTCGACATCA ATTTCAGCACGTTGCCTCTCGCACCATTGATCACGGTGTTCCAGTGCTGGTTGACGGTG GGGCTTTTCATCCTGGCTCACGACGCCATGCATGGTTCGCTGGCGCCGGGTCGAACGC GTTTGAATGCCGTAATCGGCGGGTTCATCCTGTTCGTCTACGCGGGATTTGCGTGGAAA AAG AT C AG AG ATG CTC ACTTC G C AC AC C AC G AC G C AC C C G GTAC AC C G G C C G AC C C G G ATTTCTACGCAGATGATCCGGAGAATTTCTGGCCTTGGTTCGGCACCTTCTTCTCACGTT ATTTCGGATGGAGATCGGTCGCATTCGTCTCGACCGTCGTGACGTTTTATCTCGTCATA CTGGATGCATCTGTGACGAACGTGGTTCTATTTTACGGCTTGCCGTCACTGCTTTCGTC ATTGCAGCTCTTCTACTTCGGAACCTACCGCCCGCATCGACACGAAGAATCGGGCACCT TTGCCGACGCGCATAACACACGTTCGAGCGAATTCGGTTACGTGGCCTCGCTATTCTCC TGCTTCCATTTTGGCTACCACCATGAGCACCATTTGGCGCCATGGACGCCTTGGTGGGC TCTGCCGCATACTCGCCAGTCCTAA SEQ ID NO.: 4 - a crtW-protein from F. pelagi encoded by SEQ ID NO.: 3 (a crtW1 Fp - protein):
MTLSPTSRLIPASALPRSTPADSPKIRPYQTTIGLTLCAVLLASWFAIHVSAIFFLD INFSTLPLA
PLITVFQCWLTVGLFILAHDAMHGSLAPGRTRLNAVIGGFILFVYAGFAWKKIRDAH FAHHDA
PGTPADPDFYADDPENFWPWFGTFFSRYFGWRSVAFVSTWTFYLVILDASVTNVVLF YGL
PSLLSSLQLFYFGTYRPHRHEESGTFADAHNTRSSEFGYVASLFSCFHFGYHHEHHL APWT
PWWALPHTRQS *
SEQ ID NO.: 5 - another crtW-encoding nucleic acid sequence from F. pelagi (a crtW2 Fp - gene):
ATGAGACCCTACCAAACGACGATTGGCCTGACGCTCTGTGCCGTGCTGCTGGCATCG T GGTTCGCAATACACGTCTCAGCGATATTCTTCCTCGACATCAATTTCAGCACGTTGCCTC TCGCACCATTGATCACGGTGTTCCAGTGCTGGTTGACGGTGGGGCTTTTCATCCTGGCT CACGACGCCATGCATGGTTCGCTGGCGCCGGGTCGAACGCGTTTGAATGCCGTAATCG GCGGGTTCATCCTGTTCGTCTACGCGGGATTTGCGTGGAAAAAGATCAGAGATGCTCAC TTCGCACACCACGACGCACCCGGTACACCGGCCGACCCGGATTTCTACGCAGATGATC
CGGAGAATTTCTGGCCTTGGTTCGGCACCTTCTTCTCACGTTATTTCGGATGGAGAT CG
GTCGCATTCGTCTCGACCGTCGTGACGTTTTATCTCGTCATACTGGATGCATCTGTG AC
GAACGTGGTTCTATTTTACGGCTTGCCGTCACTGCTTTCGTCATTGCAGCTCTTCTA CTT
CGGAACCTACCGCCCGCATCGACACGAAGAATCGGGCACCTTTGCCGACGCGCATAA C
ACACGTTCGAGCGAATTCGGTTACGTGGCCTCGCTATTCTCCTGCTTCCATTTTGGC TA
CCACCATGAGCACCATTTGGCGCCATGGACGCCTTGGTGGGCTCTGCCGCATACTCG C
CAGTCCTAA
SEQ ID NO.: 6 - another crtW-protein from F. pelagi encoded by SEQ ID NO.: 5 (a crtW2 Fp - protein):
MRPYQTTIGLTLCAVLLASWFAIHVSAIFFLDINFSTLPLAPLITVFQCWLTVGLFI LAHDAMHG SLAPGRTRLNAVIGGFILFVYAGFAWKKIRDAHFAHHDAPGTPADPDFYADDPENFWPWF G TFFSRYFGWRSVAFVSTVVTFYLVILDASVTNVVLFYGLPSLLSSLQLFYFGTYRPHRHE ES GTFADAHNTRSSEFGYVASLFSCFHFGYHHEHHLAPWTPWWALPHTRQS *
SEQ ID NO.: 7 - a crtW-encoding nucleic acid sequence from B. aurantiaca (a crtW Ba -gene):
ATGACCGCCGCCGTCGCCGAGCCACGCACCGTCCCGCGCCAGACCTGGATCGGTCTG ACCCTGGCGGGAATGATCGTGGCGGGATGGGCGGTTCTGCATGTCTACGGCGTCTATT TTCACCGATGGGGGCCGTTGACCCTGGTGATCGCCCCGGCGATCGTGGCGGTCCAGA CCTGGTTGTCGGTCGGCCTTTTCATCGTCGCCCATGACGCCATGCACGGCTCCCTGGC GCCGGGACGGCCGCGGCTGAACGCCGCAGTCGGCCGGCTGACCCTGGGGCTCTATG CGGGCTTCCGCTTCGATCGGCTGAAGACGGCGCACCACGCCCACCACGCCGCGCCCG GCACGGCCGACGACCCGGATTTTCACGCCCCGGCGCCCCGCGCCTTCCTTCCCTGGTT CCTGAACTTCTTTCGCACCTATTTCGGCTGGCGCGAGATGGCGGTCCTGACCGCCCTG GTCCTGATCGCCCTCTTCGGCCTGGGGGCGCGGCCGGCCAATCTCCTGACCTTCTGG GCCGCGCCGGCCCTGCTTTCAGCGCTTCAGCTCTTCACCTTCGGCACCTGGCTGCCGC ACCGCCACACCGACCAGCCGTTCGCCGACGCGCACCACGCCCGCAGCAGCGGCTACG GCCCCGTGCTTTCCCTGCTCACCTGTTTCCACTTCGGCCGCCACCACGAACACCATCTG AGCCCCTGGCGGCCCTGGTGGCGTCTGTGGCGCGGCGAGTCTTGA
SEQ ID NO.: 8 - a crtW-protein from B. aurantiaca a (crtW Ba -protein): MTAAVAEPRTVPRQTWIGLTLAGMIVAGWAVLHVYGVYFHRWGPLTLVIAPAIVAVQTWL S VGLFIVAHDAMHGSLAPGRPRLNAAVGRLTLGLYAGFRFDRLKTAHHAHHAAPGTADDPD F HAPAPRAFLPWFLNFFRTYFGWREMAVLTALVLIALFGLGARPANLLTFWAAPALLSALQ LF TFGTWLPHRHTDQPFADAHHARSSGYGPVLSLLTCFHFGRHHEHHLSPWRPWWRLWRG ES *
SEQ ID NO.: 9 - a crtW-encoding nucleic acid sequence from S. astaxanthinifaciens (a crtWsa-gene):
ATGGCCCCCATGCTCAGTGACGCGCAGCGCCGCCGCCAGGCGATGATCGGGCTCGGC CTCGCCGCCGCGATCACCGCCGCCTTCGTCGCGCTGCATGTCTGGTCGGTCTTCTTCC TGCCGCTCGAGGGCGCGGGCTGGTGGCTCGCGCTGCCGATCGTCGCGGTGCAGACCT GGCTCAGCGTCGGCCTGTTCATCGTCGCGCATGACGCGATGCACGGCAGCCTCGCGC CGGGCCGCCCGGCGACCAACCTCTTCTGGGGGCGGCTGACGCTGCTGCTCTACGCGG GCTTCTGGTTGGACCGCCTTTCGCCCAAGCATTTCGACCACCACCGCCATGTCGGGAC CGAGCGCGATCCCGATTTCTCGGTCGATCATCCGACCCGCTTCTGGCCCTGGTATTATG CCTTCATGCGGCGCTATTTCGGGCTTCGCGAATATCTGGTGCTGAACGCGCTGGTGCT GGCCTACGTGCTGGTGCTGAAGGCGCCGCTCGGCAATCTGCTCCTGTTCTGGGCGCTG CCCTCGATCCTGTCCTCGATCCAGCTCTTCTATTTCGGCACCTACCTTCCGCACCGGCA CGAGGACGCGCCCTTCGCCGACCAGCACAATGCCCGCAGCAACGACTTTCCGGTCTG GCTGTCGCTGCTGACCTGCTTCCACTTCGGCTATCACCGCGAGCATCACCTCAGCCCC GGCACCCCCTGGTGGCAGCTGCCCCGGCGGCGGCGCGAGCTTGCGCTTCCCGCCTAA
SEQ ID NO.: 10 - a crtW-protein from S. astaxanthinifaciens (a crtW Sa -protein):
MAPMLSDAQRRRQAMIGLGLAAAITAAFVALHVWSVFFLPLEGAGWWLALPIVAVQT WLSV GLFIVAHDAMHGSLAPGRPATNLFWGRLTLLLYAGFWLDRLSPKHFDHHRHVGTERDPDF S VDHPTRFWPWYYAFMRRYFGLREYLVLNALVLAYVLVLKAPLGNLLLFWALPSILSSIQL FYF GTYLPHRHEDAPFADQHNARSNDFPVWLSLLTCFHFGYHREHHLSPGTPWWQLPRRRRE LALPA *
SEQ ID NO.: 1 1 - a crtW-encoding nucleic acid sequence from Brevundimonas bacteroides (a crtW Bb -gene):
ATGACGCGGGAACGCCAGACCGTCGTCGGCCTGACGCTGGCCGCCGTCATCGTGGGC GGCTGGATGACGCTGCACGTCTGGGGCGTGTTCTTTCAGCCGCTGTCGGGAACAGCG CTGTTCGTGGTCCCGCTGCTGATCCTGACCCAGAGCTGGCTCGGTGCGGGCATGTTCA TCGTCGCCCATGACGCCATGCACGGTTCACTGGCCCCCGGTCGCCCCCGCCTCAACG CCGTGATCGGCCAGATCTGCGTCGGGGCCTATGCGGCCTTCTCGTATCGCAAGCTGAA CGTCTGCCACCACCAGCACCACCGCGCGCCGGGCACGGCCGAGGACCCCGACTTCCA TGCCGAGCGGCCCGAGGCCTTCCTGCCGTGGTTCTATGGCTTCTTCACCCGATACTTC GGCTGGCGCGAGTTCACGATCGTGACGGCGGTGCTGATCGCCTATCTGCTGATCGGG GCGACGGTGGTGAACCTGATCCTGTTCTGGGCCGTGCCCGCGGTCCTCAGTGCGCTC
CAGCTGTTCGTGTTCGGGACCTGGCTGCCGCATCGGCATACGGCGGGCGACGGGTTC
GCGGATCATCACCATGCGCGGACGATCCCGATGCCGTGGGTCGCGTCGCTTCTGGCC T
GCTTCCACTTCGGAATGCATCACGAGCACCACCTGACGCCAGCCGCGCCTTGGTGGA G
ACTGCCTGAGGTTCGAAAGGCTATGCTGGCGCGTAGCGAACGTCTCTAA
SEQ ID NO.: 12 - a crtW-protein from B. bacteroides encoded by SEQ ID NO.: 1 1 (a crtW Bb - protein):
MTRERQTVVGLTLAAVIVGGWMTLHVWGVFFQPLSGTALFWPLLILTQSWLGAGMFI VAH DAMHGSLAPGRPRLNAVIGQICVGAYAAFSYRKLNVCHHQHHRAPGTAEDPDFHAERPEA FLPWFYGFFTRYFGWREFTIVTAVLIAYLLIGATVVNLILFWAVPAVLSALQLFVFGTWL PHR HTAGDGFADHHHARTIPMPWVASLLACFHFGMHHEHHLTPAAPWWRLPEVRKAMLARSE RL *
SEQ ID NO.: 13 - a crtZ-encoding nucleic acid sequence from B. bacteroides (a crtZ Bb -gene):
ATGACGATCGTCTGGTTCACCCTGCTGACGCTGGCCGTCTTCTTCCTCATGGAAGGG GT CGCCTGGACAACGCACCGCTACATCATGCATGGGCCGCTCGGCTGGGGCTGGCACCG CGATCACCATGAGCCGCACGACAAGACCTTCGAGGTCAACGACCTCTATGGCGTGGTC GGGGCCGTGGTCGGGACCGGTCTGTTCGTCGTCGCCTGGTTGACGGACCTTTGGTGG GTGCGGGCGACCGCACTGGGCGTCACGCTGTACGGCGTGGTCTACGCCTTCGTGCAC GACGGCCTGGTGCACCAGCGATGGCCGTTCCACTGGATGCCGAAGAACGGTTATGCG CGGAGGCTGGTTCAGGCGCACAAGCTGCATCACGCGGTTCAGACGCGCGATGGGGCC GTGTCGTTCGGCTTCGTCTTCGCGCCAAACCCCCAGCGGCTCAGCGCCATCCTGAAGG CGCGCCGGGCAGAGCGCGCCGCGACGGACATCCCGGCCGAGTAA
SEQ ID NO.: 14 - a crtZ-protein from B. bacteroides encoded by SEQ ID NO.: 13 (a crtZ Bb - protein):
MTIVWFTLLTLAVFFLMEGVAWTTHRYIMHGPLGWGWHRDHHEPHDKTFEVNDLYGV VGA VVGTGLFVVAWLTDLWWVRATALGVTLYGVVYAFVHDGLVHQRWPFHWMPKNGYARRLV QAHKLHHAVQTRDGAVSFGFVFAPNPQRLSAILKARRAERAATDIPAE *
SEQ ID NO.: 15 - a crtZ-encoding nucleic acid sequence from S. astaxanthinifaciens (a crtZs a -gene): ATGTCCTGGCCTGCCGGTCTCGCCCTGTTCGTATCGACGGTCCTTCTGATGGAGGGCT TCGCCTATGTCCTCCACCGCTTCGTGATGCACTCGCGGCTCGGCTGGAACTGGCACGA AAGCCATCATCGCGCGCGGACCGGCTGGTTCGAGCGGAACGACCTCTATGCCGTGGT CTTCGCTTTGCCCTCGATCCTGCTGATCTGGGGCGGGCTCAATGGCGGCTGGGGCGAC
TGGGCGACGTGGATGGGGGCCGGGGTGGCCTTCTACGGGGTGATCTATTTCGGCTTT C
ACGACGTCATCGTCCACGGCCGGCTGCCGCACCGGATCGTGCCGCGTTCGACCTATT T
CAAGCGGATCGTCCAGGCGCACAAGCTGCACCATGCGGTCGAGAGCCGCGACGGGGC
GGTGAGCTTCGGCTTCCTTTACGCCCCGCCGGTCGAGCGGCTGAAGCAGGCGCTCCA
GGCCAGCCGCGAGGCGCAGCTCAGGCGTGCGCGGGGCGGGTCCACAGCCCGTCACG
AGGAGCGGGCCTAA
SEQ ID NO.: 16 - a crtZ-protein from S. astaxant inifaciens encoded by SEQ ID NO.: 15 (a crtZS a -protein): MSWPAGLALFVSTVLLMEGFAYVLHRFVMHSRLGWNWHESHHRARTGWFERNDLYAWF ALPSILLIWGGLNGGWGDWATWMGAGVAFYGVIYFGFHDVIVHGRLPHRIVPRSTYFKRI VQ AHKLHHAVESRDGAVSFGFLYAPPVERLKQALQASREAQLRRARGGSTARHEERA *
SEQ ID NO.: 17- a crtZ-encoding nucleic acid sequence from B. vesicularis (a crtZ Bv -gene):
ATGTCCTGGCCGACGATGATCCTGCTGTTTCTCGCCACCTTCCTGGGGATGGAGGTC TT CGCCTGGGCGATGCATCGCTATGTCATGCACGGCCTGCTGTGGACCTGGCACCGTAGC CACCATGAGCCGCACGACGACGTGCTGGAAAAGAACGACCTGTTCGCCGTGGTGTTCG CCGCCCCGGCCATCATCCTCGTCGCCTTGGGCCTGCATCTGTGGCCTTGGGCGCTGCC GATCGGCCTGGGCGTCACGGCCTATGGACTGGTCTATTTCTTCTTCCACGACGGGCTG GTGCATCGCCGGTTCCCGACGGGAATCGCGGGCCGCTCAGGGTTCTGGACGCGGCGC ATTCAGGCCCACCGGCTGCATCACGCGGTGCGGACGCGTGAGGGCTGCGTGTCGTTC GGCTTCCTGTGGGTGCGGTCGGCGCGCGCGCTGAAGGCCGAACTGTCTCAGAAGCGC GGCGCTTCCAGCAACGGCGCCTAA
SEQ ID NO.: 18 - a crtZ-protein from B. vesicularis encoded by SEQ ID NO.: 17 (a crtZ Bv - protein):
MSWPTMILLFLATFLGMEVFAWAMHRYVMHGLLWTWHRSHHEPHDDVLEKNDLFAVV FAA PAIILVALGLHLWPWALPIGLGVTAYGLVYFFFHDGLVHRRFPTGIAGRSGFWTRRIQAH RLH HAVRTREGCVSFGFLWVRSARALKAELSQKRGASSNGA *
SEQ ID NO.: 19 - a crtW1 -encoding nucleic acid sequence from B. vesicularis (a crtW1 Bv - gene): ATGGGGCAAGCGAACAGGATGCTTACGGGGCCGCGATGCGCTAAGTGTCGCGCCATG TTCGCCGTCACGCCAATGTCACGGGTCGTCCCGAACCAGGCCCTGATCGGCCTGACGC TGGCTGGCCTGATCGCCGCGGTCTGGCTGACCCTGCACATCTACGGCGTCTATTTTCAT CGCTGGACGATCTGGAGCATCCTGACCGTTCCGCTGATCGTCGCCGTCCAGACCTGGC TATCCGTCGGCCTGTTCATCGTCGCCCACGACGCCATGCACGGCTCGCTGGCCCCGG GACGCCCACGGCTGAACACGGCGATCGGCAGCCTGGCGCTGGCCCTCTACGCCGGAT TTCGGTTCGCGCCTTTGAAGATCGCACACCACGCCCATCACGCTGCGCCTGGTACGGC GGACGATCCCGACTTTCACGCCGACGCCCCGCGCGCTTTCCTGCCCTGGTTCTACGGC TTTTTCCGCACCTATTTCGGCTGGCGAGAACTGGCCGTTCTGACGGTGCTCGTGGCCG TTGCGGTGCTGATCCTCGGCGCCCGCGTGCCCAATCTTCTGGCCTTTTGGGCCGCGCC CGCCCTGCTATCGGCGCTACAGCTTTTCACATTCGGAACCTGGCTGCCTCACAGGCATA CCGACGACGCTTTCCCCGACCACCACAACGCCCGCACCAGCCCCTTCGGCCCGGTCCT GTCGTTGCTCACCTGCTTCCACTTCGGCCGCCACCACGAACACCTCCTGACCCCCTGG AAGCCCTGGTGGAGTTTGTTCAGCTAG
SEQ ID NO.: 20 - a crtW1 -protein from B. vesicularis encoded by SEQ ID NO.: 19 (a crtW1 B v-protein):
MGQANRMLTGPRCAKCRAMFAVTPMSRVVPNQALIGLTLAGLIAAVWLTLHIYGVYF HRWT
IWSILTVPLIVAVQTWLSVGLFIVAHDAMHGSLAPGRPRLNTAIGSLALALYAGFRF APLKIAH
HAHHAAPGTADDPDFHADAPRAFLPWFYGFFRTYFGWRELAVLTVLVAVAVLILGAR VPNL
LAFWAAPALLSALQLFTFGTWLPHRHTDDAFPDHHNARTSPFGPVLSLLTCFHFGRH HEHL
LTPWKPWWSLFS *
SEQ ID NO.: 21 - a crtW2-encoding nucleic acid sequence from B. vesicularis (a crtW2Bv- gene):
ATGCGGCAAGCGAACAGGATGCTTACGGGGCCGCGATGCGCTAAGTGTCGCGCCATG TTCGCCGTCACGCCAATGTCACGGGTCGTCCCGAACCAGGCCCTGATCGGCCTGACGC TGGCTGGCCTGATCGCCGCGGTCTGGCTGACCCTGCACATCTACGGCGTCTATTTTCAT CGCTGGACGATCTGGAGCATCCTGACCGTTCCGCTGATCGTCGCCGTCCAGACCTGGC TATCCGTCGGCCTGTTCATCGTCGCCCACGACGCCATGCACGGCTCGCTGGCCCCGG GACGCCCACGGCTGAACACGGCGATCGGCAGCCTGGCGCTGGCCCTCTACGCCGGAT TTCGGTTCGCGCCTTTGAAGATCGCACACCACGCCCATCACGCTGCGCCTGGTACGGC GGACGATCCCGACTTTCACGCCGACGCCCCGCGCGCTTTCCTGCCCTGGTTCTACGGC TTTTTCCGCACCTATTTCGGCTGGCGAGAACTGGCCGTTCTGACGGTGCTCGTGGCCG TTGCGGTGCTGATCCTCGGCGCCCGCGTGCCCAATCTTCTGGCCTTTTGGGCCGCGCC CGCCCTGCTATCGGCGCTACAGCTTTTCACATTCGGAACCTGGCTGCCTCACAGGCATA CCGACGACGCTTTCCCCGACCACCACAACGCCCGCACCAGCCCCTTCGGCCCGGTCCT GTCGTTGCTCACCTGCTTCCACTTCGGCCGCCACCACGAACACCTCCTGACCCCCTGG AAGCCCTGGTGGAGTTTGTTCAGCTAG SEQ ID NO.: 22 - a crtW1 -protein from B. vesicularis encoded by SEQ ID NO.: 19 (a crtWI Bv-protein):
MRQANRMLTGPRCAKCRAMFAVTPMSRWPNQALIGLTLAGLIAAVWLTLHIYGVYFH RWTI WSILTVPLIVAVQTWLSVGLFIVAHDAMHGSLAPGRPRLNTAIGSLALALYAGFRFAPLK IAHH AHHAAPGTADDPDFHADAPRAFLPWFYGFFRTYFGWRELAVLTVLVAVAVLILGARVPNL L AFWAAPALLSALQLFTFGTWLPHRHTDDAFPDHHNARTSPFGPVLSLLTCFHFGRHHEHL L T PWKPWWSLFS *
SEQ ID NO: 23 - a crtYe encoding nucleic acid sequence from C. glutamicum (a crtYe-gene) ttgatccctatcatcgatatttcacaaaatgagcaagatagcgatatttttatggccttt atttatctaggtactctcctagttctcattgggt gcatggctttgtgcgaccaccgttggaagctagcgttcttccgccatccgttacgagcaa ttctttcggtaggtgctgcatatattggat ttcttttatgggatatatttggcattattactggcactttttatcgcggagactcagcgt ttatgtccggtattaaccttgcaccccatatgcc cattgaagaactttttttcttattcttcctctgctacatcaccctcaaccttacctcggc agcagcattatggcttaaagcaccactgccta aaaaacccggtaaaaagtctcccctcacaccacagcgcgatactttccaaccaactacca ctcccgaggttgaaccatga
SEQ ID NO: 24 - a crtYe-protein from C. glutamicum (a crtYe-protein)
Ml PI I DISQN EQDSDI FMAFI YLGTLLVLIGCMALCDH RWKLAFFRH PLRAI LSVGAAYI GFLLW DIFGIITGTFYRGDSAFMSGINLAPHMPIEELFFLFFLCYITLNLTSAAALWLKAPLPKK PGKKS PLTPQRDTFQPTTTPEVEP
SEQ ID NO: 25 - a crtYf encoding nucleic acid sequence from C. glutamicum (a crtYf-gene)
Atgacttatatttttataagcattccttttttagcaatagccatggtcctatttgtc ttaaagctgcagtctggaacacctaaacttttacca atcaccgctgtcagtgcccttaccctatgttccctaactatcatatttgataacctcatg gtttgggctgatctctttggatatggcgatac ccagcaccttggcatttggctcggtttaatccccctagaggatcttttctatccgctctt cgcagtacttctgattcctgccctatggttgcc tggaaatatgtttaaacgcaggaaaaaacgtccacaccattccttacccaccatcgccaa tggaagcatcactactagatccacc accacgcaatctgagccagaaaagccgtag
SEQ ID NO: 26 - a crtYf-protein from C. glutamicum (a crtYf-protein)
MTYIFISIPFLAIAMVLFVLKLQSGTPKLLPITAVSALTLCSLTIIFDNLMVWADLF GYGDTQHLG IWLGLIPLEDLFYPLF
SEQ ID NO: 27 - a crtEb encoding nucleic acid sequence from C. glutamicum (a crtEb-gene)
Atgatggaaaaaataagactaattctattgtcatctcgccccattagctggatcaat accgcctacccctttggtctggcctacctatt aaatgcaggagagattgactggctgttttggctaggcatcgtattttttcttatcccgta taacatcgccatgtatggtatcaacgatgttt ttgattacgaatctgatatgcgtaatccccgcaaaggcggcgtcgagggggccgtgctac cgaaaagttcccacagcacactgtt atgggcctcggctatctcaacaattcctttcctagttattcttttcatatttggcacctg gatgtcgtctttatggctgacactctcagtgcta gcagtgattgcttattcagcaccgaaattgcgttttaaagaacgcccctttatcgatgct ctaacatcttctactcacttcacttcacctg cattaatcggtgcaacgatcactggaacatctccttcagcagcgatgtggatagcactgg gatcctttttcttgtggggcatggccag tcagatccttggagcagtacaggatgttaatgcagaccgggaagctaatctgagctcaat tgccactgtaattggggcgcgtgga gccattcggctttcagtagtactttatttactagctgctgtgttagtcactactttgcct aatccggcgtggatcatcgggattgcgattcta acttacgtatttaatgccgcacgattttggaacattacagatgccagttgtgaacaggct aatcgcagttggaaagttttcctgtggct gaactactttgttggtgctgtgataacgatactgctaatagcaattcatcagatataa
SEQ ID NO: 28 - a crtEb-protein from C. glutamicum (a crtEb-protein)
MMEKIRLILLSSRPISWINTAYPFGLAYLLNAGEIDWLFWLGIVFFLIPYNIAMYGI NDVFDYES DMRNPRKGGVEGAVLPKSSHSTLLWASAISTIPFLVILFIFGTWMSSLWLTLSVLAVIAY SAP KLRFKERPFIDALTSSTHFTSPALIGATITGTSPSAAMWIALGSFFLWGMASQILGAVQD VNA DREAN LSSIATVIGARGAIRLSVVLYLLAAVLVTTLPNPAWIIGIAILTYVFNAARFWNITDASC E QANRSWKVFLWLNYFVGAVITILLIAIHQI
SEQ ID NO: 29 - a TUF promotor C. glutamicum
TGGCCGTTACCCTGCGAATGTCCACAGGGTAGCTGGTAGTTTGAAAATCAACGCCGT TG CCCTTAGGATTCAGTAACTGGCACATTTTGTAATGCGCTAGATCTGTGTGCTCAGTCTTC CAGGCTGCTTATCACAGTGAAAGCAAAACCAATTCGTGGCTGCGAAAGTCGTAGCCACC ACGAAGTCCAGGAGGACATACA
SEQ ID NO: 30 - a crtE encoding nucleic acid sequence from C. glutamicum (a crtE-gene) Atggacaatggcatgacaatcaccacagaacattcaactcatcctgatcttgatttcaat gatgagatttatcgggaactaaaccg catctgcgcttcgctatctcaacagtgcagcacatatcaaccagagttccgtacctgcct agatgctgctttccaagctttgcgaggt ggcaagttaatccgccctcgaatgctactggggctatacaacacgcttgtagacgatgac attgaggtcaaactcaacaccgtttt acaggtagcagtggctttagaactactgcatttttcccttttggttcatgacgatgttat tgacggagacctctatcgccgaggcaaact taattttattgggcagattctcatgcatcgcacacctgaaagttttgcacaaatccagcg cgatccagagcatctagattgggcaca atctaatggactgcttatgggaaatctttttcttgctgccacccatcaaatcttcgcgcg ccttgaccttccacatcaccaacgggttcg acttttagatttactcaaccacacgataaatgacactattgtgggtgagtttcttgatgt gggattaagcagcaaagccatcagcccc aatatggacattgctctagaaatgagtcggctaaaaacagccacatacacttttgaactt ccaatgagagcagcggcaattctcgc ggaactacctcaggagattgaaacaaagataggtgagataggcacaaacttgggcatcgc ttatcaattgcaggacgattactta tctacttttggtgacgcagccgaacacggcaaagatgccttttctgaccttcgagaagga aaagaaactacaattatcgccttcgct cgagatactgctaaatggactgatattcaagacaacttcggctccgcagatctgagcacc tctcaggcagagcgaattcaacatc ttctcatacagtgtggagcaaagaatcactccttgaatgccatctccgaccacttaaata tctgccgttcgatgatcaaaacactaa gcccccaggtagatcccaaggctcaaaatttattacttaaacaagttgagcaactagcca gccgcaaatcttag SEQ ID NO: 31 - a crtE-protein from C. glutamicum (a crtE-protein)
MDNGMTITTEHSTHPDLDFNDEIYRELNRICASLSQQCSTYQPEFRTCLDAAFQALR GGKLI
RPRMLLGLYNTLVDDDIEVKLNTVLQVAVALELLHFSLLVHDDVIDGDLYRRGKLNF IGQILM
HRTPESFAQIQRDPEHLDWAQSNGLLMGNLFLAATHQIFARLDLPHHQRVRLLDLLN HTIND
TIVGEFLDVGLSSKAISPNMDIALEMSRLKTATYTFELPMRAAAILAELPQEIETKI GEIGTNLGI
AYQLQDDYLSTFGDAAEHGKDAFSDLREGKETTIIAFARDTAKWTDIQDNFGSADLS TSQAE
RIQHLLIQCGAKNHSLNAISDHLNICRSMIKTLSPQVDPKAQNLLLKQVEQLASRKS
SEQ ID NO: 32 - a crtB encoding nucleic acid sequence from C. glutamicum (a crtB-gene) atgacacaccaaaattcgcctctcttccttaaaagtgcactgagactttacaatcgggcc tcattcaaggcttcacataaagtgatcg aagaatattcgacgagcttcagtctgtctacgtggttgctatccccacgcatacgaaatg acatacgaaatctctatgcagtagttcg tatcgccgatgagattgtcgacggcactgcacatgccgctggttgctcaactgccaaaat cgaagagattctcgatgcctatgaaa ttgcggttcttgcagcaccacaacaacgcttcaacacagatcttgttttacaagcttatg gtgaaactgcccgacgctgtgatttcga acaagagcatgtaatagccttctttgcatcaatgcgtaaggacctcaaagctaatacaca cgacccagatagcttcacaacgtat gtctatggctccgcggaagttataggcctgctttgtctcagcgttttcaaccaaggtaga acgattagcaaaaaacggctagagatt atgcaaaacggagcccgctcattgggagcggcattccagaaaattaactttctccgtgac ttggcagaagatcagcaaaatttgg gccgattttatttccccaaaaccagccaaggaactcttactaaagaacaaaaagaagatc tcatcgctgatatccgtcaagacct agcaattgcccacgatgcatttccagaaataccagtgcaggctcgcatcggagtgatctc tgcttatttgctctttcaaaaactcactg accgaattgaggctactcctaccgccgatttattgcgggagcgaatcagagttccacttc atatcaaactctctacactcgctagag ccacgatgaaaggtctatctatgagcatctacagaaagaattcgtga SEQ ID NO: 33 - a crtB-protein from C. glutamicum (a crtB-protein)
MTHQNSPLFLKSALRLYNRASFKASHKVIEEYSTSFSLSTWLLSPRIRNDIRNLYAW RIADEI
VDGTAHAAGCSTAKIEEILDAYEIAVLAAPQQRFNTDLVLQAYGETARRCDFEQEHV IAFFAS
MRKDLKANTHDPDSFTTYVYGSAEVIGLLCLSVFNQGRTISKKRLEIMQNGARSLGA AFQKI
NFLRDLAEDQQNLGRFYFPKTSQGTLTKEQKEDLIADIRQDLAIAHDAFPEIPVQAR IGVISAY
LLFQKLTDRIEATPTADLLRERIRVPLHIKLSTLARATMKGLSMSIYRKNS
SEQ ID NO: 34 - a crtl encoding nucleic acid sequence from C. glutamicum (a crtl-gene) gtgatgaaggtctcgactaaaactccacgctcctcaggtaccgccgtagtcataggcgca ggtgttgctggtttagccacttctgca cttttagcacgtgatggctggcaagtaactgttttggaaaaaaatactgatgtcggtggc cgagctggatcgcttgaaatatcaggct ttcctggctttcgatgggataccggaccttcttggtacctcatgcccgaggcctttgacc atttcttcgcactttttggtgcatgtacttctg attatctcgatttggtagaattaacgcctggttatcgagttttttctggcacacatgacg ctgtcgatgtccccactgggcgtgaagaag caattgcgctattcgaatccatcgaacccggcgcgggtgcaaaactaggaaattatcttg atagcgcggcagacgcctatgacat tgccattgatagattcctttataataatttctccacgttaggcccgctgcttcaccggga tgtactgacccgagctggccgactgttttct ctactgacccgttctttacaaaagtacgtaaatagtcaattcagtagcccggtgttgcgc cagatcctaacctatccagcagtcttcct gtcttcccgacccactactaccccatcgatgtaccacttgatgagtcataccgatttggt gcagggagtgaaataccctataggtggt tttactgcagtggttaacgctctgcatcagttagcgctggaaaacggggttgagtttcaa ctcgattctgaggtcatttccatcaacact gcttcatcgaggggcaacacaagcgccacaggtgtgagcttgcttcacaacagaaaagtg caaaatctagatgcggatcttgtg gtttcagcaggcgacctacaccatacagaaaataatctgcttccccgggaacttcgaacc tatcccgaacgatattggtccaatcg caatcctggaattggagcggtattaatcctcctgggcgtaaaaggagagttaccccagct cgaccatcacaaccttttcttcagtga agattggacagatgattttgctgtagttttcgacgggcctcaacttacccgcccccacaa tgcatcaaattccatttatgtctccaagc cttcaacgtccgaagacggcgttgcacctgctggatacgaaaacctttttgttttaattc cgaccaaggcctctagcagcatcggcc acggtgatgcgtatatgcagtcggcttcagcatccgtggaaacaatcgcgtcacatgcaa tcaatcaaattgctacgcaagccgg catccctgacctcactgaccgaattgtggtcaaacgcaccattggccctgcggattttga gcaccgctaccattcatgggtaggca gtgcgctgggtccagcacataccctcagacagtccgctttcttaagagggcgcaatagct cccgcaaggtcaataacctcttctatt ccggtgccaccaccgtcccgggtgtaggaatacccatgtgtttaatttctgccgagaata ttattaagcgtttacatgccgataccag tgcaggaccactgcccgaaccattgccgcctaaaacgacaccatctcaaaagacctcata cgatcattaa
SEQ ID NO: 35 - a crtl-protein from C. glutamicum (a crtl-protein)
MMKVSTKTPRSSGTAWIGAGVAGLATSALLARDGWQVTVLEKNTDVGGRAGSLEISG FPG FRWDTGPSWYLMPEAFDHFFALFGACTSDYLDLVELTPGYRVFSGTHDAVDVPTGREEAI A LFESIEPGAGAKLGNYLDSAADAYDIAIDRFLYNNFSTLGPLLHRDVLTRAGRLFSLLTR SLQ KYVNSQFSSPVLRQILTYPAVFLSSRPTTTPSMYHLMSHTDLVQGVKYPIGGFTAWNALH Q LALENGVEFQLDSEVISINTASSRGNTSATGVSLLHNRKVQNLDADLWSAGDLHHTENNL L PRELRTYPERYWSNRNPGIGAVLILLGVKGELPQLDHHNLFFSEDWTDDFAVVFDGPQLT R PHNASNSIYVSKPSTSEDGVAPAGYENLFVLIPTKASSSIGHGDAYMQSASASVETIASH AIN QIATQAGIPDLTDRIWKRTIGPADFEHRYHSWVGSALGPAHTLRQSAFLRGRNSSRKVNN L FYSGATTVPGVGIPMCLISAENIIKRLHADTSAGPLPEPLPPKTTPSQKTSYDH
SEQ ID NO: 36 - an artificial operon Ptuf-crtEBI
TGGCCGTTACCCTGCGAATGTCCACAGGGTAGCTGGTAGTTTGAAAATCAACGCCGT TG CCCTTAGGATTCAGTAACTGGCACATTTTGTAATGCGCTAGATCTGTGTGCTCAGTCTTC CAGGCTGCTTATCACAGTGAAAGCAAAACCAATTCGTGGCTGCGAAAGTCGTAGCCACC ACGAAGTCCAG GAG GACATACAATG G ACAATG G CATG ACAATCACCACAG AACATTCAA CTCATCCTGATCTTGATTTCAATGATGAGATTTATCGGGAACTAAACCGCATCTGCGCTT CGCTATCTCAACAGTGCAGCACATATCAACCAGAGTTCCGTACCTGCCTAGATGCTGCT TTCCAAGCTTTGCGAGGTGGCAAGTTAATCCGCCCTCGAATGCTACTGGGGCTATACAA CACGCTTGTAGACGATGACATTGAGGTCAAACTCAACACCGTTTTACAGGTAGCAGTGG CTTTAGAACTACTGCATTTTTCCCTTTTGGTTCATGACGATGTTATTGACGGAGACCTCT ATCGCCGAGGCAAACTTAATTTTATTGGGCAGATTCTCATGCATCGCACACCTGAAAGTT TTGCACAAATCCAGCGCGATCCAGAGCATCTAGATTGGGCACAATCTAATGGACTGCTT ATGGGAAATCTTTTTCTTGCTGCCACCCATCAAATCTTCGCGCGCCTTGACCTTCCACAT CACCAACGGGTTCGACTTTTAGATTTACTCAACCACACGATAAATGACACTATTGTGGGT
GAGTTTCTTGATGTGGGATTAAGCAGCAAAGCCATCAGCCCCAATATGGACATTGCT CT
AGAAATGAGTCGGCTAAAAACAGCCACATACACTTTTGAACTTCCAATGAGAGCAGC GG
CAATTCTCG CG G AACTACCTCAG G AG ATTGAAACAAAG ATAGGTG AG ATAG G CACAAAC
TTGGGCATCGCTTATCAATTGCAGGACGATTACTTATCTACTTTTGGTGACGCAGCC GAA
CACGGCAAAGATGCCTTTTCTGACCTTCGAGAAGGAAAAGAAACTACAATTATCGCC TT
CGCTCGAGATACTGCTAAATGGACTGATATTCAAGACAACTTCGGCTCCGCAGATCT GA
G CACCTCTCAG G CAGAGC GAATTC AACATCTTCTCATACAGTGTG GAG CAAAGAATC AC
TCCTTGAATGCCATCTCCGACCACTTAAATATCTGCCGTTCGATGATCAAAACACTA AGC C C C C AG GTAG ATC C C AAG G CTC AAAATTTATTACTTAAAC AAGTTG AG C AACTAG C C AG CCGCAAATCTTAGCTGCAGGTCGACTCTAGAGGATCCGAAAGGAGGCCCTTCAGATGA CACACCAAAATTCGCCTCTCTTCCTTAAAAGTGCACTGAGACTTTACAATCGGGCCTCAT TCAAGGCTTCACATAAAGTGATCGAAGAATATTCGACGAGCTTCAGTCTGTCTACGTGG TTGCTATCCCCACGCATACGAAATGACATACGAAATCTCTATGCAGTAGTTCGTATCGCC GATGAGATTGTCGACGGCACTGCACATGCCGCTGGTTGCTCAACTGCCAAAATCGAAG AGATTCTCGATGCCTATGAAATTGCGGTTCTTGCAGCACCACAACAACGCTTCAACACA GATCTTGTTTTACAAGCTTATGGTGAAACTGCCCGACGCTGTGATTTCGAACAAGAGCAT GTAATAGCCTTCTTTGCATCAATGCGTAAGGACCTCAAAGCTAATACACACGACCCAGAT AGCTTCACAACGTATGTCTATGGCTCCGCGGAAGTTATAGGCCTGCTTTGTCTCAGCGT TTTC AAC C AAG GTAG AAC G ATT AG C AAAAAAC G G CTAG AG ATTATG C AAAAC G GAG C C C GCTCATTGGGAGCGGCATTCCAGAAAATTAACTTTCTCCGTGACTTGGCAGAAGATCAG C AAAATTTG G G C C G ATTTTATTTC C C C AAAAC C AG C C AAG G AACTCTTACTAAAG AAC AA AAAGAAGATCTCATCGCTGATATCCGTCAAGACCTAGCAATTGCCCACGATGCATTTCC AGAAATACCAGTG CAG G CTCG CATC GG AGTG ATCTCTGCTTATTTG CTCTTTCAAAAACT CACTGACCGAATTGAGGCTACTCCTACCGCCGATTTATTGCGGGAGCGAATCAGAGTTC CACTTCATATCAAACTCTCTACACTCGCTAGAGCCACGATGAAAGGTCTATCTATGAGCA TCTACAGAAAGAATTCGTGATGAAGGTCTCGACTAAAACTCCACGCTCCTCAGGTACCG CCGTAGTCATAGGCGCAGGTGTTGCTGGTTTAGCCACTTCTGCACTTTTAGCACGTGAT GGCTGGCAAGTAACTGTTTTGGAAAAAAATACTGATGTCGGTGGCCGAGCTGGATCGCT TGAAATATCAGGCTTTCCTGGCTTTCGATGGGATACCGGACCTTCTTGGTACCTCATGC CCGAGGCCTTTGACCATTTCTTCGCACTTTTTGGTGCATGTACTTCTGATTATCTCGATT TGGTAGAATTAACGCCTGGTTATCGAGTTTTTTCTGGCACACATGACGCTGTCGATGTC CCCACTGGGCGTGAAGAAGCAATTGCGCTATTCGAATCCATCGAACCCGGCGCGGGTG CAAAACTAGGAAATTATCTTGATAGCGCGGCAGACGCCTATGACATTGCCATTGATAGA TTCCTTTATAATAATTTCTCCACGTTAGGCCCGCTGCTTCACCGGGATGTACTGACCCGA GCTGGCCGACTGTTTTCTCTACTGACCCGTTCTTTACAAAAGTACGTAAATAGTCAATTC AGTAGCCCGGTGTTGCGCCAGATCCTAACCTATCCAGCAGTCTTCCTGTCTTCCCGACC CACTACTACCCCATCGATGTACCACTTGATGAGTCATACCGATTTGGTGCAGGGAGTGA AATACCCTATAGGTGGTTTTACTGCAGTGGTTAACGCTCTGCATCAGTTAGCGCTGGAA AACGGGGTTGAGTTTCAACTCGATTCTGAGGTCATTTCCATCAACACTGCTTCATCGAG G GG CAACACAAG CG CCAC AG GTGTG AG CTTG CTTCACAACAG AAAAGTG CAAAATCTA GATGCGGATCTTGTGGTTTCAGCAGGCGACCTACACCATACAGAAAATAATCTGCTTCC CCGGGAACTTCGAACCTATCCCGAACGATATTGGTCCAATCGCAATCCTGGAATTGGAG CGGTATTAATCCTCCTGGGCGTAAAAGGAGAGTTACCCCAGCTCGACCATCACAACCTT TTCTTCAGTGAAGATTGGACAGATGATTTTGCTGTAGTTTTCGACGGGCCTCAACTTACC CGCCCCCACAATGCATCAAATTCCATTTATGTCTCCAAGCCTTCAACGTCCGAAGACGG CGTTGCACCTGCTGGATACGAAAACCTTTTTGTTTTAATTCCGACCAAGGCCTCTAGCAG CATCGGCCACGGTGATGCGTATATGCAGTCGGCTTCAGCATCCGTGGAAACAATCGCG TCACATGCAATCAATCAAATTGCTACGCAAGCCGGCATCCCTGACCTCACTGACCGAAT TGTGGTCAAACGCACCATTGGCCCTGCGGATTTTGAGCACCGCTACCATTCATGGGTAG GCAGTGCGCTGGGTCCAGCACATACCCTCAGACAGTCCGCTTTCTTAAGAGGGCGCAA TAGCTCCCGCAAGGTCAATAACCTCTTCTATTCCGGTGCCACCACCGTCCCGGGTGTAG GAATACCCATGTGTTTAATTTCTGCCGAGAATATTATTAAGCGTTTACATGCCGATACCA GTGCAGGACCACTGCCCGAACCATTGCCGCCTAAAACGACACCATCTCAAAAGACCTCA TACGATCATTAA
SEQ ID NO: 37 - a crtR encoding nucleic acid sequence from C. glutamicum (a crtR-gene) ATGCTGAATATGCAGGAACCAGATAAAATCCATCCGGCAGAACCTACACTTCGTAATATT TATGACGTTAAAACTAGTGATCCCAAAAGTGAATTAGTTGATCGTTCTGGCATGTCGGAA GAAGACATTGCGCAAATTGGGCGGCTAATGAAATCGTTGGCCAGTCTTCGCGATGTGG AACGTAGTATTGGTGAAGCCTCGGCACGTTATATGGAGCTAAGTGCCCCTGATATGCGA GCTTTGCACTATTTGATTGTGGCGGGCAATGCGGGCGAAGTGGTGACTCCAGGAATGC TTGGAGCTCACCTTAAGCTTTCCCCGGCATCTGTAACAAAGACGCTTAATAGGCTAGAA AAAGGTGGGCATATTGTTCGTAATGTGCACCCCGTCGACCGCAGGGCTTTCGCCCTCAT GGTCACTGATGCCACTCGTGGAGAGGCGATGCGGACGCTTGGTAAGCATCAGGCGCG TCGTTTTGATGCTGCTAAACGATTAACTCCACAAGAGCGTGAAGTGGTTATCCGATTCCT TCAGG ATATG G CACAG GAGTTATCC CTTAATAATG CACCATG G CTCAACACG GAGTAG SEQ ID NO: 38 - a crtR-protein from C. glutamicum (a crtR-protein)
MLNMQEPDKIHPAEPTLRNIYDVKTSDPKSELVDRSGMSEEDIAQIGRLMKSLASLR DVERSI GEASARYMELSAPDMRALHYLIVAGNAGEVVTPGMLGAHLKLSPASVTKTLNRLEKGGHI V RNVHPVDRRAFALMVTDATRGEAMRTLGKHQARRFDAAKRLTPQEREWIRFLQDMAQEL SLNNAPWLNTE SEQ ID NO: 39 - a crtY Pa encoding nucleic acid sequence from P. ananatis (a crtY-gene)
ATGCAACCGCATTATGATCTGATTCTCGTGGGGGCTGGACTCGCGAATGGCCTTATC GC
CCTGCGTCTTCAGCAGCAGCAACCTGATATGCGTATTTTGCTTATCGACGCCGCACC CC
AGGCGGGCGGGAATCATACGTGGTCATTTCACCACGATGATTTGACTGAGAGCCAAC AT
CGTTGGATAGCTTCGCTGGTGGTTCATCACTGGCCCGACTATCAGGTACGCTTTCCC AC
ACGCCGTCGTAAGCTGAACAGCGGCTACTTCTGTATTACTTCTCAGCGTTTCGCTGA GG
TTTTACAGCGACAGTTTGGCCCGCACTTGTGGATGGATACCGCGGTCGCAGAGGTTA AT
GCGGAATCTGTTCGGTTGAAAAAGGGTCAGGTTATCGGTGCCCGCGCGGTGATTGAC G
GGCGGGGTTATGCGGCAAACTCAGCACTGAGCGTGGGCTTCCAGGCGTTTATTGGCC A GGAATGGCGATTGAGCCACCCGCATGGTTTATCGTCTCCCATTATCATGGATGCCACGG TCGATCAGCAAAATGGTTATCGCTTCGTGTACAGCCTGCCGCTCTCGCCGACCAGATTG TTAATTGAAGACACGCACTATATCGATAATGCGACATTAGATCCTGAACGCGCGCGGCA AAATATTTGCGACTATGCCGCGCAACAGGGTTGGCAGCTTCAGACATTGCTGCGTGAAG AACAGGGCGCCTTACCCATCACCCTGTCGGGCAATGCCGAGGCATTCTGGCAGCAGCG CCCCCTGGCCTGTAGTGGATTACGTGCCGGTCTGTTCCATCCTACCACCGGCTATTCAC TGCCGCTGGCGGTTGCCGTGGCCGACCGCCTGAGCGCACTTGATGTCTTTACGTCGGC CTC AATTC AC C AG G CTATTAG G C ATTTTG C C C G C GAG C G CTG G C AG C AG C AG C G CTTTT TCCGCATGCTGAATCGCATGCTGTTTTTAGCCGGACCCGCCGATTCACGCTGGCGGGT TATGCAGCGTTTTTATGGTTTACCTGAAGATTTAATTGCCCGTTTTTATGCGGGAAAACT CACGCTGACCGATCGGCTACGTATTCTGAGCGGCAAGCCGCCTGTTCCGGTATTAGCA GCATTGCAAGCCATTATGACGACTCATCGTTAA
SEQ ID NO: 40 - Ptuf-crtY encoding nucleic acid sequence (Pantoea ananatis)
TGGCCGTTACCCTGCGAATGTCCACAGGGTAGCTGGTAGTTTGAAAATCAACGCCGT TG CCCTTAGGATTCAGTAACTGGCACATTTTGTAATGCGCTAGATCTGTGTGCTCAGTCTTC CAGGCTGCTTATCACAGTGAAAGCAAAACCAATTCGTGGCTGCGAAAGTCGTAGCCACC ACGAAGTCC AG GAG GACATACAAAG CTTG CATG CCTG CAG GTCG ACTCTAG AG GAAAG GAGGCCCTTCAGATGCAACCGCATTATGATCTGATTCTCGTGGGGGCTGGACTCGCGA ATGGCCTTATCGCCCTGCGTCTTCAGCAGCAGCAACCTGATATGCGTATTTTGCTTATC GACGCCGCACCCCAGGCGGGCGGGAATCATACGTGGTCATTTCACCACGATGATTTGA CTGAGAGCCAACATCGTTGGATAGCTTCGCTGGTGGTTCATCACTGGCCCGACTATCAG GTACGCTTTCCCACACGCCGTCGTAAGCTGAACAGCGGCTACTTCTGTATTACTTCTCA GCGTTTCGCTGAGGTTTTACAGCGACAGTTTGGCCCGCACTTGTGGATGGATACCGCG GTCGCAGAGGTTAATGCGGAATCTGTTCGGTTGAAAAAGGGTCAGGTTATCGGTGCCC GCGCGGTGATTGACGGGCGGGGTTATGCGGCAAACTCAGCACTGAGCGTGGGCTTCC AGGCGTTTATTGGCCAGGAATGGCGATTGAGCCACCCGCATGGTTTATCGTCTCCCATT ATCATGGATGCCACGGTCGATCAGCAAAATGGTTATCGCTTCGTGTACAGCCTGCCGCT CTCGCCGACCAGATTGTTAATTGAAGACACGCACTATATCGATAATGCGACATTAGATCC TGAACGCGCGCGGCAAAATATTTGCGACTATGCCGCGCAACAGGGTTGGCAGCTTCAG ACATTGCTGCGTGAAGAACAGGGCGCCTTACCCATCACCCTGTCGGGCAATGCCGAGG CATTCTGGCAGCAGCGCCCCCTGGCCTGTAGTGGATTACGTGCCGGTCTGTTCCATCC TACCACCGGCTATTCACTGCCGCTGGCGGTTGCCGTGGCCGACCGCCTGAGCGCACTT GATGTCTTTACGTCGGCCTCAATTCACCAGGCTATTAGGCATTTTGCCCGCGAGCGCTG GCAGCAGCAGCGCTTTTTCCGCATGCTGAATCGCATGCTGTTTTTAGCCGGACCCGCC GATTCACGCTGGCGGGTTATGCAGCGTTTTTATGGTTTACCTGAAGATTTAATTGCCCGT TTTTATGCGGGAAAACTCACGCTGACCGATCGGCTACGTATTCTGAGCGGCAAGCCGC CTGTTCCGGTATTAGCAGCATTGCAAGCCATTATGACGACTCATCGTTAA
CCGCATTAT
GATCTG
SEQ ID NO.: 58 CGGTACCCGGGGATCTTAACG
Pa_c/fY-rv1 **
ATGAGTCGTCATAATGG
* Used for sequencing to con : irm deletion of crtR
** Primers were used to amplify crtY Pa
SEQ ID NO.: 59 - an LdhA (cg3219) encoding nucleic acid sequence from C. glutamicum (an LdhA gene) atgaaagaaaccgtcggtaacaagattgtcctcattggcgcaggagatgttggagttgca tacgcatacgcactgatcaaccag ggcatggcagatcaccttgcgatcatcgacatcgatgaaaagaaactcgaaggcaacgtc atggacttaaaccatggtgttgtgt gggccgattcccgcacccgcgtcaccaagggcacctacgctgactgcgaagacgcagcca tggttgtcatttgtgccggcgcag cccaaaagccaggcgagacccgcctccagctggtggacaaaaacgtcaagattatgaaat ccatcgtcggcgatgtcatggac agcggattcgacggcatcttcctcgtggcgtccaacccagtggatatcctgacctacgca gtgtggaaattctccggcttggaatgg aaccgcgtgatcggctccggaactgtcctggactccgctcgattccgctacatgctgggc gaactctacgaagtggcaccaagct ccgtccacgcctacatcatcggcgaacacggcgacactgaacttccagtcctgtcctccg cgaccatcgcaggcgtatcgcttag ccgaatgctggacaaagacccagagcttgagggccgtctagagaaaattttcgaagacac ccgcgacgctgcctatcacattat cgacgccaagggctccacttcctacggcatcggcatgggtcttgctcgcatcacccgcgc aatcctgcagaaccaagacgttgc agtcccagtctctgcactgctccacggtgaatacggtgaggaagacatctacatcggcac cccagctgtggtgaaccgccgagg catccgccgcgttgtcgaactagaaatcaccgaccacgagatggaacgcttcaagcattc cgcaaataccctgcgcgaaattca gaagcagttcttctaa
SEQ ID NO.: 60 - a LdhA-protein from C. glutamicum
MKETVGNKIVLIGAGDVGVAYAYALINQGMADHLAIIDIDEKKLEGNVMDLNHGVVW ADSRT RVTKGTYADCEDAAMVVICAGAAQKPGETRLQLVDKNVKIMKSIVGDVMDSGFDGIFLVA S NPVDILTYAVWKFSGLEWNRVIGSGTVLDSARFRYMLGELYEVAPSSVHAYIIGEHGDTE LP VLSSATIAGVSLSRMLDKDPELEGRLEKIFEDTRDAAYHIIDAKGSTSYGIGMGLARITR AILQ NQDVAVPVSALLHGEYGEEDIYIGTPAWNRRGIRRWELEITDHEMERFKHSANTLREIQK Q FF
SEQ ID NO.: 61 - a SugR (cg21 15) encoding nucleic acid sequence from C. glutamicum
ATGTACGCAGAGGAGCGCCGTCGACAGATTGCCTCATTAACGGCAGTTGAGGGACGT G TAAATGTCACAGAATTAGCGGGCCGATTCGATGTCACTGCAGAGACGATTCGACGAGAC CTTGCGGTGCTAGACCGCGAGGGAATTGTTCACCGCGTTCACGGTGGCGCAGTAGCCA CCCAATCTTTCCAAACCACAGAGTTGAGCTTGGATACTCGTTTCAGGTCTGCATCGTCA GCAAAGTACTCCATTGCCAAGGCAGCGATGCAGTTCCTGCCCGCTGAGCATGGCGGAC TGTTCCTCGATGCGGGAACTACTGTTACTGCTTTGGCCGATCTCATTTCTGAGCATCCTA GCTCCAAGCAGTGGTCGATCGTGACCAACTGCCTCCCCATCGCACTTAATCTGGCCAAC GCCGGGCTTGATGATGTCCAGCTGCTTGGAGGAAGCGTTCGCGCGATCACCCAGGCTG TTGTGGGTGACACTGCGCTTCGTACTCTCGCGCTGATGCGTGCGGATGTAGTGTTCATC GGCACCAACGCGTTGACGTTGGATCACGGATTGTCTACGGCCGATTCCCAAGAGGCTG CCATGAAATCTGCGATGATCACCAACGCCCACAAGGTGGTGGTGTTGTGTGACTCCACC AAGATGGGCACCGACTACCTCGTGAGCTTTGGCGCAATCAGCGATATCGATGTGGTGG TCACCGATGCGGGTGCACCAGCAAGTTTCGTTGAGCAGTTGCGAGAACGCGATGTAGA AGTTGTGATTGCAGAATGA
SEQ ID NO.: 62 - a SugR- amino acid sequence from C. glutamicum
MYAEERRRQIASLTAVEGRVNVTELAGRFDVTAETIRRDLAVLDREGIVHRVHGGAV ATQSF QTTELSLDTRFRSASSAKYSIAKAAMQFLPAEHGGLFLDAGTTVTALADLISEHPSSKQW SIV TNCLPIALNLANAGLDDVQLLGGSVRAITQAWGDTALRTLALMRADVVFIGTNALTLDHG LS TADSQEAAMKSAMITNAHKVWLCDSTKMGTDYLVSFGAISDIDVWTDAGAPASFVEQLRE RDVEVVIAE
Figures
Fig. 1 : Strain construction. The strain GRLyslAsugRAIdhA is the initial strain. Deletions are marked with Δ, integrations are marked with Int. First, genomic changes were carried out by conjugation. Then plasmids were transformed into the cell.
Fig. 2: Deletion of genomic DNA. A) Simplified figure of pk19mobsacB with a deletion construct consisting of FR1 and FR2. B) Genomic region with flanking regions 1 and 2 and the gene which is going to be deleted. C) Conjugation by two homologous recombinations, where the two possible results are shown, the WT (initial genome) and the deletion mutant.
Fig. 3: Carotenoid titers in the various strains after 48 hours of growth. The titers with standard deviation of the produced carotenoids by the various strains were analyzed by HPLC. Significances are calculated with an unpaired two-sided student's t-test, using the carotenoid titer of GRLyslAsugRAIdhA as reference ( * : 0.01 < p < 0.05; ** : 0.001 < p < 0.01 ; *** : p < 0.001 ). 1 =GRLYS1AsugRAIdh), 2=DECA LYS1 , 3=DECA LYS2 and 4=DECA-BETA LYS produced decaprenoxanthin; 5=DECA-BETA LYS and 7= BETA LYS produced β- carotene; 6=LYC LYS produced lycopene; 8=CAN LYS produced canthaxanthin; 9=ZEA LYS produced zeaxanthin; 10=ASTA LYS produced astaxanthin. Fig. 4: Titers of lysine in the various strains after 48 hours cultivation. The titers with standard deviation of the produced lysine by the various strains were analyzed by HPLC. Significances are calculated with an unpaired two-sided student's t-test, using the GRLyslAsugRAIdhA as reference ( * : 0.01 < p < 0.05; ** : 0.001 < p < 0.01 ; *** : p < 0.001 ).
Fig. 5: Colony-PCR of
DECA LYS1 (5 a and b: deletion of crtR),
DECA LYS2 (5 c (primer NW29 OP1 -E and crtE-B) and d (primer NW29 OP1 -E and NW30 OP1 -F): insertion of crtEBI),
DECA BETA LYS (5 e: insertion of crtY Pa ),
LYC LYS (5 f: deletion of genes crtYe, crtYf and crtEb since they are part of an operon), BETA LYS (5 g and h: insertion of crt Y Pa ),
CAN LYS (5 i: insertion of pSH1_crtW1 Fp ),
ZEA LYS (5 j: insertion of pECXT_crtZ Fp ),
ASTA LYS (5 k: BETALYS (pECXT99a_crtZFp) (pSH1 -crtWFp).
Fig. 6: Fed-batch fermentation of C. glutamicum ASTALYS with glucose as primary carbon source. ASTALYS was fermented in a 20 L fermenter with a starting volume of 12 L and 3 L feeding. Biomass concentrations are indicated with black circles, astaxanthin concentrations with bars, L-lysine concentrations with grey triangles and glucose concentrations with open circles. Fig. 7: Coproduction of β-carotene and L-lysine from alternative carbon sources. BETALYS derivatives were grown for 48 h in CGXII supplemented with 10 g/L of the following carbon sources: glucose (BETALYS (pVWExl )), arabinose (BETALYS (pVWExl -araBAD)) and xylose (BETALYS (pVWExl -xylAB)). Titers are given as means of three biological triplicates (exception BETALYS (pVWExl -xy I AB) as duplicate) with standard deviations. Open bars: L- lysine, boxed bars: β-carotene.
Detailed description
It was surprisingly found that the use of recombinant C. glutamicum wherein in the genome of said recombinant C. glutamicum crtR, crtYe and crtYf and crtEb were deleted and crtEBI, crtYp a and at least one recombinant sequence which comprises a nucleic acid sequence encoding for a crtZ-protein (crtZ-nucleic acid sequence), preferably from F. pelagi (crtZ Fp - nucleic acid sequence), at least one recombinant sequence which comprises a nucleic acid sequence encoding for a crtW-protein (crtW-nucleic acid sequence), preferably from F. pelagi (crtW Fp -nucleic acid sequence), B.aurantiaca (crtW Ba -nucleic acid sequence) or S. astaxanthinifaciens (crtW Sa -nucleic acid sequence) were introduced in a process for the production of astaxanthin and lysine yields not only higher amounts of said substance compared to processes with recombinant C. glutamicum known in the art but also an increased production of lysine.
One aspect of the present invention refers to a recombinant gram-positive bacterium, preferably C. glutamicum, wherein the genome of said bacterium was modified in that it comprises deletions of crtR, crtYe and crtYf from said bacterium, preferably from C. glutamicum, and crtEb, respectively, and introduction of crtEBI, introduction of crtY Pa and introduction of at least one recombinant sequence which comprises a nucleic acid sequence encoding for a crtZ-protein (crtZ-nucleic acid sequence), preferably from F. pelagi (crtZ Fp - nucleic acid sequence), at least one recombinant sequence which comprises a nucleic acid sequence encoding for a crtW-protein (crtW-nucleic acid sequence), preferably from F. pelagi (crtW Fp -nucleic acid sequence), B.aurantiaca (crtW Ba -nucleic acid sequence) or S. astaxanthinifaciens (crtW Sa -nucleic acid sequence).
In one preferred embodiment, in said recombinant gram-positive bacterium according to the invention, preferably C. glutamicum, the genes crtYe, crtYf and crtEb are replaced by said crtZ-nucleic acid sequence, preferably a crtZ Fp -nucleic acid sequence, and nucleic acid sequence encoding for a crtW-protein (crtW-nucleic acid sequence), preferably from F. pelagi (crtW Fp -nucleic acid sequence), B.aurantiaca (crtW Ba -nucleic acid sequence) or S. astaxanthinifaciens (crtW Sa -nucleic acid sequence) in at least one recombinant sequence. In one preferred embodiment, said recombinant bacterium according to the invention comprises only one recombinant sequence, which comprises a crtZ Fp -nucleic acid sequence, and a crtW-nucleic acid sequence, preferably crtW Fp -nucleic acid sequence, crtW Ba -nucleic acid sequence or crtW Sa -nucleic acid sequence.
Another aspect of the present invention refers to a method to produce astaxanthin and lysine in recombinant gram-positive bacterium according to the invention such as recombinant C. glutamicum, wherein said bacterium comprises a crtZ-nucleic acid sequence, preferably a crtZ Fp -nucleic acid sequence, and comprises a crtW-nucleic acid sequence, preferably crtW Fp -nucleic acid sequence, crtW Ba -nucleic acid sequence or crtW Sa -nucleic acid sequence, in at least one recombinant sequence. Yet another aspect of the present invention refers to a method to produce astaxanthin and lysine in recombinant C. glutamicum according to the invention, wherein said recombinant C. glutamicum comprises a recombinant sequence, which comprises a crtZ-nucleic acid sequence, preferably a crtZ Fp -nucleic acid sequence, and a crtW-nucleic acid sequence, preferably a crtW Fp -nucleic acid sequence, crtW Ba -nucleic acid sequence or crtW Sa -nucleic acid sequence.
Especially preferred is a method according to the invention or a bacterium according to the invention, wherein a crtZ-nucleic acid sequence, preferably a crtZ Fp -nucleic acid sequence, and a crtW-nucleic acid sequence, preferably crtW Fp -nucleic acid sequence, crtW Ba -nucleic acid sequence or crtW Sa -nucleic acid sequence, are each expressed and corresponding crtZ- protein and crtW-protein are produced.
In one preferred embodiment, said crtZ-nucleic acid sequence and said crtW-nucleic acid sequence being each part of a recombinant sequence, preferably being part of one recombinant sequence, are each individually operatively linked to a promotor.
In a preferred embodiment, the method of the invention further comprises the step of obtaining astaxanthin and lysine.
In a particular embodiment, recombinant crtW- and/or crtZ-nucleic acid sequences may be expressed from a non-native or heterologous promoter (i.e. a promoter which is heterologous to a crtW- and/or crtZ-nucleic acid sequence, i.e. is not the native crtW- or crtZ-gene promoter of the host bacterium, e.g., C. glutamicum) and particularly a strong, non-native or heterologous promoter. Thus, in this embodiment the crtW- or crtZ-nucleic acid sequences are not used with their native promoter. A crtW- or crtZ-nucleic acid sequence may be introduced which is under the control of a non-native promoter.
The use of a non-native promoter may advantageously have the effect of relieving the crtW- or crtZ-nucleic acid sequences of transcriptional repression, as at least some of any repressive elements will be located in the native promoter region. By replacing the native promoter with a non-native promoter devoid of repressive elements responsive to the effects of pathway products, the crtW- or crtZ-nucleic acid sequence will be at least partly relieved of transcriptional repression.
The invention, in one preferred embodiment, may thus provide a method wherein a crtW- and/or a crtZ-nucleic acid sequence is expressed which is not subject to transcriptional repression, e.g. by a product of the astaxanthin pathway or by a repressor of the endogenous crtW- or crtZ-nucleic acid sequence.
In a preferred embodiment, the non-native promoter in view of a crtZ-nucleic acid sequence of C. glutamicum and a crtW-nucleic acid sequence of C. glutamicum is nevertheless native to C. glutamicum. The introduced sequences may be modified to render them relieved of transcriptional repression, e.g. by mutating or deleting recognition elements for transcriptional repressors or by using expression control elements (e.g. promoters) which are not subject to transcriptional regulation by the transcriptional regulator(s) which normally control expression of the crtW- gene and/or crtZ-nucleic acid sequence, e.g. which control expression in their native situation, for example transcriptional repressors being products of the astaxanthin pathway. The endogenous crtW- and/or crtZ-nucleic acid sequence may alternatively or additionally be modified in this way, or by addition of a stronger promoter. Thus, mutagenesis (including both random and targeted) may for example be used to mutate the endogenous control or regulatory elements so as to increase expression of the endogenous crtW- and/or crtZ- nucleic acid sequence (e.g. increase transcription and/or translation). Alternatively, the organism may be engineered to introduce additional or alternative regulatory elements.
In yet another preferred embodiment, the C. glutamicum used for producing a recombinant C. glutamicum strain in regard of crtW and crtZ according to the present invention is GRLys 1 AsugRAIdhA, a modified strain of MB001 (ATCC13032) known from Perez-Garcia, Peters- Wendisch and Wendisch, 2016.
Especially preferably, the expression, preferably overexpression, of a recombinant crtZ Fp - nucleic acid sequence and a recombinant crtW-nucleic acid sequence, preferably a crtW Fp - nucleic acid sequence, crtW Ba -nucleic acid sequence or crtW Sa -nucleic acid sequence, results in the production, preferably overproduction, of a crtZ Fp -protein encoded by said crtZpp-nucleic acid sequence and the production, preferably overproduction, of a crtW- protein, preferably a crtW Fp -protein, crtW Ba -protein or crtW Sa -protein, encoded by said crtW- nucleic acid sequence, preferably a crtW Fp -nucleic acid sequence, crtW Ba -nucleic acid sequence or crtW Sa -nucleic acid sequence, respectively.
In yet another preferred embodiment, the crtZ Fp -nucleic acid sequence is SEQ ID NO.: 1 or is a nucleic acid sequence having at least 80% identity as set forth with SEQ ID NO.: 1 , or a nucleic acid sequence that hybridizes with the complement of a nucleic acid sequence according to SEQ ID NO.: 1 under the following hybridization conditions: 0,1 x SSC, 0,1 % SDS, 65 °C and wash conditions 2x SSC, 0,1 % SDS, 65 °C , followed by 0,1 x SSC, 0,1 % SDS, 65 °C (high stringency conditions), or a nucleic acid sequence encoding for an amino acid sequence having at least 80% identity with SEQ ID NO.: 2 and which amino acid sequence shows crtZ activity. In yet another preferred embodiment, the source for a nucleic acid sequence encoding for crtWp p is SEQ ID NO.: 3 or SEQ ID NO.: 5 or is a nucleic acid sequence having at least 80% identity as set forth with SEQ ID NO.: 3 or 5, respectively, or a nucleic acid sequence that hybridizes with the complement of a nucleic acid sequence according to SEQ ID NO.: 3 or 5, respectively, under the following hybridization conditions: 0,1 x SSC, 0,1 % SDS, 65 °C and wash conditions 2x SSC, 0,1 % SDS, 65 °C , followed by 0,1 x SSC, 0,1 % SDS, 65 °C (high stringency conditions), or a nucleic acid sequence encoding for an amino acid sequence having at least 80% identity with SEQ ID NO.: 4 or 6, respectively, and which amino acid sequence shows crtW activity.
In yet another preferred embodiment, the source for a nucleic acid sequence encoding for crtW Ba is SEQ ID NO.: 7 or is a nucleic acid sequence having at least 80% identity as set forth with SEQ ID NO.: 7, or a nucleic acid sequence that hybridizes with the complement of a nucleic acid sequence according to SEQ ID NO.: 7 under the following hybridization conditions: 0,1 x SSC, 0,1 % SDS, 65 °C and wash conditions 2x SSC, 0,1 % SDS, 65 °C , followed by 0,1 x SSC, 0,1 % SDS, 65 °C (high stringency conditions), or a nucleic acid sequence encoding for an amino acid sequence having at least 80% identity with SEQ ID NO.: 8 and which amino acid sequence shows crtW activity. In yet another preferred embodiment, the source for a nucleic acid sequence encoding for crtWsa is SEQ ID NO.: 9, or is a nucleic acid sequence having at least 80% identity as set forth with SEQ ID NO.: 9, or a nucleic acid sequence that hybridizes with the complement of a nucleic acid sequence according to SEQ ID NO.: 9 under the following hybridization conditions: 0,1 x SSC, 0,1 % SDS, 65 °C and wash conditions 2x SSC, 0,1 % SDS, 65 °C , followed by 0,1 x SSC, 0,1 % SDS, 65 °C (high stringency conditions), or a nucleic acid sequence encoding for an amino acid sequence having at least 80% identity with SEQ ID NO.: 10 and which amino acid sequence shows crtW activity.
Yet another aspect of the present invention refers to a method to produce astaxanthin and lysine comprising the step of cultivating recombinant gram-positive bacterium, preferably C. glutamicum according to the invention, under conditions that a recombinant crtZ Fp -protein resulting from a recombinant crtZ Fp -nucleic acid sequence described herein is overproduced and a recombinant crtW-protein, preferably a crtW Fp -, crtW Sa -, crtW Ba -protein resulting from a crtW-nucleic acid sequence described herein, is overproduced simultaneously, at different times or at overlapping times in said bacterium.
As non-limiting examples for "simultaneously overproduced" recombinant proteins are, e.g., proteins which encoding nucleotide sequences are both individually operatively linked to a constitutively expressing promotor. A non-limiting example for "overproduced at different times" recombinant proteins are, e.g., proteins of which one encoding nucleotide sequences is operatively linked to a substance 1 (e.g. methanol) induced promotor and another encoding nucleotide sequence is operatively linked to a substance 2 (e.g. glucose) induced promotor and the inducing substances are provided to the bacterium at different times. A non-limiting example for overproduced "at overlapping times" recombinant proteins are, e.g., a protein which encoding nucleotide sequence is operatively linked to a substance 1 (e.g. methanol) induced promotor and a protein which encoding nucleotide sequence is operatively linked to a constitutively expressing promotor and the inducing substance is provided to the bacterium only for a specific time period. Yet another aspect of the present invention refers to a method to produce astaxanthin and lysine comprising the steps of introducing into a gram-positive bacterium according to the invention, preferably a C. glutamicum, a crtZ Fp -nucleic acid sequence according to the invention and a crtW- nucleic acid sequence, preferably a crtW Fp -, crtW Sa -, crtW Ba -nucleic acid sequence; and cultivating the gram-positive bacterium, preferably C. glutamicum, under conditions that crtZ Fp -protein is overproduced and crtW-protein, preferably a crtW Fp -, crtW Sa -, crtW Ba - protein, is overproduced.
Preferably, both nucleic acid sequences encoding for a crtZ-protein and encoding for a crtW- protein, respectively, are introduced into the gram-positive bacterium, preferably C. glutamicum, simultaneously, e.g. both sequences being comprised in a plasmid which is introduced into C. glutamicum.
The skilled person is aware how to transform plasmid into cells, e.g. by electroporation or heat-shock methods, by methods known in the art (see, e.g., Heider et al, supra). Methods for introducing nucleic acids and vectors into microorganisms are well known and widely described in the literature. The choice of method may depend on the microorganism used. As described in Heider et al., 2014 (supra), methods for introducing genes into C. glutamicum and suitable plasmids etc. for use in such methods are known and available in the art.
Preferably, each recombinant nucleic acid sequence encoding for a crtZ Fp -protein and encoding for a crtW-protein, respectively, is individually operatively linked to a promotor. More preferably, at least one promotor, even more preferably, each promotor individually operatively linked to a recombinant crtZ Fp -nucleic acid sequence (promotor 1 ) and a crtW- nucleic acid sequence, preferably a crtW Fp -, crtW Sa -, or crtW Ba -nucleic acid sequence, respectively, (promotor 2), is a constitutively expressing promotor, preferably a constitutively expressing strong promotor.
The use of promotors leads, when activated or constitutively expressing, to an overexpression of the operatively linked nucleic acid sequence and results in the overproduction of the encoded recombinant protein.
One preferred embodiment refers a process according to the invention or a recombinant bacterium according to the invention comprises a recombinant crtZ-nucleic acid sequence, wherein the crtZ-protein encoding nucleic acid sequence is a nucleic acid sequence according to SEQ ID NO.: 1 , or is a nucleic acid sequence having at least 80% identity as set forth with SEQ ID NO.: 1 , or a nucleic acid sequence that hybridizes with the complement of a nucleic acid sequence according to SEQ ID NO.: 1 under the following hybridization conditions: 0,1 x SSC, 0,1 % SDS, 65 °C and wash conditions 2x SSC, 0,1 % SDS, 65 °C , followed by 0,1 x SSC, 0,1 % SDS, 65 °C (high stringency conditions), or a nucleic acid sequence encoding for an amino acid sequence having at least 80% identity with SEQ ID NO.: 2 and which amino acid sequence shows crtZ activity.
In yet another preferred embodiment, the source for a nucleic acid sequence encoding for crtW is SEQ ID NO.: 3 or SEQ ID NO.: 5 or is a nucleic acid sequence having at least 80% identity as set forth with SEQ ID NO.: 3 or 5, respectively, or a nucleic acid sequence that hybridizes with the complement of a nucleic acid sequence according to SEQ ID NO.: 3 or 5, respectively, under the following hybridization conditions: 0,1 x SSC, 0,1 % SDS, 65 °C and wash conditions 2x SSC, 0,1 % SDS, 65 °C , followed by 0,1 x SSC, 0,1 % SDS, 65 °C (high stringency conditions), or a nucleic acid sequence encoding for an amino acid sequence having at least 80% identity with SEQ ID NO.: 4 or 6, respectively, and which amino acid sequence shows crtW activity.
In yet another preferred embodiment, the source for a nucleic acid sequence encoding for crtW is SEQ ID NO.: 7 or is a nucleic acid sequence having at least 80% identity as set forth with SEQ ID NO.: 7, or a nucleic acid sequence that hybridizes with the complement of a nucleic acid sequence according to SEQ ID NO.: 7 under the following hybridization conditions: 0,1 x SSC, 0,1 % SDS, 65 °C and wash conditions 2x SSC, 0,1 % SDS, 65 °C , followed by 0,1 x SSC, 0,1 % SDS, 65 °C (high stringency conditions), or a nucleic acid sequence encoding for an amino acid sequence having at least 80% identity with SEQ ID NO.: 8 and which amino acid sequence shows crtW activity.
In yet another preferred embodiment, the source for a nucleic acid sequence encoding for crtW is SEQ ID NO.: 9, or is a nucleic acid sequence having at least 80% identity as set forth with SEQ ID NO.: 9, or a nucleic acid sequence that hybridizes with the complement of a nucleic acid sequence according to SEQ ID NO.: 9 under the following hybridization conditions: 0,1 x SSC, 0,1 % SDS, 65 °C and wash conditions 2x SSC, 0,1 % SDS, 65 °C , followed by 0,1 x SSC, 0,1 % SDS, 65 °C (high stringency conditions), or a nucleic acid sequence encoding for an amino acid sequence having at least 80% identity with SEQ ID NO.: 10 and which amino acid sequence shows crtW activity.
(Sequence) "identity" may be assessed by any convenient method. However, for determining the degree of sequence identity between sequences, computer programs that make multiple alignments of sequences are useful, for instance Clustal W (Thompson et al, (1994) Nucleic Acids Res., 22: 4673-4680). Furthermore, the Dali server at the European Bioinformatics institute offers structure-based alignments of protein sequences (Holm (1993) J. Mol. Biol., 233: 123-38; Holm (1995) Trends Biochem. Sci., 20: 478-480; Holm (1998) Nucleic Acid Res., 26: 316-9). Yet another preferred embodiment refers to a method or a recombinant C. glutamicum wherein in the genome of the recombinant C. glutamicum crtR, crtY from C. glutamicum and crtEb were deleted and the genome comprises crtEBI, crtYpa, and pSH1_crtW1 F p+pEC-XT-crtZF P! crtR, crtY from C. glutamicum and crtEb were deleted and the genome comprises crtEBI, crtYp a , and pSH1_crtW2 F p+pEC-XT-crtZ Fp! crtR, crtY from C. glutamicum and crtEb were deleted and the genome comprises crtEBI, crtYpa, and pSH1_crtW S a+pEC-XT-crtZ F p, or crtR, crtY from C. glutamicum and crtEb were deleted and the genome comprises crtEBI, crtYp a , and pSH1_crtW Ba +pEC-XT-crtZ Fp, more preferably the recombinant C. glutamicum is recombinant C. glutamicum GRLysl As ugR IdhA with the following modifications crtR, crtY from C. glutamicum and crtEb were deleted and the genome comprises crtEBI, crtYp a , and pSH1_crtW1 Fp +pEC-XT-crtZ Fp , crtR, crtY from C. glutamicum and crtEb were deleted and the genome comprises crtEBI, crtYp a , and pSH1_crtW2 Fp +pEC-XT-crtZ Fp , crtR, crtY from C. glutamicum and crtEb were deleted and the genome comprises crtEBI, crtYp a , and pSH1_crtW Sa +pEC-XT-crtZ Fp , or crtR, crtY from C. glutamicum and crtEb were deleted and the genome comprises crtEBI, crtYp a , and pSH1_crtW Ba +pEC-XT-crtZ Fp,
Even more preferred, the recombinant C. glutamicum is recombinant C. glutamicum ASTA LYS as described herein (i.e. BETALYS (pECXT99A-crfZFp)(pSH1 -crfl l/Fp).
Another preferred embodiment refers to a process according to the invention or a recombinant bacterium according to the invention, wherein the recombinant crtW-nucleic acid sequence is a crtW Fp -, crtW Sa -, or crtW Ba -nucleic acid sequence, more preferably a crtW Ba -nucleic acid sequence.
Another preferred embodiment refers to a process according to the invention or a recombinant bacterium according to the invention, wherein said recombinant bacterium, preferably C. glutamicum, comprises a recombinant nucleic acid sequence encoding for a promotor 1 which is operatively linked to a crtZ Fp -nucleic acid sequence. Another preferred embodiment refers to a process according to the invention or a recombinant bacterium according to the invention, wherein said recombinant bacterium, preferably C. glutamicum, comprises a recombinant nucleic acid sequence encoding for a promotor 2 which is operatively linked to a crtW-nucleic acid sequence, preferably a crtW Fp -, crtWsa-, or crtW Ba -nucleic acid sequence.
Another preferred embodiment refers to a process according to the invention or a recombinant bacterium according to the invention, wherein the promotor 1 which is operatively linked to a crtZ Fp -nucleic acid sequence and the promotor 2 which is operatively linked to a crtW-nucleic acid sequence, preferably a crtW Fp -, crtW Sa -, or crtW Ba -nucleic acid sequence, are activated by different sources, e.g. one of both is constitutively expressing while the other is activated/induced, e.g. by IPTG or a saccharide such as xylitol or mannitol. The skilled person is well aware of further compound inducible promotors.
Another preferred embodiment refers to a process according to the invention or a recombinant bacterium according to the invention, wherein promotor 2 is a constitutively expressing promotor.
Another preferred embodiment refers to a process according to the invention or a recombinant bacterium according to the invention, wherein induction of promotor activity of promotor 1 and induction of promotor activity of promotor 2 occur at different times.
Another preferred embodiment refers to a process according to the invention, wherein induction of promotor activity of promotor 1 occurs within the first 6 hours of the cultivation, in the exponential growth phase.
Another preferred embodiment refers to a process according to the invention or a recombinant bacterium according to the invention, wherein promotorl and promotor 2 are constitutively expressing promotors.
Another preferred embodiment refers to a process according to the invention, wherein the amount of astaxanthin is at least 0,5 mg/gCDW (cell dry weight), more preferably at least 0,75 mg/gCDW, even more preferably at least 0,8 mg/gCDW after 48 h of incubation at 30 °C, e.g., in a 50 ml culture.
Another preferred embodiment refers to a process according to the invention, wherein the concentration of astaxanthin after 48 h incubation at 30 °C, e.g., in a 50 ml culture, is at least 1 ,6 mg/l, more preferably 2,45 mg/l, even more preferably at least 2,6 mg/l and the concentration of lysine is at least 9,2 mM, more preferably 13,8 mM, even more preferably at least 14,7 mM. Notably, all strains produced herein except of ASTA LYS (BETALYS (pECXT99A- crtZFp)(pSW -crtWFp)) were not able to produce increased amounts of astaxanthin and lysine.
Xylose and arabinose can be obtained from lignocelluloses by hydrolysis and these pentose sugars do not have competing uses in the food and feed industries. C. glutamicum wild type can neither utilize xylose nor arabinose, may be engineered for growth on these pentose sugars as sole and combined carbon sources (Meiswinkel et al., 2013; Schneider et al., 201 1 ; Wendisch et al., 2016a). Example 4 shows that the use of different carbon sources for the production of β-carotene and lysine is possible. Accordingly, another aspect of the invention relates to a process for preparation of carotenoids, preferably astaxanthin and/or β-carotene, in recombinant C. glutamicum of the invention, preferably BETALYS, wherein arabinose is used as carbon source and wherein in the genome of said recombinant C. glutamicum araA, preferably as depicted in SEQ ID NO: 87, araB, preferably as depicted in SEQ ID NO: 88 and araD, preferably as depicted in SEQ ID NO: 89, is introduced. Another aspect of the invention relates to a process for preparation of carotenoids, preferably astaxanthin and/or β-carotene, in recombinant C. glutamicum of the invention, preferably BETALYS, wherein in the genome of said recombinant C. glutamicum xylA, preferably as depicted in SEQ ID NO: 90, and xylB, preferably as depicted in SEQ ID NO: 91 , is introduced. A further aspect of the invention relates to a process for preparation of carotenoids, preferably astaxanthin and/or β-carotene, in recombinant C. glutamicum of the invention, preferably BETALYS, wherein arabinose and xylulose are used as carbon source and wherein in the genome of said recombinant C. glutamicum araA, preferably as depicted in SEQ ID NO: 87, araB, preferably as depicted in SEQ ID NO: 88, araD, preferably as depicted in SEQ ID NO: 89, xylA, preferably as depicted in SEQ ID NO: 90, and xylB, preferably as depicted in SEQ ID NO: 91 , are introduced. Preferably, the introduced genes are operatively linked to a promotor.
Another aspect of the present invention refers to a method and a strain for the production of lycopene and lysine, preferably a process for the preparation of lycopene in recombinant C. glutamicum, wherein in the genome of said recombinant C. glutamicum strain sugR and Idh and crtR from C. glutamicum, crtYe, crtYf, crtEb were deleted, Ptuf-crtEcrtBcrtl was introduced. Preferably, the strain is LYC LYS as described herein.
Yet another aspect of the present invention refers to a method and a strain for the production of decaprenoxanthin and lysine, preferably a process for the preparation of decaprenoxanthin in recombinant C. glutamicum, wherein in the genome of said recombinant C. glutamicum strain sugR and Idh are deleted, or sugR and Idh and crtR are deleted, sugR and Idh and crtR are deleted and Ptuf-crtEcrtBcrtI is introduced, or sugR and Idh and crtR are deleted and Ptuf-crtEcrtBcrtI and Ptuf-crtY Pa is introduced. Preferably, the strain is selected from the group consisting of GRLYSIAsugRAIdh), 2=DECA LYS1 , 3=DECA LYS2 and 4=DECA-BETA LYS as described herein.
Yet another aspect of the present invention refers to a method and a strain for the production of canthaxanthin and lysine, preferably a process for the preparation of canthaxanthin in recombinant C. glutamicum, wherein in the genome of said recombinant C. glutamicum strain sugR and Idh and crtR from C. glutamicum , crtYe, crtYf, crtEb were deleted, Ptuf- crtEcrtBcrtI was introduced and crtW, preferably crtW Fp , are introduced. Preferably, the strain is CAN LYS.
Yet another aspect of the present invention refers to a method and a strain for the production ozeaxanthin and lysine, preferably a process for the preparation of ozeaxanthin and lysine in recombinant C. glutamicum, wherein in the genome of said recombinant C. glutamicum strain sugR and Idh and crtR from C. glutamicum , crtYe, crtYf, crtEb were deleted, Ptuf- crtEcrtBcrtI was introduced and crtZ, preferably crtZ Fp , are introduced. Preferably, the strain is ZEA LYS
Yet another aspect of the present invention refers to a method and a strain for the production of β-carotene and lysine, preferably a process for the preparation of β-carotene and lysine in recombinant C. glutamicum, wherein in the genome of said recombinant C. glutamicum strain sugR and Idh and crtR are deleted and Ptuf-crtEcrtBcrtI and Ptuf-crtY Pa is introduced or sugR and Idh and crtR and crtYe and crtYf and crtEb are deleted and Ptuf-crtEcrtBcrtI and Ptuf-crtYp a is introduced. Preferably, the strain is DECA-BETA LYS or BETA LYS.
Yet another aspect of the present invention refers to a method and a strain for the production of β-carotene, decaprenoxanthin and lysine preferably a process for the preparation of β- carotene, decaprenoxanthin and lysine in recombinant C. glutamicum, wherein in the genome of said recombinant C. glutamicum strain sugR and Idh and crtR are deleted and Ptuf-crtEcrtBcrtI and Ptuf-crtY Pa is introduced. Preferably, the strain is DECA-BETA LYS.
The invention is also characterized by the following items:
1 . A process for the preparation of astaxanthin and lysine in recombinant C. glutamicum, wherein in the genome of said recombinant C. glutamicum crtR, crtY from C. glutamicum and crtEb were deleted and crtEBI, crtYPa and at least one recombinant sequence which comprises a nucleic acid sequence encoding for a crtZ-protein (crtZ-nucleic acid sequence), preferably from F. pelagi (crtZFp-nucleic acid sequence) and at least one recombinant sequence which comprises a nucleic acid sequence encoding for a crtW-protein (crtW- nucleic acid sequence), preferably from F. pelagi (crtWFp-nucleic acid sequence), B.aurantiaca (crtWBa-nucleic acid sequence) or S. astaxanthinifaciens (crtWSa-nucleic acid sequence) were introduced.
2. The process according to item 1 , wherein the crtZFp-nucleic acid sequence is SEQ ID NO.: 1 , or
a nucleic acid sequence having at least 80% identity as set forth with SEQ ID NO.: 1 , or a nucleic acid sequence that hybridizes with the complement of a nucleic acid sequence according to SEQ ID NO.: 1 under the following hybridization conditions: 0,1 x SSC, 0,1 % SDS, 65 °C and wash conditions 2x SSC, 0,1 % SDS, 65 °C , followed by 0,1 x SSC, 0,1 % SDS, 65 °C (high stringency conditions), or
a nucleic acid sequence encoding for an amino acid sequence having at least 80% identity with SEQ ID NO.: 2 and which amino acid sequence shows crtZ activity.
3. The process according to item 2, wherein the crtZFp-nucleic acid sequence is SEQ ID NO.: 1 .
4. The process according to item 1 or item 2, wherein the crtW-nucleic acid sequence is SEQ ID NO.: 3 or SEQ ID NO.: 5 or is
a nucleic acid sequence having at least 80% identity as set forth with SEQ ID NO.: 3 or 5, respectively, or
a nucleic acid sequence that hybridizes with the complement of a nucleic acid sequence according to SEQ ID NO.: 3 or 5, respectively, under the following hybridization conditions: 0,1 x SSC, 0,1 % SDS, 65 °C and wash conditions 2x SSC, 0,1 % SDS, 65 °C , followed by 0,1 x SSC, 0,1 % SDS, 65 °C (high stringency conditions), or
is a nucleic acid sequence encoding for an amino acid sequence having at least 80% identity with SEQ ID NO.: 4 or 6, respectively, and which amino acid sequence shows crtW activity; or
is SEQ ID NO.: 7 or is
a nucleic acid sequence having at least 80% identity as set forth with SEQ ID NO.: 7, or a nucleic acid sequence that hybridizes with the complement of a nucleic acid sequence according to SEQ ID NO.: 7 under the following hybridization conditions: 0,1 x SSC, 0,1 % SDS, 65 °C and wash conditions 2x SSC, 0,1 % SDS, 65 °C , followed by 0,1 x SSC, 0,1 % SDS, 65 °C (high stringency conditions), or
a nucleic acid sequence encoding for an amino acid sequence having at least 80% identity with SEQ ID NO.: 8 and which amino acid sequence shows crtW activity; or
is SEQ ID NO.: 9, or is a nucleic acid sequence having at least 80% identity as set forth with SEQ ID NO.: 9, or a nucleic acid sequence that hybridizes with the complement of a nucleic acid sequence according to SEQ ID NO.: 9 under the following hybridization conditions: 0,1 x SSC, 0,1 % SDS, 65 °C and wash conditions 2x SSC, 0,1 % SDS, 65 °C , followed by 0,1 x SSC, 0,1 % SDS, 65 °C (high stringency conditions), or
a nucleic acid sequence encoding for an amino acid sequence having at least 80% identity with SEQ ID NO.: 10 and which amino acid sequence shows crtW activity.
5. The process according to any one of the items 1 to 3, wherein the crtW-protein is of SEQ ID NO.: 4, 6, 8 or 10. 6. The process according to any of the preceding items, wherein said recombinant C. glutamicum comprises a nucleic acid sequence encoding for a promotor 1 which is operatively linked to a crtZFp-nucleic acid sequence according to item 2 or item 3.
7. The process according to any of the preceding items, wherein said recombinant C. glutamicum comprises a nucleic acid sequence encoding for a promotor 2 which is operatively linked to a crtWFp-, crtWBa-, or crtWSa-nucleic acid sequence according to item 4 or 5.
8. The process according to any one of the preceding items, wherein the promotor 1 and the promotor 2 are not induced by the same inducing compound.
9. The process according to any one of the preceding items, wherein promotor 2 is a constitutively expressing promotor.
10. The process according to any one of the preceding items, wherein induction of promotor activity of promotor 1 and induction of promotor activity of promotor 2 occur at different times.
1 1 . The process according to any one of the preceding items, wherein induction of promotor activity of promotor 1 occurs at the beginning of the cultivation, in the exponential growth phase within the first 6 hours.
12. The process according to any one of items 1 to 7 and 8 to 10, wherein promotorl and promotor 2 are constitutively expressing promotors.
13. The process according to any one of the preceding items, wherein said recombinant C. glutamicum comprises the following modifications: deletion of sugR and deletion of LdhA, deletion of crtR insertion of crtEBI deletion of genes crtYe, crtYf and crtEb insertion of crt YPa , preferably as Ptuf-crtYPa, insertion of crtZFp, preferably as pECXT99a_crtZFp, insertion of crtWFp, preferably as pSH1 -crtWFp.
14. A recombinant C. glutamicum, wherein said recombinant C. glutamicum comprises a crtY-nucleic acid sequence, preferably a crtYPa-nucleic acid sequence, further comprises a crtZ-nucleic acid sequence, which is not from C. glutamicum, preferably a crtZFp-nucleic acid sequence, and further comprises a crtW-nucleic acid sequence, preferably a crtWFp-, crtWBa-, or crtWSa-nucleic acid sequence;
more preferably, in the genome of said recombinant C. glutamicum crtR, crtY from C. glutamicum and crtEb were deleted and crtEBI, crtYPa and at least one recombinant sequence which comprises a nucleic acid sequence encoding for a crtZ-protein, preferably from F. pelagi (crtZFp-nucleic acid sequence) and at least one recombinant sequence which comprises a nucleic acid sequence encoding for a crtW-protein, preferably from F. pelagi (crtWFp-nucleic acid sequence), B.aurantiaca (crtWBa-nucleic acid sequence) or S. astaxanthinifaciens (crtWSa-nucleic acid sequence) were introduced.
15. The recombinant C. glutamicum, according to item 15, wherein the nucleic acid sequence encoding for a crtZ-protein is a nucleic acid sequence according to item 2 or 3 and the nucleic acid sequence encoding for a crtW-protein is a nucleic acid sequence according to item 4 or 5.
Examples
Example 1 : Co-production of astaxanthine and lysine
• Agilent 1200 series HPLC system (Agilent Technologies)
• Autoclave DE-23 (Systec)
• Autoclave S. p. A. (Fedegari)
• Axio Lab.AI (Zeiss)
• BioCapt MW
• Safe 2020 Biological Safety Cabinet (Thermo Scientific)
• Centrifuge 5417 R (Eppendorf)
· Centrifuge 5424 (Eppendorf)
• Centrifuge 5810 R (Eppendorf)
• DC Power Supply 5004
• Ecotron (Infors HT)
• Gene Pulser Xcell™ (Biorad)
• Incubator (Memmert)
• Spectrophotometer ND-1000 (Nanodrop)
• Spectrophotometer V-1200 (VWR)
• Thermocycler FlexCycler (Biometra)
• Thermocycler T3000 (Biometra)
· Thermomixer comfort (Eppendorf)
• UV Transilluminator (UVP)
• Vortex Genie 2 (Scientific Industries)
• Waterbath 3042 (Kottermann)
The chemicals used to prepare the buffers and solutions were obtained by AppliChem GmbH (Darmstadt), Carl Roth GmbH & Co. KG (Karlsruhe), Merck KGaA (Darmstadt), Sigma- Aldrich GmbH (Taufkirchen) and VWR International GmbH (Darmstadt). The components and preparations for the buffers and solutions are listed in Table 1.
Table 1 : Buffers and solutions. Components, amounts and preparation of the used buffers and solutions
Component
RF1 End concentration
RbCI 100 mM
MnCI 2 x 4 H 2 0 50 mM
Potassium acetate 30 mM
adjust pH to 5.8 with 0.2 % acetic acid
autoclave
RF2 End concentration
MOPS 10 mM
RbCI 10 mM
CaCI 2 x 2 H 2 0 75 mM
Glycerol 15 % (w/v)
adjust pH to 6.8 with NaOH
autoclave
EPB1 End concentration
HEPES 20 mM
Glycerol 5 % (w/v)
adjust pH to 7.2 with 2N NaOH
autoclave
EPB2 End concentration
HEPES 5 mM
Glycerol 15 % (w/v)
adjust pH to 7.2 with 2N NaOH
autoclave
40 % glucose Amount
Glucose 400 g/l
autoclave
TAE End concentration
Tris 40 mM
Acetic acid 20 mM
Na 2 EDTA 1 mM
1 % Agarose Amount
Agarose 10 g/l
cook with 1x TAE until solution is clear, store at 60 °C
Gel Loading Buffer End concentration
Na 2 EDTA 100 mM
Glycerol 50 % (w/v)
Bromphenol blue 0.10%
Xylene cyanol 0.20%
Orange G 0.15%
Component
Borat Buffer End concentration
Boronic acid 100 mM
adjust pH to 7 with 30 % NaOH
Ethambutol dihydrochloride End concentration
Ethambutol dihydrochloride 36 mM Bioinformatic tools: Clone Manager Version 9.0 (Sci-Ed)
The components and preparations of the various media are listed in Table 2. To solve the components, deionized H 2 0 was used. For the preparation of medium for plates, 16 g/l agar was added before autoclaving. To prepare media for organisms with antibiotic resistance, the antibiotics were added to the liquid media immediately before preparing the cultures. For producing plates with selective media, antibiotics were added before pouring the plates. In Table 3 the components of the solution for trace elements are listed. Table 4 contains the antibiotics and their used concentrations.
Table 2: Media. Components, amounts and preparation of media
autoclave
BHIS Medium
Brain Heart Infusion Medium 37 g/l
autoclave
Sorbitol 90 g/l
autoclave
BHIS 10 % sucrose Medium
Brain Heart Infusion Medium 37 g/l
autoclave
Sorbitol 90 g/l
Sucrose 100 g/l
autoclave
adjust pH to 7 with KOH autoclave
Biotin (sterile) 0.2 mg/l
PKS (sterile) 30 mg/l
Carbon source (sterile) x g/i
Trace elements (sterile) 1 ml/l
Table 3:Trace elements. Components and amount to prepare trace elements used for CGXII medium
sterile filtrating
Table 4: Antibiotics. Concentration of stock solution and end concentration of antibiotics used to prepare selective media
Antibiotic Stock solution cone, [mg/ml] End cone. [Mg/ml]
Kanamycin 50 15/25
Nalidixic acid 50 50
Tetracycline 5 5
Oligonucleotides: The primers used for PCR were ordered from Metabion
(Planegg/Steinkirchen) (Table 5).
Table 5: Oligonucleotides. Sequences used to amplify genes. Sequence in italics = linker sequence for hybridization
Name Sequence 5"→ 3"
crtY-A AAA4GG/\7 " CCAGTCGGCTTCAGCATCC (SEQ ID NO: 63)
crfEb-DelD /A/A/A/A CCCGGGATGTGTGGGAGGCTTCGC (SEQ ID NO: 64)
lntY2 GAAGTCCAGGAGGACATACAATGCAACCGCATTATGATCTG (SEQ ID NO: 65)
TCTTACTACTTGCGCTAGGTACAGTTAACGATGAGTCGTCATAATGG (SEQ ID lntY3
NO:66)
NW23 P fur fw TGGCCGTTACCCTGCGAATG (SEQ ID NO: 67)
crtl-sacl-rv 7777G.A GCTCTTAAGTCCGATCCACACTGT (SEQ ID NO: 68)
cg0725_E GCGCGAAGATTTGATGGG (SEQ ID NO: 69)
cg0725_F ACTTGTCACCACAGCACTAC (SEQ ID NO: 70)
NW29 Op1 -E TCGCACCATCTACGACAACC (SEQ ID NO: 71 )
NW30 Op1 -F CTACGAAGCTGACGCCGAAG (SEQ ID NO: 72)
crtE-B CCCATCCACTAAACTTAAACAGATTGTCATGCCATTGTCCAT (SEQ ID NO: 73)
AAA4C7GC/AGGAAAGGAGGCCCTTCAGATGGACAATGGCATGACAATC (SEQ crfE-Pstl-fw
ID NO: 74) Name Sequence 5"→ 3"
NW31 Op2-E GTGGTGCTCGAGAACATAAG (SEQ ID NO: 75)
NW32 Op2-F CGGTCACCCGTAACAATCAG (SEQ ID NO: 76)
crtY-E TTGCACCTGCTGGATACGAA (SEQ ID NO: 77)
crtEb-De\F AAAACAATGCGCAGCGCA (SEQ ID NO: 78)
PD5 (pSH1-fw) ACCGGCTCCAGATTTATCAG (SEQ ID NO: 79)
582 (pSH1 -rv, pEKEx3-rv) ATCTTCTCTCATCCG CCA (SEQ ID NO: 80)
pECXT-fw AATACG CAAACCG CCTCTCC (SEQ ID NO: 81 )
pECXT-rv TACTGCCGCCAGGCAAATTC (SEQ ID NO: 82)
GCAGGTCGACTCTAGAGGATCCCCGCGCGAAGATTTGATGGG (SEQ ID NO: cg0725_A
83)
CCAGTGAATTCGAGCTCGGTACCCCTTGTCACCACAGCACTACT (SEQ ID NO: cg0725_D
84)
CTGCAGGTCGACTCTAGAGGAAAGGAGGCCCTTCAGATGCAACCGCATTAT
Pa_crtY-fw
GATCTG (SEQ ID NO: 85)
Pa_crfY-rv1 CGGTACCCGGGGATCTTAACGATGAGTCGTCATAATGG (SEQ ID NO: 86)
Biological material: The strains and plasmids used for growth experiments or constructing new strains are listed in Table 6 and 7. C. glutamicum GRLys \ sugR IdhA was used to construct further strains by deleting or inserting genes.
Table 6: Strains used for this invention
Strain Relevant characteristics Source or reference
E. co// S 17-1 hsdR Pro, Rec " , genome integrated RP4-2Tc::Mu Simon, Priefer and
Km::Tn7 Puhler, 1983
C. glutamicum
strains
MB001 prophage cured, genome reduced ATCC 13032 Baumgart et al., 2013
GRLys 1 AsugRAIdhA ATCC 13032 with following modifications: Apc/c, Perez-Garcia, Peters- pyc P458S , hom V59A , 2 copies of lysC 73111 , 2 copies of Wendisch and asd, 2 copies of dapA, 2 copies of dapB, 2 copies of Wendisch, 2016 ddh, 2 copies of lysA, 2 copies of lysE, in-frame
deletion of prophages CGP1 (cg 1507 - cg1524),
CGP2 (eg 1746 - eg 1752), CGP3 (eg 1890 - cg2071 ), in-frame deletion of sugR (cg21 15) and
IdhA (cg3219)
Source or
Strain Relevant characteristics
reference DECA LYS1 crtR deletion mutant of GRLys 1 sugRAIdhA this work
DECA LYS2 DECA LYS1 derivative with genome integration of the artificial this work operon crtE, crtB, crtl under control of the P tuf promoter
DECA-BETA LYS DECA LYS2 derivative with genome integration of crtY Pa under this work control of the P tuf promoter
LYC LYS crtY e Y f Eb deletion mutant of DECA LYS2 this work
BETA LYS LYC LYS derivative with genome integration of crtY Pa under this work control of P tuf Promoter
CAN LYS BETA LYS with plasmid pSH1_crfW7 Fp this work
ZEA LYS BETA LYS with plasmid pECXT_crtZ Fp this work
ASTA LYS BETA4 (pECXT99A_crtZFp)(pSH 1 -crtWFp) this work
Table 7: Plasmids invention
Source or
Plasmid Vector Relevant characteristics
reference pk1 QmobsacB- crtR Km , shuttle vector for E. coli and C. glutamicum to construct (Henke ef deletions and insertions in C. glutamicum; contains a a/. , 2016) construct to delete crtR
pk19mofc>sacB-lnt- Km , shuttle vector for E. coli and C. glutamicum to construct (Henke et crtEBI deletions and insertions in C. glutamicum; contains a a/. , 2016) construct to insert the artificial operon crtEBI under control of
Ptu f promoter, additional ribosome binding site in front of crtB
for the integration into the CGP2 cured region of C.
glutamicum
pk19mofc>sacB- Km , shuttle vector for E. coli and C. glutamicum to construct (S. A. E. AcrtYEb deletions and insertions in C. glutamicum; contains a Heider ei construct to delete crtY e Y f Eb a/. , 2014) pk19mofc>sacB-lnt- Km , shuttle vector for E. coli and C. glutamicum to construct (Henke ei crtYp a deletions and insertions in C. glutamicum; contains a a/. , 2016) construct to insert crtY of Pantoea ananatis under control of
Ptu f promoter into the cgpl cured region of C. glutamicum pSM_crtW1 Fp Km , Ptu f , pHM519 oriV Cg , C. glutamicum/E. coli expression (Henke ei shuttle vector, constitutive expression of crtW from a/. , 2016) Fulvimarina pelagi with artificial ribosome binding site pEC-XT99A crtZp p Tet , Ptr acf, pGA1 oriV Cg , C. glutamicum/E. coli expression (Henke et (pECXT_crtZ Fp ) shuttle vector, IPTG-inducible expression of crtZ from a/. , 2016)
Fulvimarina pelagi with artificial ribosome binding site
Cultivation: If not mentioned otherwise, Escherichia coli was cultivated in LB at 37 °C with an agitation of 180 rpm and Corynebacterium glutamicum was cultivated in BHIS at 30 °C and 120 rpm. Plasmid isolation: To isolate plasmids from E. coli bacteria cells, 20 ml of an overnight culture were processed according to the GeneJET Plasmid Miniprep kit from Thermo Scientific. To elute the plasmids, the elution buffer was substituted with 50 μΙ MilliQ. Subsequently the concentration was determined by Spectrophotometer ND-1000 (Nanodrop).
Competent E. coli cells: A colony of E. coli S17-1 was cultivated in 5 ml LB and incubated overnight at 37 °C. Two 500 ml flasks with 50 ml LB were inoculated with 1 ml of the overnight culture. The flasks were incubated for 2 - 3 hours until they reached an OD600 of 0.2 - 0.4. Afterwards the cultures were transferred to 50 ml Falcon tubes and incubated on ice for 10 minutes. Thereafter the cells were centrifuged for 20 minutes at 4000 rpm and 4 °C in a Centrifuge 5810 R (Eppendorf). The cells were washed in 30 ml ice-cooled RF1 -Buffer and centrifuged for 7 minutes at 4000 rpm and 4 °C. Afterwards the pellets were resuspended in 8 ml ice-cooled RF2-Buffer and incubated on ice for 10 - 15 minutes. 100 μΙ aliquots were frozen in liquid nitrogen and stored at -80 °C.
Transformation in E. coli via heat-shock: Competent E. coli cells were thawed on ice. 50 ng plasmid DNA was added to the cells and incubated on ice for 15 minutes. Thereafter the heat-shock at 42 °C for 1 .5 minutes occurred. Afterwards the cells were incubated on ice for 1 minute. 700 μΙ of LB medium was added. Cells were regenerated for 45 - 60 minutes at 37 °C and 450 rpm in a Thermomixer comfort (Eppendorf). The cells were plated on LB plates with the required antibiotics and incubated at 37 °C. Colonv-PCR: Colony-PCR was performed to verify if the transformation of a plasmid into a bacteria cell or a genomic integration/deletion was successful. For this process Taq- polymerase from NEB was used. For each PCR a forward and a reverse primer were added to the reaction mix, the list which primers were used for which plasmid or strain is listed in Table 5. The components of a single reaction mix and the parameters of the program for the PCR cycler can be seen in Table 8 and 9. To perform the PCR the Thermocycler FlexCycler or Thermocycler T3000 (Biometra) was used. After each PCR the samples were analysed by gel electrophoresis.
Table 8: A single reaction mix for colony PCR. Components and used amounts
Taq DNA polymerase reaction mix
Components Volume [μΙ]
MilliQ 15.5
10x Thermo polymerase buffer 2
dNTPs (10 mM) 0.4
Forward primer (10 mM) 1
Reverse Primer (10 mM) 1
Taq-polymerase 0.04 Total volume 20
Table 9: PCR program used for colony PCR with thermocycler
Colony-PCR program
Initial denaturation 95 °C 5 min
Denaturation 95 °C 20 s
Annealing 58 - 65 °C 25 s
Elongation 72 °C 60 s/kb
35 cycles
Final Elongation 72 °C 5 min
Storage 4 °C
Gel electrophoresis: To separate the DNA fragments on the basis of their size, gel electrophoresis was performed with 1 % agarose gel (peqGOLD Universal Agarose, peqlab). Each sample was mixed with 5 μΙ 6x triple dye loading buffer and 9 μΙ of the sample were loaded on the gel. As a standard to compare the sizes of the fragments, 5 μΙ 1 kb ladder (NEB) were used. The gel was run at 100 V for 20 - 30 minutes and stained in an ethidium bromide bath (400 μΙ 1 % ethidium bromide solution in 700 ml H20) for 5 - 9 minutes. To analyse the gels, a UV transilluminator (UVP) was used.
PCR clean-up: The kit DNA, RNA, and protein purification (Macherey-Nagel, Dijren, Germany) was used to purify the amplified DNA fragments. The steps were performed according to the instructions, but instead of using the elution buffer of the kit, the fragments were eluted with 15 μΙ MilliQ. The concentration was measured by Spectrophotometer ND- 1000 (Nanodrop) and the fragments were sequenced.
Conjugation: Genomic integrations/deletions in the chromosome of C. glutamicum were carried out via homologous recombination events. With this method, genomic regions can be deleted or foreign DNA can be integrated by introducing the suicide vector pk19mobsacB (Figure 5) (Schafer et al., 1994). Since this vector is based on the replicon pMB1 , it can only be replicated in E. coli (Sutcliffe, 1979). The plasmid contains a multiple cloning site (MCS), Km R gene, RP4mofc> DNA region and a genetically modified sacB gene (Schafer et al., 1994). The MCS with unique restriction sites is convenient for cloning. The Km R can be used as a selection marker for cells which contain the plasmid (Schafer et al., 1994). When expressed, the levansucrase of the sacB gene is lethal for C. glutamicum in presence of sucrose (Jager et al., 1992), which is why cells that contain the plasmid can't grow on sucrose. This can be used as another selection marker. The plasmid pk19mobsacB was transferred (Schafer et al., 1994) into the E. coli strain S17-1 , which contains a genome integrated RP4 plasmid. This RP4 derivative enables the pk19mobsacB to be transferred into other strains (Simon, Priefer and Puhler, 1983), in this case: C. glutamicum. Since the vector only has an or/V for £ coli, the plasmid needs to be integrated via homologous recombination into the genome of the recipient to be replicated (Schafer et al., 1994) (Figure 5C). Via a second recombination, the vector was removed from the genome and there are two possible results: The complete plasmid is removed and the initial genome is restored (WT) or by homologous recombination the flanking regions (FR) are partially exchanged and the genomic region between the flanking regions is removed from the genome (deletion mutant). To insert DNA regions into a genome, the suicide vector contains the DNA region, which is to be inserted, between the flanking regions. The procedure is the same as for deleting genomic regions. Two pre-cultures were inoculated, one with cells of the donor (£. co// S17-1 pk19mobsacB) in 50 ml LB with Km 25 and one with cells of the recipient (C. glutamicum) in 50 ml BHIS. The flasks were incubated overnight. Two flasks with fresh media and appropriate antibiotics were inoculated, both to an OD 6 oo of 0.1 and incubated until they reached an OD 6 oo of 1 - 1 .5. 50 ml of the recipient were transferred to a 50 ml Falcon tube and centrifuged for 10 minutes at 4000 rpm (Centrifuge 5810 R, Eppendorf). The cells were resuspended with 5 ml BHIS and aliquots of 800 μΙ were incubated at 50 °C for 9 minutes (Thermomixer comfort, Eppendorf).
Two 15 ml Falcon tubes, each with 10 ml of the donor culture, were harvested and centrifuged for 10 minutes at 4000 rpm. The pellets were resuspended in 1 ml LB.
200 μΙ of the donor were added to each aliquot of the recipient and inverted gently. The tubes were centrifuged for 3 minutes at 3000 rpm (Centrifuge 5424, Eppendorf) and the pellets were resuspended by stirring carefully with a 1 ml pipette tip.
Sterile cellulose acetate or cellulose nitrate filters were placed onto BHIS plates and the cell suspensions were pipetted onto the filters. The plates were incubated for 20 minutes under the sterile bench (Safe 2020 Biological Safety Cabinet, Thermo Scientific, Massachusetts, USA), in which the lids were left open for 12 minutes. Afterwards the plates were incubated at 30 °C for at least 20 hours. Then the filters were transferred to 15 ml Falcon tubes to remove the cells from the filters with 500 μΙ BHIS. The cell suspensions were centrifuged for 4 minutes at 4000 rpm and the supernatants were discarded. The pellets were resuspended and plated onto BHIS Km 15 Nal 50 plates and incubated for two days at 30 °C. Colonies which grew on the plates were picked onto a fresh BHIS Km 25 Nal 50 plate to dispose of £. coli cells and were incubated overnight at 30 °C. The new colonies were picked parallel, first onto a BHIS Km 25 and then onto a BHIS Km 25 + 10 % sucrose plate and incubated overnight. Six Colonies which grew on BHIS Km 25 but not on Km 25 + 10 % sucrose were streaked on BHIS 10 % sucrose plates with a glass pipette and incubated for 2 days for the second recombination to occur. Colonies from these plates were parallel picked onto BHIS Km and BHIS 10 % sucrose and incubated overnight. Cells which grew on BHIS 10 % sucrose but not on BHIS Km 25 were used to perform a colony-PCR to verify that the deletion or insertion was successful.
Competent C. glutamicum cells: A pre-culture of 5 ml BHIS with appropriate antibiotics and cell material of C. glutamicum was incubated overnight at 30 °C and an agitation of 120 rpm. Two flasks with 50 ml fresh BHIS with required antibiotics were inoculated with 1 ml of the pre-culture and incubated until they reached an OD600 of 0.6. To each flask, Ampicillin [1.5 μg ml] was added and they were incubated for 1 - 1.5 hours. Afterwards the suspensions were transferred to 50 ml Falcon tubes and centrifuged for 7 min at 4000 rpm and 4 °C in a Centrifuge 5810 R (Eppendorf). The pellets were washed three times with 30 ml ice-cooled EPB1 -Buffer and centrifuged as performed before. Thereafter the pellets were resuspended in 750 μΙ ice-cooled EPB2-Buffer and incubated for 10 - 15 minutes on ice. Aliquots of 150 μΙ were stored at -80 °C.
Transformation in C. glutamicum via electroporation: Competent C. glutamicum cells were thawed on ice. 500 ng of purified plasmid DNA was added to the cells and incubated for 15 minutes on ice. The cells were transferred into a pre-cooled sterile electroporation cuvette. The electroporation was performed with 2.5 kV, 200 Ω and 25 F with Gene Pulser Xcell™ (Biorad). Immediately after the electroporation the cells were transferred to a tube with 750 μΙ BHIS which was preheated to 46 °C. The heat shock was performed at 46 °C for 6 minutes. Afterwards the regeneration occurred at 30 °C for 60 - 90 minutes with an agitation of 450 rpm in a Thermomixer comfort (Eppendorf). The cells were plated onto a BHIS plate with the required antibiotics and incubated for two days at 30 °C.
Growth experiment with C. glutamicum: A pre-culture with 20 ml BHIS, 50 mM glucose, appropriate antibiotics and cell material was incubated overnight at 30 °C and 120 rpm. Cells for an OD600 of 1 .1 in 50 ml were harvested and centrifuged for 7 min at 4000 rpm in a Centrifuge 5810 R (Eppendorf). Afterwards they were washed with 20 ml basic CGXII. To prepare the CGXII medium, 100 mM glucose, 1 mM IPTG and appropriate antibiotics were added. The pellet was resuspended with 50 ml of the CGXII medium and transferred to a 500 ml flask. The flask was incubated for 24 - 48 hours with an agitation of 120 rpm. The OD600 of the culture was measured at different time points. After 24, 32 or 36 hours the glucose content in the flask was measured with a glucose test strip DIABUR Test 5000 (Roche Diabetes Care Deutschland GmbH, Mannheim, Germany). At the end of the growth experiment, 2 x 1 ml from the flask were transferred to 2 ml Eppendorf tubes and centrifuged for 10 minutes at max rpm in a Centrifuge 5242 (Eppendorf). The supernatant was transferred to a 1.5 ml tube. The pellet and the supernatant were stored at -20 °C until further use.
Carotenoid extraction: The pellet was thawed at room temperature for 5 minutes and resuspended in 800 μΙ of methanokacetone (7:3) with 0.05 % BHT (2, 6 - Di - tert - Butyl - 4 - methylphenol). The tube was incubated for 15 minutes in a 60 °C waterbath 3042 (Kottermann), while it was shaken every 5 minutes. After the incubation, the tube was centrifuged for 10 minutes at max rpm (Centrifuge 5424, Eppendorf). The supernatant was transferred to a fresh 2 ml tube. If the pellet was not colourless, another extraction round was performed. The supernatant was centrifuged for 15 minutes at max rpm and transferred to a fresh 2 ml tube. 500 μΙ were analysed by HPLC.
Preparation of samples for amino acid analysis: The frozen supernatants were thawed at room temperature. Then they were centrifuged for 15 minutes at max rpm in a Centrifuge 5424 (Eppendorf) to spin down possible remaining cells and residues.
49 ml Borat Buffer were mixed with 0.5 ml 10 mM asparagine, 495 μΙ of this solution were transferred to a vial and 5 μΙ of the sample were added. Standards were prepared as prescribed in Table 10. The prepared sample and the standards were analysed by HPLC.
Table 10: Preparation of standards of one amino acid. In each set of standards, there are H 2 0, asparagine as internal standard and one amino acid. In this case it is either glutamate or lysine. The total volume of each vial is 495 μΙ.
High performance liquid chromatography: The carotenoid extracts and supernatants with amino acids were analysed by high performance liquid chromatography (HPLC) using the Agilent 1200 series HPLC system (Agilent Technologies).
Automatic precolumn derivatization with o f/?o-phthaldialdehyde (Georgi, Rittmann and Wendisch, 2005) was used to determine the amino acids. The column system consisted of a precolumn (LiChrospher 100 RP18 EC-5 μ (40 x 4 mm), CS Chromatographie Service GmbH, Langerwehe, Germany) and a reversed-phase main column (LiChrospher 100 RP18 EC-5 μ (125 x 4 mm), CS Chromatographie Service GmbH) which were used to separate the amino acids. A fluorescence detector (FLD G1321A, 1200 series, Agilent Technologies) was used to detect the amino acids (Perez-Garcia, Peters-Wendisch and Wendisch, 2016) with excitation at 230 nm and emission at 450 nm (Peters-Wendisch et al., 2014). L -Asparagine was used as internal standard to quantify the amount of amino acid (Perez-Garcia, Peters- Wendisch and Wendisch, 2016). The buffers used for this process were sodium acetate 0.1 M, pH 7.1 , and methanol in a mixture of 4:1 (unpublished method from Perez-Garcia 2016).
To determine the carotenoids a diode array detector (DAD) was used to detect the UV/visible (Vis) spectrum. To quantify the carotenoids, every maximum of the extracted wavelength chromatogram at A max 470 nm was integrated and the respective profiles of UVA is were analysed. For the standard calibration curve samples with different carotenoids and various concentrations were measured. The carotenoids were lycopene (Sigma-Aldrich), β-carotene (Sigma-Aldrich), canthaxanthin (Sigma-Aldrich), zeaxanthin (Sigma-Aldrich) and astaxanthin (Sigma-Aldrich). The stock solution [1 mg/ml] was dissolved in dichloromethane and different amounts of the solution were diluted in methanokacetone (7:3) with 0.05 % BHT to prepare the standards (Henke et al., 2016).
50 μΙ of the samples were run through a precolumn (LiChrospher 100 RP18 EC-5 μ, (40 x 4 mm), CS-Chromatographie) and a reversed-phase main column (LiChrospher 100 RP18 EC-5, (125 x 4 mm), CS-Chromatographie). Buffers used were methanol (A) and methanokwater (9:1 ) (B). The gradient started with 0 % of B at 0 minutes, increasing to 100 % of B at 10 minutes and 100 % of B at 32.5 minutes with a flow rate of 1.5 ml/min (Henke, unpublished method from Henke 2016).
Strain construction by conjugation and transformation: To construct new strains by conjugation, the various pk19mobsacB plasmids were transferred into S17-1 cells. The strain GRLysl As ugRAIdhA was used as the initial strain. The first step was to delete the gene crtR (cg0725) which encodes a putative transcriptional regulator (Pfeifer et al., 2016) with the plasmid pk19mobsacB-AcrtR to construct the strain DECA LYS1 (GRLysl AsugRAIdhAAcrtR) (Figure 1 ). To verify the genomic modification, the primers cg0725_E and cg0725_F were used for colony-PCR. Then the artificial operon crtEBI was integrated using the plasmid pM 9mobsacB-\nt-crtEBI which created the strain DECA LYS2 (GR\-ys \AsugRAIdhAAcrtR-\ntcrtEBI). To verify the genomic modification, the primer combinations NW29 Op1 -E + NW30Op1 -F, NW29 Op1 -E + crtE- B and crfE-Pstl-fw + NW30Op1 -f were used for colony-PCR.
The gene crtY Pa was integrated into DECA LYS2 using the plasmid pM 9mobsacB-\nt-crtY Pa constructing DECA-BETA LYS {GRLys'\AsugRAIdhAAcrtR-\ntcrtEBI-\ntcrtYp a ). To verify the genomic modification, the primers NW31 OP2-E and NW32 OP2-F were used for colony- PCR.
Starting from DECA LYS2 , the genes crtY e Y f Eb (=crtY e crtY f and crtEb) were deleted creating the strain LYC LYS {GRLys'\AsugRAIdhAAcrtR-\ntcrtEBIAcrtY e Y f Eb). To verify the deletion, the primers crtY-E and crfEb-DelF were used.
The integration of crtY Pa in LYC LYS led to the strain BETA LYS (G RLys 1 AsugRAIdhAAcrtR- \ntcrtEBIAcrtY e Y f Eb-\ntcrtY Pa ). For this colony-PCR the primers NW31 OP2-E and NW32 OP2-F were used. The strain BETA LYS was used as the initial strain for transformation. The plasmids pSH1 _crtW1 Fp and pECXT_c/fZ Fp were isolated from the strains E. coli DH5a pSM_crtW1 Fp and £. coli DH5a pECXT_crfZ Fp .
The vector pSH1 _crtW1 Fp was transferred into the competent BETA LYS cells by electroporation with Gene Pulser Xcell™ (Biorad) constructing the strain CAN LYS. For colony-PCR the standard vector primers for pSH 1 , PD5 (pSM -fw) and 582 (pSH1 -rv, pEKEx3-rv), were used.,
The plasmid pECXT_c/fZ Fp was transferred into BETA LYS to create the strain ZEA LYS. To verify via colony-PCR the standard vector primers pECXT-fw and pECXT-rv, were used.
After confirmation that the transformations were successful, the vector pECXT_c/fZ Fp was transferred into CAN LYS resulting in ASTA LYS1.
The plasmid pSW _crtW1 Fp was transferred into ZEA LYS to construct ASTA LYS2. The verification was made with the standard primers for each new added plasmid.
Cultures for production of carotenoids and glutamate: To produce glutamate in C. glutamicum there need to be specific conditions, e.g. biotin limitation or addition of ethambutol dihydrochloride (following called ethambutol or EMB). The strains tested were MB001 , MBOOIAcrtR and ASTA1. Each strain was grown in different conditions (i) CGXII medium without further addition, serves as control, (ii) CGXII medium with EMB [50 g/ml], (iii) biotin limitation. The pre-cultures were prepared with 50 ml BHIS, 50 mM glucose, appropriate antibiotics and cell material. They were incubated overnight.
(i) Control: Cell suspension to inoculate a flask with 50 ml to an OD 6 oo of 1 .1 were centrifuged for 7 minutes at 4000 rpm and 4 °C (Centrifuge 5810 R, Eppendorf). The cells were resuspended in basic CGXII and centrifuged. The pellet was resuspended in CGXII medium with 100 mM glucose, appropriate antibiotics and 50 mM IPTG if required. (ii) EMB: The main culture was prepared as described in (i) but 50 g/ml EMB were added to the flask before incubation.
(iii) Biotin limitation: A second pre-culture was prepared with CGXII, 100 mM glucose, appropriate antibiotics and 50 mM IPTG if required. But instead of adding biotin with a concentration of 0.2 mg/ml, the concentration was 0.01 mg/ml. The flask was incubated overnight. The main culture was prepared as described in (i) with a concentration of biotin of 1 μg ml.
The flasks were incubated for 48 hours at 30 °C with an agitation of 120 rpm.
Cultures for production of carotenoids and lysine: Pre-cultures of the strains G R Ly s 1 AsugRAId A , DECA LYS1 , DECA LYS2, DECA-BETA LYS, LYC LYS, BETA LYS, CAN LYS, ZEA LYS and ASTA LYS were inoculated with 20 ml BHIS, 50 mM glucose (pre- cultivation) and appropriate antibiotics. The flasks were incubated overnight at 30 °C at 120 rpm. Cell suspension to inoculate a flask with 50 ml of the same medium (main cultivation) to an OD 6 oo of 1 .1 were centrifuged for 7 minutes at 4000 rpm and 4 °C (Centrifuge 5810 R, Eppendorf). The cells were washed with basic CGXII. The pellet was resuspended in CGXII medium with 100 mM glucose, appropriate antibiotics and 50 mM IPTG if required. The flasks were incubated for 48 hours at 30 °C and an agitation of 120 rpm.
Establishment of a platform strain for the coproduction of carotenoids and lysine on the basis of a metabolically optimized lysine producer GRLysl AsugRAIdhA: The strain GRLysl As ugR IdhA (Unthan et al., 2015) was used as a platform strain to construct the following strains which are able to produce carotenoids and lysine simultaneously.
The almost white colour of GRLysl As ugR IdhA was changed to a pale yellow, when crtR, the gene encoding for the putative transcriptional regulator of carotenogenesis in C. glutamicum, was deleted, leading to the construction of the strain DECA LYS1 (Figure 1 ). The deletion was verified by colony-PCR (Figure 5). The colonies 1 , 31 , 38, 48 and 50 were sequenced and showed no mutations but the correct deletion of crtR. DECA LYS1 was used for the construction of the next strain. 1 kb ladder from NEB was used for every gel electrophoresis and the sizes are shown in the Figure 5. Insertion of the artificial operon crtEBI lead to a stronger yellow pigmentation and to the construction of the strain DECA LYS2. The verification of the insertion was done by three colony-PCRs with the primer combinations NW29 Op1 -E + crtE-B, NW29 Op1 -E + NW30 OP1 -F and crfE-Pstl-fw + NW30 OP1 -F. This was necessary, as C. glutamicum naturally possesses an operon with the genes crtB and crtl. The combination NW29 and crtE-B lead to a 1 ,500 bp fragment. The fragment produced with the primers NW29 and NW30 had a size of 6,300 bp, while the combination c f£-fw and NW30 lead to a size of 4,800 bp. The colony- PCR verified the insertion of the artificial operon in the colonies 27, 29, 32 and 41 (Figures 5).
When the lycopene cyclase crtY Pa (S. A. E. Heider et al., 2014) was integrated into the genome, the colour changed from yellow to orange in the strain DECA-BETA LYS. The fragments without the integrated gene are 2,100 bp while the fragments which contain the integration are about 3,800 bp (Figure 5).
The strain LYC LYS contains the deletion of the genes crtYEb, encoding for the lycopene elongase and the C50 ε-cyclase (Krubasik, Kobayashi and Sandmann, 2001 ), leading to the accumulation of lycopene in the strain LYC LYS. The colonies 1 , 12, 16, 21 and 22 among others had the size of 1 ,050 bp (Figure 5) and showed the expected pink colour.
BETA LYS had an orange pigmentation due to the production of the carotenoid β- carotene by the insertion of the gene crtY Pa . The DNA fragment had a size of 3,800 bp and the colonies 8, 1 1 , 29 and 33 were used to make glycerol stocks (Figures 5).
The transformation of the plasmids pSH1 _crtW1 Fp and pECXT_c/fZ Fp lead to the synthesis of canthaxanthin in CAN LYS (Figure 5) with a slightly pink colour, zeaxanthin in ZEA LYS (Figure 5), a strong orange pigmentation, or to the red carotenoid astaxanthin in ASTA LYS (Figure 5). The plasmids were already sequenced and known to be correct. The colony-PCR showed that the vectors were successfully transformed, with fragment sizes of 1 ,200 bp for the gene crtW1 Fp and 1 ,000 bp for the gene crtZ Fp including the flanking regions of the plasmids (Figures 5).
The strains produced carotenoids and the values were analysed by HPLC (Figure 3). GRLysl AsugRAIdhA, DECA LYS1 , DECA LYS2 and DECA-BETA LYS produced decaprenoxanthin. The strains DECA-BETA LYS and BETA LYS synthesized β-carotene. Lycopene was detected in LYC LYS and canthaxanthin in CAN LYS. ZEA LYS produced zeaxanthin and astaxanthin was synthesized in ASTA LYS. The decaprenoxanthin concentration significantly increased from GRLysl As ugRAIdhA (0.05 ± 0 mg/g CDW) to the other decaprenoxanthin producing strains, with DECA-BETA LYS containing the lowest concentration (0.54 ± 0.05 mg/g CDW) and DECA LYS2 the highest (1 .51 ± 0.12 mg/g CDW). The amount of β-carotene was high in both producing strains, 3.19 ± 0.31 mg/g CDW in DECA-BETA LYS and 3.77 ± 0.73 mg/g CDW in BETA LYS, which is the highest concentration of all produced carotenoids. Zeaxanthin was accumulated to 0.34 ± 0.02 mg/g CDW in ZEA LYS and the red canthaxanthin was produced up to 0.92 ± 0.1 1 mg/g CDW in CAN LYS. In ASTA LYS an amount of 0.84 ± 0.1 1 mg/g CDW astaxanthin was detected. The data are listed in Table 1 1 .
The strain GRLysl As ugRAIdhA produced the highest amount of lysine, 24.79 ± 1 mM (Figure 4). The other strains produced less lysine, varying from 14.33 ± 0.46 to 18.79 ± 0.19 mM. The highest amount, apart from GRLysl As ugRAIdhA, was produced by DECA-BETA LYS with a concentration of 18 ± 0.19 mM lysine. The data are listed in Table 12.
All in all, the simultaneous production of C40/C50 carotenoids and the amino acid lysine in one cultivation is possible with the strains used and constructed in this work.
Table 1 1 : Carotenoid production in growth experiment for carotenoids and lysine after 48 hou various strains with their corresponding carotenoids are listed, as well as the final OD 60 o after 48 hours and the production of the carotenoids in different units.
Carotenoid
Strain Carotenoid Final OD mg/g CDW mg/l mg/l*h
GRLYSlAsugRAIdh Decaprenoxanthin 10.90 ± 0.26 0.05 ± 0 0.14 ± 0.00 > 0.01 ± 0.00
DEC A LYS1 Decaprenoxanthin 10.00 ± 0.49 1.41 ± 0.14 3.52 ± 0.27 0.07 ± 0.01
DECA LYS 2 Decaprenoxanthin 13.00 ± 1.04 1.51 ± 0.12 4.94 ± 0.80 0.10 ± 0.02
DECA-BETA LYS Decaprenoxanthin 14.17 ± 0.47 0.54 ± 0.05 1.93 ± 0.20 0.04 ± 0.00
DECA-BETA LYS β-carotene 14.17 ± 0.47 3.19 ± 0.31 11.26 ± 0.85 0.23 ± 0.02
LYC LYS Lycopene 14.60 ± 0.85 0.67 ± 0.1 2.44 ± 0.22 0.05 ± 0.00
BETA LYS β-carotene 12.61 ± 0.65 3.77 ± 0.73 11.89 ± 2.30 0.25 ± 0.05
CAN LYS Canthaxanthin 11.45 ± 0.79 0.92 ± 0.11 2.62 ± 0.28 0.05 ± 0.01
ZEA LYS Zeaxanthin 11.76 ± 0.30 0.34 ± 0.02 0.99 ± 0.06 0.02 ± 0.00
ASTA LYS Astaxanthin 13.27 ± 1.01 0.84 ± 0.11 2.76 ± 0.21 0.06 ± 0.00
Table 12: Production of lysine in the growth experiment for carotenoids and lysine. The strains, final OD 60 o and the lysine production in different units after 48 hours are listed.
Strain Final OD Lysine [mM] Lysine [mg/l]
GRLYSlAsugRAIdh 10.90 ± 0.26 24.79 ± 1.00 3624.31 ± 146.38
DECA LYS1 10.00 ± 0.49 16.16 ± 1.28 2362.94 ± 187.53
DECA LYS 2 13.00 ± 1.04 18.61 ± 1.37 2720.20 ± 200.56
DECA-BETA LYS 14.17 ± 0.47 18.79 ± 0.19 2746.98 ± 28.43
LYC LYS 14.60 ± 0.85 16.14 ± 1.43 2359.92 ± 209.19
BETA LYS 16.57 ± 0.87 14.33 ± 0.46 2094.85 ± 67.44
CAN LYS 11.45 ± 0.79 14.40 ± 0.41 2104.47 ± 59.89
ZEA LYS 11.76 ± 0.30 17.29 ± 0.62 2527.49 ± 91.16
ASTA LYS 13.27 ± 1.01 15.93 ± 1.74 2328.24 ± 253.88 Example 2: Repetition of experiments leads to similar results
The experiments were performed as described in Example 1 unless stated otherwise using the strains described in Example 1 .
First, the production of carotenoids was measured in different C. glutamicum strains. Table 13 shows the results. The highest amount of carotenoids was produced in the BETALYS strain with 1 1 .6 ± 0.94 mg/l carotenoids (β-carotene). ASTALYS showed a production of 3.15 ± 0.58 mg/l astaxanthin, a value even higher than the one shown in Table 1 1 of Example 1 .
Table 13: Carotenoid production in lysine-coproducing C. glutamicum strains. Titer, yield and productivity of carotenoids from cultivation in CGXII (100 mM glucose) and 32 h. Decaprenoxanthin is given as β-carotene equivalents (GRLyslAsugRAIdhA and DECALYS2), lycopene (LYCLYS), β- carotene (BETALYS), zeaxanthin (ZEALYS, canthaxanthin (CANLYS) and astaxanthin (ASTALYS). Means of three biological triplicates and standard deviations are given.
CDW tg/L] [mg/g CDW] [mg/L] ~
GRLYSIAsugRAIdhA 33..4488 ±± 00..1122 00..0066 ±± 00..0033 00..2200 ±± 00..0099 00..0011 ±± 00..0000 00..0011 ±± 0.00
DECALYS1 3.58 ± 0.18 1.70 ± 0.1 1 6.10 ± 0.38 0.19 ± 0.01 0.34 ± 0.02
LYCLYS 4.02 ± 0.1 1 0.68 ± 0.1 1 2.74 ± 0.49 0.09 ± 0.02 0.15 ± 0.03
BETALYS 2.93 ± 0.13 3.96 ± 0.17 1 1 .60 ± 0.94 0.36 ± 0.03 0.64 ± 0.05
ZEALYS 2.65 ± 0.10 0.49 ± 0.02 1.29 ± 0.02 0.04 ± 0.00 0.07 ± 0.00
CANLYS 2.69 ± 0.14 0.84 ± 0.05 2.26 ± 0.04 0.07 ± 0.00 0.13 ± 0.00
ASTALYS 3.16 ± 0.09 1.00 ± 0.18 3.15 ± 0.58 0.10 ± 0.02 0.17 ± 0.03
The strain GRLysl As ugRAId A produced the highest amount of lysine, 23.61 ± 0.43 mM. The other strains produced less lysine, varying from 12.37 ± 0.65 to 19.08 ± 1 .17 mM. The highest amount, apart from GRLysl As ugRAIdhA, was produced by DECALYS1 with a concentration of 19.08 ± 1 .17 mM lysine. The data are listed in Table 14. ASTALYS produced lysine to a concentration of 16.2 ± 1 .31 mM, a value that is comparable to the one presented in Table 12 of Example 1 .
Table 14: Lysine production in carotenoid-coproducing C. glutamicum strains. Biomass, titers, volumetric productivity and yield are shown as mean values.
Lysine Lysine Vol. prod. Yield
Strain CDW [g/L]
[mM] [g/L] [g/L/h] [g/g]
GRLYSIAsugRAIdhA 3.48 ± 0.12 23.61 ± 0.43 3.45 ± 0.06 0.1 1 ± 0.00 0.19 ± 0.00
DECALYS1 3.58 ± 0.18 19.08 ± 1.17 2.79 ± 0.17 0.09 ± 0.01 0.15 ± 0.01
LYCLYS 4.02 ± 0.1 1 15.57 ± 0.46 2.27 ± 0.07 0.07 ± 0.00 0.13 ± 0.00
BETALYS 2.93 ± 0.13 12.37 ± 0.65 1.81 ± 0.10 0.06 ± 0.00 0.10 ± 0.01
ZEALYS 2.65 ± 0.10 16.92 ± 0.34 2.47 ± 0.07 0.08 ± 0.00 0.14 ± 0.00
CANLYS 2.69 ± 0.14 14.46 ± 0.94 2.1 1 ± 0.14 0.07 ±0.00 0.12 ± 0.01
ASTALYS 3.16 ± 0.09 16.20 ± 1.31 2.37 ± 0.19 0.07 ± 0.00 0.13 ± 0.01 These results further demonstrate that the simultaneous production of C40/C50 carotenoids and the amino acid lysine in one cultivation is possible with the strains used and constructed in this work.
Example 3: Fed-batch fermentation of C. glutamicum ASTALYS
A bioreactor with a total volume of 20 L and a working volume of 15 L was used (MBR Bioreactor AG, Switzerland). It was equipped with three six-bladed Rushton turbines and four baffles. Operating pH and oxygen saturation in the medium (p0 2 ) were followed by electrodes (Ingold, Germany). By automated addition of KOH (4 M) and phosphoric acid (10%) pH was kept at 7.0. Samples for quantification were taken by an autosampler and cooled down to 4 °C until use. Initial volume of the fermentation was 12 L with additional feeding volume of 3 L. Fermentation was carried out with 0.4 bar overpressure and aeration rate was set to 12 NL rmin -1 . Stirrer speed was regulated in a cascade to maintain the oxygen saturation at 60% (Perez-Garcia et al., 2016). Antifoam was added manually to avoid foaming by the use of Struktol (1 :10). The feeding profile was activated when the p0 2 signal reached above 60% for the first time and stopped when it fell below 60%. Feed was pumped with 0.1 g rmin "1 resulting in low sugar concentrations during the whole feeding-phase and an oscillating p0 2 signal around 60%. Moreover a cascade was included in the fermentation allowing a stirrer speeding up when p0 2 fell below 30% until p0 2 of 60% was reached again. The maximum stirring speed was set to 500 rmin "1 (Perez-Garcia et al., 2016). The process was inoculated with the cell pellet of 600 ml of an overnight culture grown at 30 °C and 120 rpm on a rotary shaker in complex medium containing 13.5 g L ~1 soypeptone, 7 g L ~1 yeast extract, 2.5 g L "1 NaCI, 2.3 g L "1 K 2 HP0 4 , 1 .5 g L "1 KH 2 P0 4 , 0.25 g L "1 MgS0 4 7 H 2 0 and 15 g L ~1 D-glucose. The fermentation was performed in the same medium as for the pre- cultivation, however 20 g L ~1 D-glucose were used. Feed-medium consisted of 400 g L ~1 D- glucose as well as 232 g L "1 (NH 4 ) 2 S0 4 (autoclaved separately) (Perez-Garcia et al., 2016).
Coproduction of L-lysine and astaxanthin by metabolically engineered C. glutamicum strain ASTALYS was tested in a 20 L fermenter with a working volume of 15 L (Fig. 6). The feeding phase started after 24 h of cultivation and feeding stopped after 101 h when glucose was consumed. Astaxanthin and L -lysine were both produced in the bioreactor with maximal titers of 10 mg/L and 48.2 g/L, respectively. Considering consumption of the substrate glucose, the product yields were 0.07 mg/g for astaxanthin and 0.35 g/g for L-lysine. The volumetric productivities were 0.01 mg of astaxanthin and 0.44 g of L-lysine per liter and hour (Fig. 6). L-Lysine was successfully co-produced with astaxanthin and other carotenoids. Example 4: Alternative carbon sources for coproduction of β-carotene and L-lysine
In order to test the possibility to coproduce carotenoids, such as β-carotene, with L-lysine from alternative carbon sources, C. glutamicum strain BETALYS was transformed with plasmids allowing for growth with xylose and arabinose, respectively: For the use of arabinose as carbon source, the strain was additionally transformed with the araBAD operon from E. coli (b0061 -b0063) encoding for arabinose isomerase (AraA, SEQ ID NO: 87), ribulokinase (AraB, SEQ ID NO: 88) and ribulose-5-phosphate-4-epimerase (AraD, SEQ ID NO: 89). For xylulose as carbon source, the strain was transformed with xylose isomerase xylA from Xanthomonas campestris (XCC1758, SEQ ID NO: 90) and xylulokinase xylB from C. glutamicum (cg0147, SEQ ID NO: 91 ). Cells were grown in CGXII minimal medium with 10 g/L of either glucose, arabinose or xylose as sole carbon and energy source. The empty vector control strain BETALYS(pVWExl ) produced around 6 mg/L β-carotene and 1 .7 g/L of L-lysine from glucose corresponding to yields of 0.6 mg/g and 0.17 g/g, respectively (Fig. 7).
Coproduction was achieved from both alternative carbon sources (Table 15). Production of β-carotene and L-lysine was decreased when arabinose (BETALYS (pVWExl -araBAD)) was used as substrate. However, still 4.5 mg/L β-carotene and 1 .2 g/L L-lysine were produced with yields of 0.45 mg/g and 0.12 g/g. With xylose as sole carbon source (BETALYS (pVWEx1 -xa//At))), titers for the secreted and the cell-bound product were similar to cultivations with glucose as sole carbon source. With xylose, β-carotene titers of around 7 mg/L (corresponding to a yield of 0.7 mg/ g xylose) and L-lysine titers of around 1 .5 g/L (yield of 0.15 g/g) were obtained.
Table 15: Coproduction of β-carotene and lysine overproducing C. glutamicum strains from non-food competitive substrates. Titers are shown as mean values.
Strain β-carotene [mg/L] Lysine [g/L]
BETALYS (pVWExl ) 6.0 ± 0.4 1.7 ± 0.1
BETALYS (pVWExl -araBAD) 4.5 ± 0.3 1.2 ± 0.01
BETALYS (pVWExl -xylAB) 7.0 ± 0.2 1.5 ± 0.01
7 References
Abbes, M., Baati, H., Guermazi, S., Messina, C, Santulli, A., Gharsallah, N. and Ammar, E. (2013) 'Biological properties of carotenoids extracted from Halobacterium halobium isolated from a Tunisian solar saltern.', BMC complementary and alternative medicine, 13, p. 255. doi: 10.1 186/1472-6882-13-255.
Agranoff (1959) 'Isopentenol pyrophsophate isomerase', Journal of the American Chemical Society, 81 (5), pp. 1254-1255.
Ajinomoto Co. (2015) Analysts' Meeting for FY2015 Consolidated Results. Available at: http://www.ajinomoto om/en/ir/ir_library/meeting_qa_2015.html (Accessed: 8 November 2016).
Ajinomoto Co. (2016a) Food Products Business. Available at: www.ajinomoto.com/en/ir/pdf/Food-Oct2016.pdf.
Ajinomoto Co. (2016b) Life Support Business. Available at: http://www.ajinomoto.com/en/ir/pdf/Life_Support-Oct2016.pdf.
Armstrong, G. A. (1994) 'Eubacteria show their true colors: Genetics of carotenoid pigment biosynthesis from microbes to plants', Journal of Bacteriology, 176(16), pp. 4795-4802.
Asai, T., Aida, K. and Oishi, K. (1957) 'On L-Glutamic Acid Fermentation', Bulletin of the Agricultural Chemical Society of Japan, 21 (2), pp. 134-135. doi: 10.1080/03758397.1957.10857370.
Baumgart, M., Unthan, S., Ruckert, C, Sivalingam, J., Grijnberger, A., Kalinowski, J., Bott, M., Noack, S. and Frunzke, J. (2013) 'Construction of a Prophage-Free Variant of Corynebacterium glutamicum ATCC 13032 for Use as a Platform Strain for Basic Research and Industrial Biotechnology', Applied and Environmental Microbiology, 79(19), pp. 6006- 6015. doi: 10.1 128/AEM.01634-13.
BBC Research (2015) The Global Market for Carotenoids - FOD025E. Available at: http://www.bccresearch.com/market-research/food-and-beverage /carotenoids-global-market- report-fod025e.html.
Bhosale, P. and Bernstein, P. S. (2005) 'Microbial xanthophylls', Applied Microbiology and Biotechnology, pp. 445-455. doi: 10.1007/s00253-005-0032-8.
Biswal, S. (2014) 'Oxidative stress and astaxanthin: The novel supernutrient carotenoid', International Journal of Health & Allied Sciences, 3(3), p. 147. doi: 10.4103/2278- 344X.138587.
Bjerkeng, B. (2000) 'Carotenoid pigmentation of salmonid fishes - recent progress', Avances en Nutricion Acuicola V. Memorias del V Simposium Internacional de Nutricion Acuicola., (19-22), pp. 71-89.
Blombach, B. and Eikmanns, B. J. (201 1 ) 'Current knowledge on isobutanol production with Escherichia coli, Bacillus subtilis and Corynebacterium glutamicum.', Bioengineered bugs, 2(6), pp. 346-350. doi: 10.4161/bbug.2.6.17845.
Blombach, B. and Seibold, G. M. (2010) 'Carbohydrate metabolism in Corynebacterium glutamicum and applications for the metabolic engineering of l-lysine production strains', Applied Microbiology and Biotechnology, 86(5), pp. 1313-1322. doi: 10.1007/s00253-010- 2537-z.
Bormann-EI Kholy, E. R., Eikmanns, B. J., Gutmann, M. and Sahm, H. (1993) 'Glutamate dehydrogenase is not essential for glutamate formation by Corynebacterium glutamicum', Applied and Environmental Microbiology, 59(7), pp. 2329-2331 .
Breitmaier, E. and Jung, G. (2012) Terpene', in Organische Chemie: Grundlagen, Verbindungsklassen, Reaktionen, Konzepte, Molekulstruktur, Naturstoffe, Syntheseplanung, Nachhaltigkeit. 7th edn. Thieme.
Britton, G., Liaaen-Jensen, S. and Pfander, H. (2008) Carotenoids: Natural Functions, Birkhauser Basel, doi: 10.1017/CBO9781 107415324.004.
Bunch, P. K., Mat-Jan, F., Lee, N. and Clark, D. P. (1997) 'The IdhA gene encoding the fermentative lactate dehydrogenase of Escherichia coli.', Microbiology, 143 ( Pt 1 (1 997), pp. 187-195.
Burton, G. W. and Ingold, K. U. (1984) 'Beta-Carotene: An Unusual Type of Lipid Antioxidant', Science (New York, N. Y.), 224(4649), pp. 569-73. doi: 10.1 126/science.6710156.
Byrne, J. (2014) Global BioChem to put the brakes on lysine production. Available at: http://www.feednavigator.com/Suppliers/Global-BioChem-to-put -the-brakes-on-lysine- production (Accessed: 28 October 2016).
Campbell, N. A. and Reece, J. B. (2009a) 'Die Ernahrung der Tiere', in Biologie. 8th edn. Pearson Studium, pp. 121 1-1241 .
Campbell, N. A. and Reece, J. B. (2009b) 'Neurone, Synapsen und Signalgebung', in Biologie. 8th edn. Pearson Studium, pp. 1410-1431 .
Campbell, N. A. and Reece, J. B. (2009c) 'Photosynthese', in Biologie. 8th edn. Mijnchen: Pearson Studium, pp. 251-278.
Campbell, N. A. and Reece, J. B. (2016) 'Proteine: Funktionsvielfalt durch Strukturvielfalt', in Biologie. 10th edn. Pearson Studium, pp. 94-123.
Choi, S. K., Harada, H., Matsuda, S. and Misawa, N. (2007) 'Characterization of two β- carotene ketolases, CrtO and CrtW, by complementation analysis in Escherichia coli', Applied Microbiology and Biotechnology, 75(6), pp. 1335-1341 . doi: 10.1007/s00253-007- 0967-z.
Choi, S. K., Matsuda, S., Hoshino, T., Peng, X. and Misawa, N. (2006) 'Characterization of bacterial β-carotene 3,3'-hydroxylases, CrtZ, and P450 in astaxanthin biosynthetic pathway and adonirubin production by gene combination in Escherichia coli', Applied Microbiology and Biotechnology, 72(6), pp. 1238-1246. doi: 10.1007/s00253-006-0426-2.
Coryneregnet (no date) OP_cg2672. Available at: http://coryneregnet.compbio.sdu.dk/v6e/CoryneRegNet/queryEle ment.php?operon=OP_cg26 72 (Accessed: 6 November 2016).
Cremer, J., Eggeling, L. and Sahm, H. (1991 ) 'Control of the lysine biosynthesis sequence in Corynebacterium glutamicum as analyzed by overexpression of the individual corresponding genes' , Applied and Environmental Microbiology, 57(6), pp. 1746-1752.
Cunningham, F. X. and Gantt, E. (1998) 'GENES AND ENZYMES OF CAROTENOID BIOSYNTHESIS IN PLANTS', Annu. Rev. Plant Physiol. Plant Mol. Biol, 49, pp. 557-83. doi: 10.1 146/annurev.arplant.49.1 .557.
Cunningham, F. X., Pogson, B., Sun, Z., Mcdonald, K. A., Dellapenna, D. and Gantt, E. (1996) 'Functional Analysis of the B and E Lycopene Cyclase Enzymes of Arabidopsis Reveals a Mechanism for Control of Cyclic Carotenoid Formation', The Plant Cell American Society of Plant Physiologists, 8(September), pp. 1613-1626. doi: 10.1 105/tpc.8.9.1613.
Eggeling, L. and Sahm, H. (1999) 'L-glutamate and L-lysine: Traditional products with impetuous developments', Applied Microbiology and Biotechnology, 52(2), pp. 146-153. doi: 10.1007/S002530051501 .
Eikmanns, B. J., Metzger, M., Reinscheid, D., Kircher, M. and Sahm, H. (1991 ) 'Amplification of three threonine biosynthesis genes in Corynebacterium glutamicum and its influence on carbon flux in different strains', Applied Microbiology and Biotechnology, 34(5), pp. 617-622. doi: 10.1007/BF00167910.
Engels, V. and Wendisch, V. F. (2007) 'The DeoR-type regulator SugR represses expression of ptsG in Corynebacterium glutamicum' , Journal of Bacteriology, 189(8), pp. 2955-2966. doi: 10.1 128/JB.01596-06.
Fischer, E. (1906) 'Untersuchungen uber Aminosauren, Polypeptide und Proteine', Berichte der deutschen chemischen Gesellschaft, 39(1 ), pp. 530-610. doi: 10.1002/cber.19060390190.
Gassel, S., Schewe, H., Schmidt, I., Schrader, J. and Sandmann, G. (2013) 'Multiple improvement of astaxanthin biosynthesis in Xanthophyllomyces dendrorhous by a combination of conventional mutagenesis and metabolic pathway engineering', Biotechnology Letters, 35(4), pp. 565-569. doi: 10.1007/s10529-012-1 103-4.
Georgi, T., Rittmann, D. and Wendisch, V. F. (2005) 'Lysine and glutamate production by Corynebacterium glutamicum on glucose, fructose and sucrose: Roles of malic enzyme and fructose-1 ,6-bisphosphatase', Metabolic Engineering, 7(4), pp. 291-301. doi: 10.1016/j.ymben .2005.05.001.
Giacometti, T. (1979) 'Free and Bound Glutamate in Natural Products', Glutamic Acid: Advances in biochemistry and physiology, pp. 25-34.
Global Market Insights (2015) Beta Carotene Market Size, Industry Analysis Report, Regional Outlook, Application Development Potential, Price Trend, Competitive Market Share & Forecast, 2016 - 2023. Available at: https://www.gminsights. com/industry- analysis/beta-carotene-market (Accessed: 9 November 2016).
Global Market Insights (2016) Glutamic Acid and Monosodium Glutamate (MSG) Market Size, Potential, Industry Outlook, Regional Analysis, Application Development, Competitive Landscape & Forecast, 2016-2023. Available at: https://www.gminsights.com/industry- analysis/glutamic-acid-and-monosodium-glutamate-msg-market- (Accessed: 26 October 2016).
Goldstein, J. L. and Brown, M. S. (1990) 'Regulation of the mevalonate pathway.', Nature, 343, pp. 425-430. doi: 10.1038/343425a0.
Goodwin, T. W., C. B. E. and F. R. S. (1980a) 'Biosynthesis of Carotenoids', in The Biochemistry of the Carotenoids: Volume I Plants. 2nd edn, pp. 33-76.
Goodwin, T. W., C. B. E. and F. R. S. (1980b) 'Nature and Properties', in The Biochemistry of the Carotenoids: Volume I Plants. II. Springer Netherlands, pp. 1-32. doi: 10.1007/978-94- 009-5860-9.
Gopinath, V., Meiswinkel, T. M., Wendisch, V. F. and Nampoothiri, K. M. (201 1 ) 'Amino acid production from rice straw and wheat bran hydrolysates by recombinant pentose-utilizing Corynebacterium glutamicum', Applied Microbiology and Biotechnology, 92(5), pp. 985-996. doi: 10.1007/s00253-01 1 -3478-x.
Grand View Research (2015) Global Amino Acids Market by Product (L-Glutamate, Lysine, Methionine, Threonine, Tryptophan, Leucine, Iso-Leucine, Valine, Glutamine, Arginine), By Source, By Application Expected to Reach USD 35.40 Billion By 2022. Available at: https://www.grandviewresearch.com/press-release/global-amino -acids-market (Accessed: 26 October 2016).
Guerin, M., Huntley, M. E. and Olaizola, M. (2003) 'Haematococcus astaxanthin: Applications for human health and nutrition', Trends in Biotechnology, 21 (5), pp. 210-216. doi: 10.1016/S0167-7799(03)00078-7.
Han, J. E. S. (1929) 'Monosodium Glutamate as a Chemical Condiment', Industrial & Engineering Chemistry, 21 (10), pp. 984-987. doi: 10.1021/ie50238a023. Harker, M. and Bramley, P. M. (1999) 'Expression of prokaryotic 1 -deoxy-D-xylulose-5- phosphatases in Escherichia coli increases carotenoid and ubiquinone biosynthesis', FEBS Lett, 448, pp. 1 15-1 19. Available at: http://dx.doi.org/10.1016/S0014-5793(99)00360-9.
Heider, S. A. E., Peters-Wendisch, P., Netzer, R., Stafnes, M., Brautaset, T. and Wendisch, V. F. (2014) 'Production and glucosylation of C50 and C40 carotenoids by metabolically engineered Corynebacterium glutamicum', Applied Microbiology and Biotechnology, 98(3), pp. 1223-1235. doi: 10.1007/s00253-013-5359-y.
Heider, S. a E., Wolf, N., Hofemeier, A., Peters-Wendisch, P. and Wendisch, V. F. (2014) 'Optimization of the IPP Precursor Supply for the Production of Lycopene, Decaprenoxanthin and Astaxanthin by Corynebacterium glutamicum.', Frontiers in bioengineering and biotechnology, 2(August), p. 28. doi: 10.3389/fbioe.2014.00028.
Henke, N. A., Heider, S. A. E., Peters-Wendisch, P. and Wendisch, V. F. (2016) 'Production of the marine carotenoid astaxanthin by metabolically engineered Corynebacterium glutamicum', Marine Drugs, 14(7), p. 124. doi: 10.3390/md14070124.
Hunter, W. N. (2007) 'The non-mevalonate pathway of isoprenoid precursor biosynthesis', Journal of Biological Chemistry, 282(30), pp. 21573-21577. doi: 10.1074/jbc.R700005200.
Inui, M., Murakami, S., Okino, S., Kawaguchi, H., Vertes, A. A. and Yukawa, H. (2004) 'Metabolic analysis of Corynebacterium glutamicum during lactate and succinate productions under oxygen deprivation conditions', Journal of Molecular Microbiology and Biotechnology, 7(4), pp. 182-196. doi: 10.1 159/000079827.
Jager, W., Schafer, A., Puhler, A., Labes, G. and Wohlleben, W. (1992) 'Expression of the Bacillus subtilis sacB gene leads to sucrose sensitivity in the gram-positive bacterium Corynebacterium glutamicum but not in Streptomyces lividans', Journal of Bacteriology, 174(16), pp. 5462-5465. doi: 0021 -9193/92/165462-04$02.00/0.
Kajiwara, S., Kakizono, T., Saito, T., Kondo, K., Ohtani, T., Nishio, N., Nagai, S. and Misawa, N. (1995) 'Isolation and functional identification of a novel cDNA for astaxanthin biosynthesis from Haematococcus pluvialis, and astaxanthin synthesis in Escherichia coli', Plant Molecular Biology, 29(2), pp. 343-352. doi: 10.1007/BF00043657.
Kalinowski, J., Bathe, B., Bartels, D., Bischoff, N., Bott, M., Burkovski, A., Dusch, N., Eggeling, L, Eikmanns, B. J., Gaigalat, L, Goesmann, A., Hartmann, M., Huthmacher, K., Kramer, R., Linke, B., McHardy, A. C, Meyer, F., Mockel, B., Pfefferle, W., Puhler, A., Rey, D. A., Rijckert, C, Rupp, O., Sahm, H., Wendisch, V. F., Wiegrabe, I. and Tauch, A. (2003) 'The complete Corynebacterium glutamicum ATCC 13032 genome sequence and its impact on the production of L-aspartate-derived amino acids and vitamins', Journal of Biotechnology, pp. 5-25. doi: 10.1016/S0168-1656(03)00154-8.
Kalinowski, J., Cremer, J., Bachmann, B., Eggeling, L, Sahm, H. and Puhler, A. (1991 ) 'Genetic and biochemical analysis of the aspartokinase from Corynebacterium glutamicum', Mol Microbiol, 5(5), pp. 1 197-1204. doi: 10.1 1 1 1/j.1365-2958.1991 .tb01893.x.
Kim, S.-W. and Keasling, J. D. (2001 ) 'Metabolic engineering of the nonmevalonate isopentenyl diphosphate synthesis pathway in Escherichia coli enhances lycopene production', Biotechnol. Bioeng., 72, pp. 408-415. Available at: http://dx.doi.Org/10.1002/1097-0290(20000220)72:4<408::AI D-BIT1003>3.0.CO\n2-H.
Kinoshita, S., KINOSHITA, S., UDAKA, S. and SHIMONO, M. (1957) 'Studies on the Amino Acid Fermentation', The Journal of General and Applied Microbiology, 3(3), pp. 193-205. doi: 10.2323/jgam.3.193. Kinoshita, S., Nakayama, K. and Akita, S. (1958) Taxonomical Study of Glutamic Acid Accumulating Bacteria, Micrococcus glutamicus nov. sp.\ Bulletin of the Agricultural Chemical Society of Japan, 22(3), pp. 176-185. doi: 10.1080/03758397.1958.10857463.
Kinoshita, S., Nakayama, K. and Kitada, S. (1958) 'L-LYSINE PRODUCTION USING AUXOTROPH ( Preliminary report )', (2), pp. 2-3.
Kirby, J. and Keasling, J. D. (2009) 'Biosynthesis of plant isoprenoids: perspectives for microbial engineering', Annu Rev Plant Biol, 60, pp. 335-55. doi: 10.1 146/annurev.arplant.043008.091955.
Kircher, M. and Pfefferle, W. (2001 ) The fermentative production of L-lysine as an animal feed additive', Chemosphere, 43(1 ), pp. 27-31. doi: 10.1016/S0045-6535(00)00320-9.
Koller, M., Muhr, A. and Braunegg, G. (2014) 'Microalgae as versatile cellular factories for valued products', Algal Research, 6(PA), pp. 52-63. doi: 10.1016/j.algal.2014.09.002.
Krubasik, P., Kobayashi, M. and Sandmann, G. (2001 ) 'Expression and functional analysis of a gene cluster involved in the synthesis of decaprenoxanthin reveals the mechanisms for C50 carotenoid formation', European Journal of Biochemistry, 268(13), pp. 3702-3708. doi: 10.1046/j.1432-1327.2001 .02275.x.
Krubasik, P., Takaichi, S., Maoka, T., Kobayashi, M., Masamoto, K. and Sandmann, G. (2001 ) 'Detailed biosynthetic pathway to decaprenoxanthin diglucoside in Corynebacterium glutamicum and identification of novel intermediates', Archives of Microbiology, 176(3), pp. 217-223. doi: 10.1007/s002030100315.
Kurihara, K. (2009) 'Glutamate: From discovery as a food flavor to role as a basic taste (umami)', American Journal of Clinical Nutrition, 90(3), pp. 1-3. doi: 10.3945/ajcn.2009.27462D.
de la Fuente, J. L, Rodriguez-Saiz, M., Schleissner, C, Diez, B., Peiro, E. and Barredo, J. L. (2010) 'High-titer production of astaxanthin by the semi-industrial fermentation of Xanthophyllomyces dendrorhous', Journal of Biotechnology, 148(2-3), pp. 144-146. doi: 10.1016/j.jbiotec.2010.05.004.
Leuchtenberger, W., Huthmacher, K. and Drauz, K. (2005) 'Biotechnological production of amino acids and derivatives: Current status and prospects', Applied Microbiology and Biotechnology, 69(1 ), pp. 1-8. doi: 10.1007/s00253-005-0155-y.
Li, J., Zhu, D., Niu, J., Shen, S. and Wang, G. (201 1 ) 'An economic assessment of astaxanthin production by large scale cultivation of Haematococcus pluvialis', Biotechnology Advances, pp. 568-574. doi: 10.1016/j.biotechadv.201 1.04.001 .
Liebl, W. (2005) 'Corynebacterium Taxonomy', in Eggeling, L. and Bott, M. (eds) Handbook of Corynebacterium glutamicum. Boca Raton, FL: CRC Press, pp. 9-34. doi: 10.1201/9781420039696.pt2.
Lorenz, R. T. and Cysewski, G. R. (2000) 'Commercial potential for Haematococcus microalgae as a natural source of astaxanthin', Trends in Biotechnology, 18(4), pp. 160-167. doi: 10.1016/S0167-7799(00)01433-5.
Lotan, T. and Hirschberg, J. (1995) 'Cloning and expression in Escherichia coli of the gene encoding 3-C-4-oxygenase, that converts β-carotene to the ketocarotenoid canthaxanthin in Haematococcus pluvialis', FEBS Letters, 364(2), pp. 125-128. doi: 10.1016/0014- 5793(95)00368-J.
Malin, G. M. and Bourd, G. I. (1991 ) 'Phosphotransferase-dependent glucose transport in Corynebacterium glutamicum', Journal of Applied Bacteriology. Wiley Online Library, 71 (6), pp. 517-523. doi: 10.1 1 1 1/j.1365-2672.1991 .tb03826.x.
Mat-Jan, F., Alam, K. Y. and Clark, D. P. (1989) 'Mutants of Escherichia coli deficient in the fermentative lactic dehydrogenase', J.Bacteriol., 171 (1 ), pp. 342-348.
Mazur, R. H. (1984) 'Discovery of Aspartame', in Stegink, L. D. and Filer Jr., L. J. (eds) Aspartame: Physiology and Biochemistry. CRC Press, pp. 3-10.
Meiswinkel, T. M., Rittmann, D., Lindner, S. N. and Wendisch, V. F. (2013) 'Crude glycerol- based production of amino acids and putrescine by Corynebacterium glutamicum', Bioresource Technology, 145, pp. 254-258. doi: 10.1016/j.biortech.2013.02.053.
Meldrum, B. S. (2000) 'Glutamate as a neurotransmitter in the brain: review of physiology and pathology.', The Journal of nutrition, 130(4S Suppl), p. 1007S-15S. doi: 10736372.
Mimitsuka, T., Sawai, H., Hatsu, M. and Yamada, K. (2007) 'Metabolic engineering of Corynebacterium glutamicum for cadaverine fermentation', Bioscience, Biotechnology, and Biochemistry, 71 (9), pp. 2130-2135. doi: 10.1271/bbb.60699.
Misawa, N., Kajiwara, S., Kondo, K., Yokoyama, A., Satomi, Y., Saito, T., Miki, W. and Ohtani, T. (1995) 'Canthaxanthin biosynthesis by the conversion of methylene to keto groups in a hydrocarbon beta-carotene by a single gene.', Biochemical and biophysical research communications, pp. 867-76. doi: 10.1006/bbrc.1995.1579.
Misawa, N., Satomi, Y., Kondo, K., Yokoyama, A., Kajiwara, S., Saito, T., Ohtani, T. and Miki, W. (1995) 'Structure and functional analysis of a marine bacterial carotenoid biosynthesis gene cluster and astaxanthin biosynthetic pathway proposed at the gene level', Journal of Bacteriology, 177(22), pp. 6575-6584.
Mortensen, A. and Skibsted, L. H. (1997) 'Importance of Carotenoid Structure in Radical- Scavenging Reactions', Journal of Agricultural and Food Chemistry, 45, pp. 2970-2977. doi: 10.1021/jf970010s.
Mortensen, A., Skibsted, L. H., Sampson, J., Rice-Evans, C. and Everett, S. A. (1997) 'Comparative mechanisms and rates of free radical scavenging by carotenoid antioxidants', FEBS Letters. Federation of European Biochemical Societies, 418(1-2), pp. 91-97. doi: 10.1016/S0014-5793(97)01355-0.
Mueller, U. and Huebner, S. (2003) 'Economic aspects of amino acids production.', Advances in biochemical engineering/biotechnology, 79, pp. 137-70. Available at: http://www.ncbi.nlm.nih.gov/pubmed/12523391 .
Nakayama, K., Kitada, S. and Kinoshita, S. (1961 ) 'Studies on Lysine Fermentation I. the Control Mechanism on Lysine Accumulation By Homoserine and Threonine', The Journal of General and Applied Microbiology, 7(3), pp. 145-154. Available at: http://scholar.google.com/scholar?hl=en&btnG=Search& q=intitle:J.+Gen.+V+App!.#6.
Noguchi, N. ., Niki, E. . and Papas, A. . (1998) 'Chemistry of Active Oxygen Species and Antioxidants', in Papas, A. M. (ed.) Antioxidant status, diet, nutrition, and .... Boca Raton, FL: CRC Press, pp. 3-20.
Norris, S. R., Barrette, T. R. and DellaPenna, D. (1995) 'Genetic dissection of carotenoid synthesis in arabidopsis defines plastoquinone as an essential component of phytoene desaturation.', The Plant cell, 7(December), pp. 2139-2149. doi: 10.1 105/tpc.7.12.2139.
Olaizola, M. and Huntley, M. E. (2003) 'Recent advances in commercial production of astaxanthin from microalgae', Recent Advances in Marine Biotechnology. Volume 9: Biomaterials and Bioprocessing., 9(JANUARY), pp. 143-164. Osborne, T. B. and Mendel, L. B. (1914) 'Amino-Acids in Nutrition and Growth', Journal of Biological Chemistry, 17, pp. 325-349.
Ovie, S. O. and Eze, S. S. (201 1 ) 'Lysine Requirement and its Effect on the Body Composition of Oreochromis niloticous Fingerlings', Fisheries and Aquatic Science, 6(2), pp. 186-193. doi: 10.1 146/annurev.ecolsys.1 10308.120220.
Perez-Garcia, F., Peters-Wend isch, P. and Wendisch, V. F. (2016) 'Engineering Corynebacterium glutamicum for fast production of l-lysine and l-pipecolic acid', Applied Microbiology and Biotechnology. Applied Microbiology and Biotechnology, 100(18), pp. 8075-8090. doi: 10.1007/s00253-016-7682-6.
Peters-Wendisch, P., Gotker, S., Heider, S. A. E., Komati Reddy, G., Nguyen, A. Q., Stansen, K. C. and Wendisch, V. F. (2014) 'Engineering biotin prototrophic Corynebacterium glutamicum strains for amino acid, diamine and carotenoid production', Journal of Biotechnology. Elsevier B.V., 192(PB), pp. 346-354. doi: 10.1016/j.jbiotec.2014.01 .023.
Pfefferle, W., Mockel, B., Bathe, B. and Marx, A. (2003) 'Biotechnological manufacture of lysine.', Advances in biochemical engineering/biotechnology, 79, pp. 59-1 12. doi: 10.1007/3- 540-45989-8_3.
Pfeifer, E., Hijnnefeld, M., Popa, O., Polen, T., Kohlheyer, D., Baumgart, M. and Frunzke, J. (2016) 'Silencing of cryptic prophages in Corynebacterium glutamicum.', Nucleic acids research, pp. 1-15. doi: 10.1093/nar/gkw692.
Porter, J. W. and Anderson, D. G. (1962) 'The biosynthesis of carotenes', Archives of Biochemistry and Biophysics, 97(3), pp. 520-528. doi: 10.1 146/annurev.pp.18.060167.001213.
Radmacher, E., Stansen, K. C, Besra, G. S., Alderwick, L. J., Maughan, W. N., Hollweg, G., Sahm, H., Wendisch, V. F. and Eggeling, L. (2005) 'Ethambutol, a cell wall inhibitor of Mycobacterium tuberculosis, elicits L-glutamate efflux of Corynebacterium glutamicum', Microbiology, 151 (5), pp. 1359-1368. doi: 10.1099/mic.0.27804-0.
Reardon, J. E. and Abeles, R. H. (1986) 'Mechanism of action of isopentenyl pyrophosphate isomerase: evidence for a carbonium ion intermediate.', Biochemistry, 25(19), pp. 5609-16. doi: 10.1021/bi00367a040.
Rodriguez-Concepcion, M. and Boronat, A. (2002) 'Elucidation of the methylerythritol phosphate pathway for isoprenoid biosynthesis in bacteria and plastids. A metabolic milestone achieved through genomics.', Plant physiology, 130(3), pp. 1079-1089. doi: 10.1 104/pp.007138.
Ronen, G., Cohen, M., Zamir, D. and Hirschberg, J. (1999) 'Regulation of carotenoid biosynthesis during tomato fruit development: expression of the gene for lycopene epsilon cyclase is down- regulated during ripening and is elevated in the mutant Delta.', The Plant Journal, 17(4), pp. 341-351 . doi: 10.1046/j.1365-313X.1999.00381.x.
Sahm, H., Antranikian, G., Stahmann, K.-P. and Takors, R. (2013) 'Aminosauren', in Industrielle Mikrobiologie. Springer Spektrum, pp. 109-126.
Sakai, S., Tsuchida, Y., Okino, S., Ichihashi, O., Kawaguchi, H., Watanabe, T., Inui, M. and Yukawa, H. (2007) 'Effect of lignocellulose-derived inhibitors on growth of and ethanol production by growth-arrested Corynebacterium glutamicum R', Applied and Environmental Microbiology, 73(7), pp. 2349-2353. doi: 10.1 128/AEM.02880-06.
Sandmann, G. and Yukawa, H. (2005) 'Vitamin synthesis: carotenoids, biotin and pantothenate. In Handbook of Corynebacterium glutamicum.', in Eggeling, L. and Bott, M. (eds) CRC express journal. Boca Raton, FL: CRC Press, pp. 399-417.
Schafer, A., Tauch, A., Jager, W., Kalinowski, J., Thierbach, G. and Pijhler, A. (1994) 'Small mobilizable multi-purpose cloning vectors derived from the Escherichia coii plasmids pK18 and pK19: selection of defined deletions in the chromosome of Corynebacterium glutamicum' , Gene, 145(1 ), pp. 69-73. doi: 10.1016/0378-1 1 19(94)90324-7.
Schneider, J. and Wendisch, V. F. (2010) 'Putrescine production by engineered Corynebacterium glutamicum', Applied Microbiology and Biotechnology, 88(4), pp. 859-868. doi: 10.1007/s00253-010-2778-x.
Schneider, J., Niermann, K., Wendisch, V.F., 201 1 . Production of the amino acids L- glutamate, L-lysine, L-ornithine and L-arginine from arabinose by recombinant Corynebacterium glutamicum. J. Biotechnol. 154 (2-3), 191-198. Schrumpf, B., Eggeling, L. and Sahm, H. (1992) 'Isolation and prominent characteristics of an L-lysine hyperproducing strain of Corynebacterium glutamicum', Applied Microbiology and Biotechnology, 37(5), pp. 566-571 . doi: 10.1007/BF00240726.
Seibold, G., Auchter, M., Berens, S., Kalinowski, J. and Eikmanns, B. J. (2006) 'Utilization of soluble starch by a recombinant Corynebacterium glutamicum strain: Growth and lysine production', Journal of Biotechnology, 124(2), pp. 381-391. doi: 10.1016/j.jbiotec.2005.12.027.
Seibold, G. M., Wurst, M. and Eikmanns, B. J. (2009) 'Roles of maltodextrin and glycogen phosphorylases in maltose utilization and glycogen metabolism in Corynebacterium glutamicum', Microbiology, 155(2), pp. 347-358. doi: 10.1099/mic.0.023614-0.
Shiio, B. I., Otsuka, S. and Takahashi, M. (1962) 'Effect of Biotin on the Bacterial Formation of Glutamic Acid As the biotin concentration in the culture Effect of Biotin on Glutamate Formation medium increased , the amount of L-glutamate produced in the medium decreased , but the of glutamate in the ace', 51 (1 ).
Simon, R., Priefer, U. and Puhler, A. (1983) Ά Broad Host Range Mobilization System for In Vivo Genetic Engineering: Transposon Mutagenesis in Gram Negative Bacteria', Nat Biotechnol, 1 (9), pp. 784-789. doi: 10.1038/nbt1 183-784.
Song, Y., Matsumoto, K., Tanaka, T., Kondo, A. and Taguchi, S. (2013) 'Single-step production of polyhydroxybutyrate from starch by using oamylase cell-surface displaying system of Corynebacterium glutamicum', Seibutsu-kogaku Kaishi, 1 15(1 ), pp. 12-14. doi: 10.1016/j.jbiosc.2012.08.004.
Spektrum - Lexikon der Biochemie (1999) Astaxanthin. Available at: http://www.spektrum.de/lexikon/biochemie/astaxanthin/609 (Accessed: 18 October 2016).
Spektrum - Lexikon der Biologie (1999a) Astaxanthin. Available at: http://www.spektrum.de/lexikon/biologie/astaxanthin/5587 (Accessed: 18 October 2016).
Spektrum - Lexikon der Biologie (1999b) Lysin. Available at: http://www.spektrum.de/lexikon/biologie/lysin/40375 (Accessed: 31 October 2016).
Spektrum - Lexikon der Biologie (1999c) Minimumgesetz. Available at: http://www.spektrum.de/lexikon/biologie/minimumgesetz/43184 (Accessed: 7 November 2016).
Spektrum - Lexikon der Chemie (1998) Lysin. Available at: http://www.spektrum.de/lexikon/chemie/l-lysin/5499 (Accessed: 31 October 2016).
Sutcliffe, J. G. (1979) 'Complete nucleotide sequence of the Escherichia coii plasmid pBR322', Cold Spring Harbor Symposia on Quantitative Biology, 43(1 ), pp. 77-90. doi: 10.1 101/SQB.1979.043.01 .013.
Thulasiram, H. V, Erickson, H. K. and Poulter, C. D. (2007) 'Chimeras of Two Isoprenoid Synthases in Isoprenoid Biosynthesis', Science, 73(2007), pp. 73-76. doi: 10.1 126/science.1 137786.
Tobias, A. V. and Arnold, F. H. (2006) 'Biosynthesis of novel carotenoid families based on unnatural carbon backbones: A model for diversification of natural product pathways', Biochimica et Biophysica Acta (BBA) - Molecular and Cell Biology of Lipids, 1761 (2), pp. 235-246. doi: 10.1016/j.bbalip.2006.01 .003.
Tsuchidate, T., Tateno, T., Okai, N., Tanaka, T., Ogino, C. and Kondo, A. (201 1 ) 'Glutamate production from β-glucan using endoglucanase-secreting Corynebacterium glutamicum', Applied Microbiology and Biotechnology, 90(3), pp. 895-901. doi: 10.1007/s00253-01 1 - 31 16-7.
Uhde, A., Youn, J. W., Maeda, T., Clermont, L, Matano, C, Kramer, R., Wendisch, V. F., Seibold, G. M. and Marin, K. (2013) 'Glucosamine as carbon source for amino acid- producing Corynebacterium glutamicum', Applied Microbiology and Biotechnology, 97(4), pp. 1679-1687. doi: 10.1007/s00253-012-4313-8.
Unthan, S., Baumgart, M., Radek, A., Herbst, M., Siebert, D., Brijhl, N., Bartsch, A., Bott, M., Wiechert, W., Marin, K., Hans, S., Kramer, R., Seibold, G., Frunzke, J., Kalinowski, J., Ruckert, C, Wendisch, V. F. and Noack, S. (2015) 'Chassis organism from Corynebacterium glutamicum - a top-down approach to identify and delete irrelevant gene clusters', Biotechnology Journal, 10(2), pp. 290-301 . doi: 10.1002/biot.201400041 .
Vershinin, A. (1999) 'Biological functions of carotenoids - diversity and evolution', BioFactors (Oxford, England), 10(2-3), pp. 99-104. doi: 10.1002/biof.5520100203.
Wendisch, V.F., Jorge, J.M., Perez-Garcia, F., Sgobba, E., 2016b. Updates on industrial production of amino acids using Corynebacterium glutamicum. World J. Microbiol. Biotechnol. 32 (6), 105.
Wink, M. (201 1 ) 'Biokatalyse in der chemischen Industrie: Konzepte, Methoden und Anwendungen', in Molekulare Biotechnologie. 2nd edn. Weinheim: Wiley-VCH, pp. 481-504.
Wisniewska, A. and Subczynski, W. K. (1998) 'Effects of polar carotenoids on the shape of the hydrophobic barrier of phospholipid bilayers', Biochimica et Biophysica Acta - Biomembranes, 1368(2), pp. 235-246. doi: 10.1016/S0005-2736(97)00182-X.
Wu, G. (2009) 'Amino acids: Metabolism, functions, and nutrition', Amino Acids, 37(1 ), pp. 1- 17. doi: 10.1007/s00726-009-0269-0.
Yokota, A. and Lindley, N. (2005) 'Central Metabolism: Sugar Uptake and Conversion.', in Eggeling, L. and Bott, M. (eds) Handbook of Corynebacterium glutamicum. Boca Raton, FL: CRC Press, pp. 215-240. doi: 10.1201/9781420039696.pt5.