PLECKAITYTE MILDA (LT)
MISTINIENE EDITA (LT)
ZVIRBLYTE GITANA (LT)
PETREIKYTE INDRE (LT)
LEIVA AUDRIUS (LT)
STIRKE ARUNAS (LT)
ZVIRBLIS GINTAUTAS (LT)
WO1992004455A1 | 1992-03-19 | |||
WO1992006116A1 | 1992-04-16 | |||
WO2013022328A1 | 2013-02-14 | |||
WO2011147319A1 | 2011-12-01 | |||
WO2005044296A1 | 2005-05-19 | |||
WO2001003737A1 | 2001-01-18 | |||
WO2008006899A1 | 2008-01-17 | |||
WO2005044296A1 | 2005-05-19 | |||
WO2005049062A1 | 2005-06-02 | |||
WO2002014023A1 | 2002-02-21 | |||
WO1992006116A1 | 1992-04-16 | |||
WO1994017185A1 | 1994-08-04 | |||
WO1997012985A2 | 1997-04-10 |
US20070081979A1 | 2007-04-12 | |||
CN100336907C | 2007-09-12 | |||
EP1689420A1 | 2006-08-16 | |||
EP1660115A1 | 2006-05-31 | |||
EP0992579A1 | 2000-04-12 | |||
EP1817047A2 | 2007-08-15 | |||
US6730303B1 | 2004-05-04 |
KUEN-JER TSAI ET AL.: "JEM", vol. 204, June 2007, THE ROCKEFELLER UNIVERSITY PRESS, article "G-CSF rescues the memory impairment of animal models of Alzheimer's disease", pages: 1273 - 1280
TSUNG-MING LEE ET AL.: "Granulocyte colony-stimulating factor increases sympathetic reinnervation and the arrhythmogenic response to programmed electrical stimulation after myocardial infarction in rats", AM J PHYSIOL HEART CIRC PHYSIOL, vol. 297, 2009, pages H512 - H522
T. FRANK ET AL.: "Both systemic and local application of Granulocyte- colony stimulating factor (G-CSF) is neuroprotective after retinal ganglion cell axotomy", BMC NEUROSCIENCE, 2009
AUREL POPA-WAGNER ET AL.: "Effects of granulocyte-colony stimulating factor after stroke in aged rats", STROKE, vol. 41, 2010, pages 1027 - 1031
ZHANG ET AL.: "Granulocyte colony-stimulating factor increases the therapeutic efficacy of bone marrow mononuclear cell transplantation in cerebral ischemia in mice", BMC NEUROSCIENCE, vol. 12, 2011, pages 61, XP021102778, DOI: doi:10.1186/1471-2202-12-61
I. BOEDER ET AL.: "Interactions of Erythropoietin, Granulocyte Colony-Stimulating Factor, Stem Cell Factor, and Interleukin-11 on Murine Hematopoiesis During Simultaneous Administration", BLOOD, vol. 91, no. 9, 1 May 1998 (1998-05-01), pages 3222 - 3229
S. BRADLEY FORLOW ET AL.: "Increased granulopoiesis through interleukin-17 and colony-stimulating factor in leukocyte adhesion molecule -deficient mice", BLOOD, vol. 98, no. 12, 1 December 2001 (2001-12-01), XP055052515, DOI: doi:10.1182/blood.V98.12.3309
J. A. GLASPY ET AL.: "Peripherial Blood Progenitor Cell Mobilization using Stem Cell Factor in Combination with Filgrastim in Breast Cancer Patients", BLOOD, vol. 90, 1997, pages 2939 - 2951
C. H. MOSKOWITZ ET AL.: "Recombinant Metionyl Human Stem Cell Factor and Filgrastim for Peripheral Blood Progenitor Cell Mobilization and Transplantation", BLOOD, vol. 89, no. 9, 1997, pages 3136 - 3147
L.B. TO ET AL.: "Stem cell mobilization Successful mobilization of peripheral blood stem cells after addition of ancestim (stem cell factor) in patients who had failed a prior mobilization with filgrastim (granulocyte colony-stimulating factor) alone or with chemotherapy plus filgrastim", BONE MARROW TRANSPLANTATION, vol. 31, 2003, pages 371 - 378
M. T. KUHLMANN ET AL.: "G-CSF/SCF reduces inducible arrhythmias in the infarcted heart potentially via increased connexin43 expression and arteriogenesis", JEM, vol. 203, 2006, pages 87 - 97, XP002571921, DOI: doi:10.1084/jem.20051151
H. KANADA ET AL.: "Administration of hematopoietic cytokines in the subacute phase after cerebral infarction Is effective for functional recovery facilitating proliferation of intrinsic neural stem/progenitor cells and transition of bone marrow-derived neuronal cells", CIRCULATION, vol. 113, 2006, pages 701 - 710, XP002482803, DOI: doi:10.1161/CIRCULATIONAHA.105.563668
LI-RU ZHAO ET AL.: "Brain repair by hematopoietic growth factors in a rat model", STROKE, vol. 38, 2007, pages 2584 - 2591, XP002482802, DOI: doi:10.1161/STROKEAHA.106.476457
Z. E. TOTH ET AL.: "The combination of granulocyte colony-stimulating factor and stem cell factor significantly increases the number of bone marrow-derived endothelial cells in brains of mice following cerebral ischemia", BLOOD, vol. 111, no. 12, 2008
B. LI ET AL.: "Stem cell factor and granulocyte colony-stimulating factor reduce f3 -amyloid deposits in the brains of APP/PS1 transgenic mice", ALZHEIMER RESEARCH & THERAPY, vol. 3, 2011, pages 8, XP021097549, DOI: doi:10.1186/alzrt67
G. STOKMAN ET AL.: "Hematopoietic Stem Cell Mobilization Therapy Accelerates Recovery of Renal Function Independent of Stem Cell Contribution", J AM SOC NEPHROL, vol. 16, 2005, pages 1684 - 1692, XP009143024, DOI: doi:10.1681/ASN.2004080678
T. CHEN ET AL.: "Design of recombinant stem cell factor-macrophage colony stimulating factor fusion proteins and their biological activity in vitro", JOURNAL OF COMPUTER-AIDED MOLECULAR DESIGN, vol. 19, 2005, pages 319 - 328, XP019248178
OSHIMA ET AL.: "Biological activity of human granulocyte colony stimulating factor with a modified C-terminus", BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS, vol. 267, 2000, pages 924 - 927
J. N. COX ET AL.: "Enhanced circulating half-life and hematopoietic properties of a human granulocyte colony-stimulating factor/immunoglobulin fusion protein", EXPERIMENTAL HEMATOLOGY, vol. 32, 2004, pages 441 - 449, XP003006681, DOI: doi:10.1016/j.exphem.2004.01.012
Y. BAI; W.-C.SHEN: "Improving the oral efficacy of recombinant granulocyte colony-stimulating factor and transferin fusion protein by spacer optimization", PHARMACEUTICAL RESEARCH, vol. 23, no. 9, September 2006 (2006-09-01)
U. ERBEN ET AL.: "Differential effects of a stem cell factor-immunoglobulin fusion protein on malignant and normal hematopoietic cells", CANCER RES., vol. 59, 15 June 1999 (1999-06-15), pages 2924 - 2930
Y. ZANG ET AL.: "A novel thrombopoietin-stem-cell factor fusion protein possesses enhanced potential in stimulating megakaryocyte proliferation and differentiation", BIOTECHNOL. APPL. BIOCHEM., vol. 48, 2007, pages 135 - 142
T. CHEN ET AL.: "Expresion of a novel recombinant stem cell factor/macrophage-colony stimulating factor fusion protein in baculovirus - infected insect cells", PROTEIN EXPR. PURIF., vol. 41, 2005, pages 402 - 408, XP004875131, DOI: doi:10.1016/j.pep.2005.02.009
J. HAN ET AL.: "Expression of a novel recombinant dual human stem cell factor in insect cells", PROTEIN EXPR. PURIF, vol. 31, 2003, pages 311 - 317, XP004462738, DOI: doi:10.1016/S1046-5928(03)00214-6
WEINSTEIN Y; IHLE JN; LAVU S; REDDY EP: "Truncation of the c-myb gene by retroviral integration in an interleukin 3-dependent myeloid leukemia cell line", PROC. NATL. ACAD. SCI. USA, vol. 83, 1986, pages 5010 - 5014
CLAIMS: 1. Fused protein which is heteromultimer of granulocyte colony-stimulating factor with other growth factor, of general formula (I) (X - L)a - X - L - GCSF -(L - GCSF)b (I) wherein L is a linker sequence, X is any growth factor selected from the group consisting of SCF, GM-CSF, M-CSF, EPO, IL-3, IL-6 and IL-1 1 , a is integer equal to 0-4; b is integer equal to 0-4, and the amino acid sequences of monomeric chains are identical by at least 95% to amino acid sequences of corresponding native proteins. 2. The fused protein according to claim 1 of the general formula (I), wherein X denotes SCF, a is equal to 0 and b is equal to 0, and the linker sequence L is selected from the group of amino acid sequences, consisting of (S-G4)n, wherein n=2-8 and SGLEA- (EAAAK)m-ALEA-(EAAAK)m-ALEGS, wherein m=2-8. 3. The fused protein according to claim 2, wherein linker sequence L is selected from the group of amino acid sequences, consisting of SEQ ID NO: 1 , SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 5. 4. The fused protein according to any one of claims 1-3, wherein amino acid sequence is selected from the group, consisting of sequences SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9 and SEQ ID NO:10. 5. The fused protein according to any one of preceding claims, characterized by extended circulation half-life in vivo and synergetic activity. 6. Fragment of recombinant DNA encoding fused protein according to claims 1-5. 7. The fragment of recombinant DNA according to claim 6 wherein coding sequence is selected from the group, consisting of sequences SEQ ID NO: 11 , SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14 and SEQ ID NO: 15. 8. Method for preparation of heterodimer protein of granulocyte colony-stimulating factor and stem cell factor according to any one of claims 2-5 comprising the following steps: a) construction of DNA fragment, encoding target protein and preparation of bacterial strain-producer; b) cultivation of strain-producer which cells comprise DNA sequence, encoding target protein in a suitable culture medium c) lysis of the microorganism of producer and separation of the fraction of insoluble target proteins; d) solubilization of the fraction of insoluble proteins; e) renaturation of the target protein; f) purification of the target protein, characterized in that: target protein is genetically fused protein according to claims 2-5; - strain-producer in step b) is cultivated under conditions, suitable for expression of the heterodimer construction of said genetically fused protein; - fraction of insoluble proteins in step d) is solubilized in a buffer solution containing urea as chaotropic agent and dithiothreitol as reducing agent, - renaturation of heterodimer in step e) is oxidative renaturation in a buffer solution containing intermediate urea concentration in the presence of dithiothreitol (DTT) as reducing agent and oxidized glutathione (GSSG) as oxidizing agent, renatured target protein in step f) is purified by sequential anion-exchange chromatography with a further mixed-mode . chromatography and cation-exchange chromatography. 9. The method according to claim 8, characterised in that said renaturation of heterodimer protein is performed in a buffer solution of pH 7.5 - 8.5 containing 2M urea in the presence of dithiothreitol and oxidized glutathione in molar ratio DTT:GSSG 5-1 :1-5; preferably in a buffer solution at pH 8.0 and DTT.GSSG molar ratio 1 :5. 10. The method according to claim 8 or claim 9 characterized in that in step f) said anion-exchange chromatography is performed on DEAE-Sepharose FF sorbent at pH 7.0 - 8.5, preferably at pH 7.5, applying step-wise elution mode; said mixed-mode chromatography is performed on CHT hydroxyapatite sorbent at pH 6.5 - 7.5, preferably at pH 7.2; said cation-exchange chromatography is performed on SP-Sepharose FF sorbent at pH 4.5 - 5.2, preferably at pH 4.7; obtained protein solution being concentrated and stored in acetic acid/NaOH buffer solution. 1 1. The method according to any of claims' 8-10 characterized in that in step a) said DNA fragment, encoding target genetically fused protein according to claims 2-5, is inserted into expression plasmid pET21 b and selected plasmids are transformed into bacterial E. coli BL21(DE3) strain-producer, and in step b) said producer is cultivated in LB medium at 37°C temperature up to optical density (OD60onm) 0,8-1 ,2, using isopropyl-P-D- thiogalactopyranoside (IPTG) as inductor. 12. Fused SCF-GCSF protein obtained by the method of claims 8-11. 13. The fused protein according to claim 12 for use in therapy. 14. Pharmaceutical composition, comprising an active ingredient and a pharmaceutically acceptable carrier, diluent, excipient and/or auxiliary substances, characterized in that the active ingredient comprises therapeutically effective amount of fused protein according to any one of claims 1-5 or claims 12-13. |
This invention belongs to the field of protein biotechnology and is designated for production of protein of therapeutic value. Actually, the present invention provides the possibility of preparation of genetically fused heteromultimers of granulocyte colony-stimulating factor (G- CSF) with other partners of hematopoietic growth factors acting synergistically with G-CSF, which multimer constructions are characterized by longer circulation half-life comparing with each monomer protein in separate state. More particularly, the present invention relates to heterodimer of granulocyte colony-stimulating factor comprising monomer unit of granulocyte colony-stimulating factor connected genetically via the linker of defined length to the monomer unit of stem cell factor (SCF), as well as with efficient isolation and purification of biologically active G-CSF - SCF heterodimer protein produced. The present invention also relates to a synthetic gene coding for heterodimer form of G-CSF with SCF containing • linker of defined length between both monomer units for the expression in host cells.
Background of the invention
In the present application the term "protein of therapeutic value" means pharmacologically active protein produced through genetic engineering, including mammalian antibodies, blood product substitutes, vaccines, hormones, cytokines. To be efficacious, protein drugs are used in concentrations and under conditions which differ markedly from their native partners and this may lead to undesirable effects in vivo. To avoid or minimize toxicity and to increase efficacy both the physicochemical and biological properties of proteins are being altered generally by some form of protein modification e.g., covalent conjugation with other macromolecules; antibody binding, mutagenesis and/or glycosylation.
The term "hematopoietic growth factor" designates one of a group of proteins, such as erythropoietin, interleukins, and colony-stimulating factors, which promote the proliferation of blood cells.
The term "biologically active protein" means the protein molecule which exhibits the same detectable biological activity as the respective naturally occurring protein. The term "monomer unit" (in, e.g. multimer proteins) means a polypeptide chain of naturally occurring biologically active protein.
The term "heteromultimer" stands for a linear polypeptide chain comprising at least two different biologically active polypeptide units which are connected to each other via peptide linker sequence in such a manner that possibility of intermolecular disulfide bonds between polypeptide chains is minimal.
The term "genetically fused" means that heteromultimer protein is obtained using recombinant DNA methodology: DNA fragment, constructed of two genes, encoding monomer proteins via linker DNA sequence, are inserted into the vector for expression of the protein in the selected cell line. The resulting recombinant protein, consisting from monomer proteins connected with linker peptide, (which protein could be isolated by applying special purification procedures) clearly differs from both "chemically conjugated" protein that is obtained by chemical joining of two or more monomer proteins using specific chemical methods and from "chemically modified" protein that is obtained by chemical modification of monomer protein using chemical agents or polymer residues.
The term "synergistic effect" or "synergy" means such joint action of two drugs, where one thereof supplements or enhances the action of the other to produce an efficiency greater than that obtained with equivalent quantity of either one of the drugs or to produce effects that could not be obtained with any safe quantity of either or both preparations. Acting in synergy two or more pharmaceuticals are able to produce greater effect, than the sum of individual effects thereof.
Over the last decades the use of therapeutic proteins produced by recombinant DNA technique have expanded remarkably Annual volumes of traditional biopharmaceutical products like insulin, erythropoietin (EPO), growth hormone (hGh), interferons (IFN), granulocyte (macrophage) colony-stimulating factors (G-CSF, GM-CSF) already exceeded tens billions of dollars and continues to increase. During the last years it has been revealed new clinical indications as well as new therapeutic use by using combination therapy of several proteins.
It has been known for a more than three decades that hematopoiesis is controlled by very specific factors, acting the early cells in the hematopoietic system to convert them into functional cells. The isolation from natural sources, purification and cloning of these factors have discovered a new class of therapeutic agents, including the colony-stimulating factors and interleukins.
One of them, the granulocyte colony-stimulating factor (G-CSF), specifically acts on 5 neutrophils, the body's major defense system against infections. The bacterially produced form thereof under the generic name„'Filgrastim"(r-metHuG-CSF) has opened wide range of therapeutical uses for ameliorating neutropenia, one of the dominant side effects of cancer chemotherapy. Its use has allowed to reduce the risk of infections for cancer patients. Besides chemotherapy-induced neutropenia, Filgrastim has been approved for the
10 treatment of myelosuppression after bone marrow transplantation, severe chronic neutropenia, acute leukemia, aplastic anemia, myelodysplastic syndromes. Filgrastim is also known for use in transplantation of peripheral blood progenitor cells [see for review: Karl Welte, Janice Gabrilove, Miguel H. Bronchud, Erich Platzer, and George Morstyn, Filgrastim (r-metHuG-CSF): the first 10 years. Blood, Vol 88, No 6 (September 15), 1996: pp 1907-
15 1929]. The range of G-CSF indications is expanding and combination therapeutic effect thereof with others cytokines are extensively investigated discovering new areas of potential clinical application of G-CSF.
Currently various G-CSF application areas are known:
- besides its major indication in treating of chemotherapy-induced neutropenia, 0 it has been suggested as a novel, noninvasive therapeutic agent for the treatment of
Alzheimer's disease [Kuen-Jer Tsai et al, G-CSF rescues the memory impairment of animal models of Alzheimer's disease. JEM. The Rockefeller University Press ,Vol. 204, No. 6, June 11 , 1273-1280, 2007];
- the use of G-CSF polypeptide as well together with additional growth factors, 5 including SCF, is described for prevention of myocardial infarction or for treating of the latter and other ischemic disorders, especially in treatment of acute myocardial infarction [WO2005044296 (prior. 2003-10-27)];
- It has been published that G-CSF mobilized progenitor cells are not only capable of tissue differentiation but are also likely to regenerate the myocardium, resulting in 0 improved cardiac function [Tsung-Ming Lee et al. Granulocyte colony-stimulating factor increases sympathetic reinnervation and the arrhythmogenic response to programmed electrical stimulation after myocardial infarction in rats. Am J Physiol Heart Circ Physiol 297, H512-H522, 2009];
- G-CSF is a potential clinical treatment option for both neurodegenerative 5 diseases and glaucoma [T. Frank et al. Both systemic and local application of Granulocyte- colony stimulating factor (G-CSF) is neuroprotective after retinal ganglion cell axotomy. BMC Neuroscience 2009];
- the use of G-CSF or fragments thereof in pharmaceutical composition for treating of organs dysfunction caused by ischemia is disclosed in patients subjected to a surgical or other interventional procedure in order to improve blood flow and/or to induce revascularization [WO2005049062 / EP1689420 (prior. 2003-10-27)];
- G-CSF was found to promote brain neurogenesis in mature animals after stroke [Aurel Popa-Wagner et al, Effects of granulocyte-colony stimulating factor after stroke in aged rats Stroke 2010, 41 : 1027-1031];
- G-CSF can increase the therapeutic efficacy of BMMCs transplantation in an experimental mouse model of cerebral ischemia [Zhang et al. Granulocyte colony- stimulating factor increases the therapeutic efficacy of bone marrow mononuclear cell transplantation in cerebral ischemia in mice. BMC Neuroscience 201 1 , 12:61];
- disclosed is the use of combined pharmaceutical preparation of G-CSF and placental growth factor in mobilization of blood stem cells [WO2002014023/EP 16601 15
(prior. 2003-07-29)].
Combination therapy
Hematopoietic growth factors have redundant properties, i.e, different factors can lead to the same effect. In addition, they are pleiotropic, meaning that one cytokine is able to mediate different effects. For a detailed understanding of the quantitative features of the cytokine network in vivo, it is important to understand how much and in which way single cytokine effects are affected by other cytokines, and how far this is concentration-dependent. With regard to this it has been reported about the in vivo effects of a combined administration, investigating all possible combinations of erythropoietin (EPO), G-CSF, stem-cell factor (SCF), and interleukin-1 1 (IL-11 ). The authors [ I. Boeder et al. Interactions of Erythropoietin, Granulocyte Colony-Stimulating Factor, Stem Cell Factor, and lnterleukin-1 1 on Murine Hematopoiesis During Simultaneous Administration. Blood, Vol 91 , No 9 (May 1 ), pp 3222- 3229, 1998] showed that cytokine dose-response characteristics in vivo are modified in a quantitative and, in few cases, in a qualitative way by other cytokine added. This suggested for more justified applications of combined cytokine therapies.
Some cytokines such as GM-CSF, SCF, IL-3, IL-6, IL-1 1 have been shown to stimulate granulopoiesis, however with efficiencies less than that of G-CSF , and to act synergistically with G-CSF to stimulate maximum granulopoiesis [S. Bradley Forlow et al. Increased granulopoiesis through interleukin-17 and colony-stimulating factor in leukocyte adhesion molecule -deficient mice. /Blood 1 December, 2001 Volume 98, Number 12, 2001].
Among the listed partners of such hematopoietic growth factors, in the present invention the primary attention is paid for human stem cell factor (SCF) which synergistic effect with G- CSF provides new possibilities for use of combination thereof in clinic. As it is well known, both proteins are used for the treatment of neutropenia in oncologic patients after applying of chemotherapy or in bone marrow transplantation to restore the normal number of neutrophils (granulocytes). It has been established that joint effect of treatment with both individual proteins, is significantly better in comparison with treatment with separate proteins. Synergistic effect is shown on the recombinant form of both SCF and G-CSF [J. A. Glaspy et al. Peripherial Blood Progenitor Cell Mobilization using Stem Cell Factor in Combination with Filgrastim in Breast Cancer Patients. Blood, vol. 90, pp 2939-2951 , 1997/C. H. Moskowitz et al, Recombinant Metionyl Human Stem Cell Factor and Filgrastim for Peripheral Blood Progenitor Cell Mobilization and Transplantation, Blood, Vol 89, No 9, pp.3136-3147, 1997].
Patent EP0992579 (prior.1989-10-16 etc.) discloses stem cell factor (SCF), the method of obtaining thereof, pharmaceutical composition and various methods for treatment of such conditions as leucopenia, thrombocytopenia, anemia, methods for enhancing bone marrow recovery in treatment of radiation, chemotherapy-induced bone marrow aplasia or myelosuppression. SCF is useful alone or in combination with one or more additional hematopoietic factors, such as EPO, G-CSF, GM-CSF, and various interleukins from IL-1 to IL-11 , IGF or LIF in the treatment of hematopoietic disorders. It is known that recombinant form of human SCF seems capable of enhancing either filgrastim or chemotherapy in combination with filgrastim mobilizations. The mobilized cells are capable of rapid hematopoietic reconstitution [L.B. To et al. Stem cell mobilization Successful mobilization of peripheral blood stem cells after addition of ancestim (stem cell factor) in patients who had failed a prior mobilization with filgrastim (granulocyte colony- stimulating factor) alone or with chemotherapy plus filgrastim. Bone Marrow Transplantation (2003) 31 , 371-378].
EP1817047 (prior. 2004-11-05) discloses the use of granulocyte colony stimulating factor (G-CSF) polypeptide, alone or in combination with stem cell factor (SCF) polypeptide, in the prevention or treatment of brain diseases after cerebral ischemia or neurological disorder. Initial preclinical and clinical trials have demonstrated that the transfer of bone marrow (BM)- derived stem and precursor cells into the infarcted myocardium can improve left ventricular systolic function. Similar results were obtained by the application of G-CSF alone or in combination with SCF [M. T. Kuhlmann et al. G-CSF/SCF reduces inducible arrhythmias in the infarcted heart potentially via increased connexin43 expression and arteriogenesis. JEM vol. 203, 2006 87-97].
Combination therapy by G-CSF and SCF after cerebral ischemia is effective for functional recovery, using the cytokine-induced generation of neuronal cells from both bone marrow- derived cells and intrinsic neural stem/progenitor cells. Because G-CSF and SCF are available for clinical use, these findings suggest a new therapeutic strategy for stroke treatment [ H. Kanada et al. Administration of hematopoietic cytokines in the subacute phase after cerebral infarction Is effective for functional recovery facilitating proliferation of intrinsic neural stem/progenitor cells and transition of bone marrow-derived neuronal cells. Circulation 2006, 113:701 -710].
SCF and G-CSF are neuroprotective and beneficial to functional restoration when administered during the acute phase after brain ischemia, indicating hematopoietic growth factors really play a role in brain repair [Li-Ru Zhao et al. Brain repair by hematopoietic growth factors in a rat model /Stroke, 2007, 38: 2584-2591 ; Z. E. Toth et al. The combination of granulocyte colony-stimulating factor and stem cell factor significantly increases the number of bone marrow-derived endothelial cells in brains of mice following cerebral ischemia. Blood, 2008, vol. 1 1 1 , No 12]. Systemic administration of SCF together with G-CSF to transgenic mice, carrying amyloid precursor, leads to long-term reduction of β-amyloid deposition in the brain. This provides insights into the contribution of the hematopoeitic growth factors, SCF and G-CSF, to limit β- amyloid accumulation in Alzheimer disease (AD) and may offer a new therapeutic approach, for AD [B. Li et al. Stem cell factor and granulocyte colony-stimulating factor reduce β -amyloid deposits in the brains of APP/PS1 transgenic mice. Alzheimer Research & Therapy 2011 , 3:8].
One of the first attempts of stem cell-based therapy using SCF and G-CSF in the treatment of renal ischemia/reperfusion was described in G. Stokman et al. Hematopoietic Stem Cell Mobilization Therapy Accelerates Recovery of Renal Function Independent of Stem Cell Contribution. J Am Soc Nephrol 16: 1684-1692, 2005. Therefore, the clinical indications of G-CSF and its combination therapy with SCF suggested large possibilities for application of these both therapeutically important protein. However, it is worth attention that both cytokines have not been used yet in the form of single dosage form. In this respect the aim of present invention is to provide new individual substance and - on the base thereof - new "biobetter" pharmaceutical preparation in the form of heteromultimer (heterodimer) construction, containing properly connected monomer units of both proteins into one entity, seeking of :
- maximally retained biological activity of both heteromultimer (heterodimer) partners; -extended circulation half-life in vivo;
-possibly gained new synergistic activity of the whole heteromultimer (heterodimer) construction as well as possible new therapeutic indications;
-lower costs using one entity instead of two separate preparations. Fused proteins
Some attempts to obtain heterodimer constructions of different growth factors are described in scientific and patent literature. WO9206116 (prior.1990-09-29) discloses a recombinant hematopoietic molecule comprising a first hematopoietic molecule having early myeloid differentiation activity and a second hematopoietic molecule having later myeloid differentiation activity. In a preferred embodiment of the invention, the first hematopoietic molecule (IL-3 or GM-CSF) is linked to the second hematopoietic molecule (EPO, G-CSF, IL-5 or M-CSF) by an amino acid linker sequence comprising at least two amino acid residues. In particular, IL-3-G-CSF hybrid growth factor was reported to stimulate AML193 cell proliferation to a greater extent than did the mixture of the two cytokines.
However the two cytokine activities were neither synergistic, nor were they additive. The PK/PD profile of this constructs is not provided and it is not clear whether this construct exhibit longer circulation half-life.
W09417185 (prior. 1993-01-28) discloses G-CSF analogues, having modified amino acid residues in the protein sequence, the chemically modified derivatives thereof and hybrid molecule with interleukin attached. No data provided regarding synergy of both cytokine partners or prolonged activity of hybrid construction.
W097 2985 or US6730303 (prior. 1995-10-05) describes hematopoietic molecule comprising modified biologically active G-CSF molecule connected directly or via various amino acid linkers with modified derivatives of biologically active IL-3 molecule and the use of such derivatives for stimulation of growth of hematopoietic cells. However the pK/pD profiles for such constructions are not provided and no data provided whether activity of both cytokines is synergistic. It is not clear whether such molecule demonstrates longer circulation half-life time.
Several attempts to construct derivatives of hematopoietic cytokines fused via linker amino acid sequence to obtain dual function are also reported in non-patent publications. The publication T. Chen et al., Design of recombinant stem cell factor-macrophage colony stimulating factor fusion proteins and their biological activity in vitro. Journal of computer- aided molecular design (2005) 19: 319-328, 2005 refers to fused cytokine constructions - IL- 3/GM-CSF, EPO/IL-3, GM-CSF/EPO etc. with a notice that some of them were properly designed to improve function of fusion partners and even exhibited new functionalities due to synergy.
However some of fusion proteins were designed unsuccessfully and their activity was lower than expected. The reason may be non proper choice of the linker sequence or non proper order of partners bonded into fusion which may cause unfavourable steric hindrance. In this context it has been shown that the modification of C-terminus part of G-CSF molecule by fusing with SCF via its Lys 148 residue has no impact neither on G-CSF biological activity nor for proliferation test [Oshima et al., Biological activity of human granulocyte colony stimulating factor with a modified C-terminus. Biochemical and Biophysical Research Communications 267, 924-927, 2000]. In opposite, the modification of N-terminus part of G- CSF by linking for example inactive diphtheria toxin leads to the decrease by 200 times the ability of the protein to stimulate formation of granulocyte colonies and thereby confirms that N-terminus part of G-CSF is important for binding with receptor.
Fused G-CSF-lgG-Fc and G-CSF-lgG-C H proteins in which immunoglobulin G (IgG) F c and CH parts were connected to G-CSF C-terminus via flexible seven amino acid sequence SGGSGGS were constructed. However the activity of these fusions were 2-3 times lower in comparison to the activity of monomeric G-CSF since G-CSF-lgG-F c and G-CSF-lgG-C H formed homodimeric structures through disulfide bonds between IgG parts [J. N. Cox et al., Enhanced circulating half-life and hematopoietic properties of a human granulocyte colony- stimulating factor/immunoglobulin fusion protein. Experimental Hematology 32 (2004) 441- Some G-CSF fusions with transferin (T f ) were constructed using different linker sequences: LE dipeptide; (GGGGS) 3 ; A(EAAAK) 2 A; A(EAAAK) 3 A; A(EAAAK)4A; A(EAAAK) 4 ALE A(EAAAK)4A peptides.
G-CSF-Tf heterodimer could be adsorbed through the stomach epithelium, however low in vitro activity of this protein may be caused by negative impact of fusion partners on the fusion conformation Heterodimer with the longest a-helical formative linker sequence demonstrated 10 times lower in vitro cell proliferation activity due to interfering domains of heterodimer. Such interference tends to reduce binding of fused protein to G-CSF and T f receptors, thus reducing in vivo myelopoietic effect in animal trials [Y. Bai and W.-C.Shen. Improving the oral efficacy of recombinant granulocyte colony-stimulating factor and transferin fusion protein by spacer optimization [Pharmaceutical Research, Vol. 23, No.9, September 2006].
Several publications also described hybrid molecules of stem cell factor (SCF) with other cytokines:
Fused protein of chimeric recombinant SCF and Fc-portion of human lgG1 have been obtained and demonstrated to be about eight times more potent in stimulating growth factor-dependent proliferation compared with SCF alone [U. Erben, et al., Differential effects of a stem cell factor-immunoglobulin fusion protein on malignant and normal hematopoietic cells, Cancer Res., 59, 2924-2930, June 15, 1999].
Thrombocytopenia is a common problem in patients with cancer and other conditions that affect haematopoietic cells. Although SCF alone does not support megakaryocyte colony formation, it has been shown to have a potent synergistic effect on megakaryopoiesis when combined with thrombopoietin (TPO). The complementary biological effect thereof on megakaryopoiesis encouraged the development of fused TPO- SCF protein with possibly synergetic action. In the heterodimer constructed TPO (1-157 amino acids) and SCF (1-145 amino acids ) are connected via (GSGGGGSGG) peptide linker by head-to-tail mode.
The activity of TPO-SCF was approx. .7 times as high as that of TPO alone, and was approx. 1.2 times as high as that of SCF monomer [Y. Zang et al., A novel thrombopoietin-stem-cell factor fusion protein possesses enhanced potential in stimulating megakaryocyte proliferation and differentiation. Biotechnol. Appl. Biochem. (2007) 48, 135- 142, 2007].
SCF could act in synergy with macrophage colony-stimulating factor (M-CSF) to promote the growth and proliferation of mononuclear phagocytes. Due to this, the fusion of both proteins has been constructed using full-length sequence of SCF polypeptide chain and 1-149 amino acid sequence of M-CSF. Both partners were connected via peptide linker GGGGSGGGGSGG by head-to-tail mode. The specific activity of SCF-M-CSF was 17 times as high as that of monomeric SCF to stimulate the proliferation of TF-1 cell [T. Chen et a!., Expresion of a novel recombinant stem cell factor/macrophage-colony stimulating factor fusion protein in baculovirus - infected insect cells. Protein Expr. Purif., 41 , 402-408, 2005].
SCF homodimer was constructed which consisted of a full-length 165 amino acids polypeptide chain connected via short GGGGSGGGGSGG linker to truncated 1-145 amino acids sequence of SCF by a head-to-tail mode. Biological activity of such homodimer was 8,7 times higher than that of SCF monomer [J. Han et al., Expression of a novel recombinant dual human stem cell factor in insect cells. Protein Expr. Purif . 3 , 311-3 7, 2003].
For above cited G-CSF hybrid constructions with other cytokines any data on the synergy of both cytokine partners and possible effects of extension residence time of hybrid construction are not provided. Prolongation of residence time was observed for G-CSF fusions with IgG or transferin, however in both cases the decrease of G-CSF activity compared to non modified G-CSF monomer form was indicated. For SCF fusions with other cytokines the increase of SCF activity is observed when comparing with monomer form thereof, however there are no indications on residence time of the fusion in serum or possible extension thereof.
Accordingly the main object of the present invention is to propose method for production of "biobetter"' version of biopharmaceutical preparations with improved properties, composed of at least two partners of synergistically acting hematopoietic growth factor by their genetic fusion into heteromultimer, particularly heterodimer, in which both protein partners are connected via linker of defined length. Sequence and structure of the linker is designed to provide ability of each monomer chain to interact with specific receptor of selected therapeutic protein and exhibit as much as possible biological and functional activity of each partner of multimer construction. The molecular mass of heteromultimer construction is increased and constituted the sum of each monomer unit molecular mass plus molecular mass of the linker. Therefore, it is another object of the present invention to provide a heteromultimer construction form of therapeutic proteins of interest possessing longer in vivo circulation half-life than serum- residence time of each separate partner. This could be characteristic feature of biopharmaceuticals produced according to the proposed method. The increase of molecular mass of heteromultimer construction itself does not necessarily leads to the extension of circulation time of the heteromultimer construction with respect to any partner. It is know, for example, that the covalent G-CSF dimmer formed via interchain -S-S- bonds has doubled molecular mass, however its circulation time in serum is the same as for G-CSF monomer. It is a further object of the present invention to provide a heteromultimer form of therapeutic proteins that can be produced by recombinant DNA technology without formation of undesirable dimer and oligomer products, formed by cross-linking via interchain disulfide bonds. It is yet another object of this invention to provide reliable opportunity to obtain not only effect of activity prolongation in vivo but also synergistic activity of two different cytokines, thus extending the therapeutic possibilities (new indications of new dosage form) and in the same time reducing the costs of production due to application of single dosage form instead of two separate therapeutic proteins as it is used now.
Construction of heteromultimer form of two different therapeutic proteins rise serious issues during technology development trying to purify the target construction to the quality level sufficient to meet the requirements specified for pharmaceutical substance. Main steps of process to be invented are not necessary analogous to the step used for the process designed for each individual partner of the heteromultimer construction. The chromatography purification steps which are essential in creation of modern biotechnology processes can vary dramatically due to different chromatographic behavior of the whole construction of heteromultimer comparing to the chromatographic behavior of each individual partner. Besides, molecular mass of the recombinant heteromultimer construction is increased and this rise risk of non-productive aggregation, especially in case of high expression level of the protein, thus resulting in its accumulation in the form of insoluble inclusion bodies. Therefore, technology approaches applied for preparation of monomer protein are no more suitable for isolation and purification of heteromultimeric protein construction. Here serious attention should be paid for the proper selection not only of each process stage but also for the compatibility of whole process steps assuring as high as possible biological activity of the protein partners at the end of purification cycle. So, this proves the necessity of new approaches at the preparation of heteromultimeric proteins. Summary of the Invention
The main object of the present invention is fused proteins which are heteromultimers of granulocyte colony-stimulating factor with other growth factors, of general formula (I) (X - L) a - X - L - GCSF -(L - GCSF) b
(I)
wherein L is a linker sequence, X is any growth factor selected from the group consisting of SCF, GM-CSF, M-CSF, EPO, IL-3, IL-6 and IL-11 , a is integer equal to 0-4; b is integer equal to 0-4, and the amino acid sequences of monomeric chain are identical by at least 95% to amino acid sequences of corresponding native proteins.
In present invention the preference is given for the fused protein of the general formula (I) wherein X denotes SCF, a is equal to 0 and b is equal to 0, and the linker sequence L is selected from the group of amino acid sequences consisting of (S-G 4 ) n , wherein n=2-8 and SGLEA-(EAAAK)m -ALEA-(EAAAK) m -ALEGS, wherein m=2-8.
More preferably the fused protein according to present invention comprises linker sequence L, selected from the group of amino acid sequences, consisting of SEQ ID NO: 1 , SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 5.
The amino acid sequences of fused protein of present invention is selected from the group, consisting of sequences SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9 and SEQ ID NO: 10.
Fused protein according to this invention is characterized by extended circulation half-life in vivo and synergetic activity. A further main object of the present invention is the recombinant DNA fragment encoding fused protein. Preference is provided to recombinant DNA fragment, wherein the coding sequence is selected from the group, consisting of of SEQ ID NO: 11 , SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14 and SEQ ID NO: 15.
One another main aspect of present invention is a method for preparation of heterodimer protein of granulocyte colony-stimulating factor and stem cell factor, comprising the steps of: a) construction of DNA fragment encoding said target protein and preparation of bacterial strain-producer;
b) cultivation of microorganism of producer which host cells comprise a DNA sequence, encoding the target protein, in a suitable culture medium;
c) lysis of the microorganism of producer and separation of the fraction of insoluble target proteins;
d) solubilization of the fraction of insoluble proteins;
e) renaturation of the target protein;
f) purification of the target protein.
Method according to present invention characterized in that: target protein is genetically fused protein of present invention;
- in step b) cultivation of producent is performed under conditions, suitable for expression of the heterodimer construction of present invention;
fraction of insoluble proteins in step d) is solubilized in a buffer solution containing urea as chaotropic agent and dithiothreitol as reducing agent,
renaturation of heterodimer in step e) is oxidative renaturation in a buffer solution containing intermediate urea concentration in the presence of dithiothreitol (DTT) as reducing agent and oxidized glutathione (GSSG) as oxidizing agent;
renaturated target protein in step f) is purified by sequential anion- exchange chromatography with a further mixed-mode chromatography and cation-exchange chromatography.
Renaturation of said heterodimer protein is performed in a buffer solution of pH 7.5 - 8.5 containing 2M urea in the presence of dithiothreitol and oxidized glutathione in molar ratio DTT:GSSG of 5-1 :1-5; more preferably in a buffer solution at pH 8.0 and DTT: GSSG molar ratio 1 :5.
In one aspect of this invention in step f) said anion-exchange chromatography is performed on DEAE-Sepharose FF sorbent at pH 7.0 - 8.5, preferably at pH 7.5, applying step-wise elution mode; said mixed-mode chromatography is performed on CHT hydroxyapatite sorbent at pH 6.5 - 7.5, preferably at pH 7.2; said cation-exchange chromatography is performed on SP-Sepharose FF sorbent at pH 4.5 - 5.2, preferably at pH 4.7; protein solution obtained is concentrated and stored in acetic acid/NaOH buffer solution.
In another aspect of present invention in step a) said DNA fragment, encoding target genetically fused protein, is inserted into expression plasmid pET21b and selected plasmids are transformed into bacterial E. coli BL21(DE3) strain-producer, and in step b) said strain- producer is cultivated in LB medium at 37°C up to optical density (ODeoonm) 0,8-1 ,2, by using isopropyl- β-D-thiogalaktopyranoside (IPTG) for induction. Yet another preferred embodiment is fused SCF-GCSF protein, obtained by the method of present invention. The SCF-GCSF protein of present invention is intended for use in therapy.
And one more object is a pharmaceutical composition, comprising a therapeutically effective amount of fused protein of present invention and a pharmaceutically acceptable carrier, diluent, excipient and/or auxiliary substances.
Brief Description of the Drawings:
Fig. 1 : presented the alteration of electrophoretic purity of SCF-G-CSF heterodimer over process stages, namely, the electrophoretic pattern of SCF-G-CSF heterodimer protein samples under reducing conditions. Lines: 1 - PageRuler™ Plus Prestained Protein Ladder #26619 - markers of protein molecular mass; 2 - sample of inclusion bodies; 3 - sample after protein renaturation; 4 - sample after protein chromatography over DEAE-Sepharose FF column; 5 - sample after protein chromatography over hydroxyapatite CHT column; 6 - sample after protein chromatography over SP-Sepharose column.
Fig. 2: Western blot analysis of purified SCF-G-CSF heterodimer protein. (A) - sample of 3 μg of SCF-G-CSF heterodimer loaded under reducing conditions; blot staining with monoclonal antibodies against G-CSF; (B) - sample of 3 μg of SCF-G-CSF heterodimer loaded under reducing conditions; blot staining with polyclonal antibodies against SCF.
Fig. 3: Purified SCF-G-CSF heterodimer protein analysis by SE-HPLC method.
Optical density of eluate at 280 nm. Peak 1 : retention time 2,329 min; peak height 2,90963 e 1 mAU; area percent 2,0264%. Peak 2: retention time 14,749 min; peak height 7,56982 mAU; area percent 97,9736%.
Fig.4. Termal stability of SCF-G-CSF heterodimer, namely, curves of SCF-G-CSF heterodimer termal denaturation. Top curve - SCF-G-CSF heterodimer formulated in acetate buffer; bottom curve - SCF-G-CSF heterodimer formulated in PBS buffer.
Fig.5. Stimulation of absolute neutrophil count (ANC) in vivo in rat blood by G-CSF, SCF, mixture thereof and SCF-G-CSF heterodimer. ANC alteration in rat blood after injection of protein samples. Injected were samples of SCF-G-CSF heterodimer, SCF monomer, G-CSF monomer, and sample of SCF and G-CSF monomer mixture. Amount of neutrophils in blood was determined just after injection, then after 24hours and 48 hours after injection.
Fig. 6. Change of G-CSF concentration in rat serum over time after injection of G-CSF, SCF, SCF+G-CSF mixture and SCF-G-CSF heterodimer. G-CSF concentration in rat sera was determined 3, 6 and 18 hours after injection.
Detailed Description of the Invention
The present invention disclosed new type of heteromultimers, comprising of monomer of granulocyte colony-stimulating factor genetically fused via linker sequence of defined length with monomer of other hematopoietic growth factor.
Recombinant form of proposed according to present invention heteromultimers is formed of genetically fused recombinant biologically active and synergistically acting protein monomer chains, connected via suitable linker, wherein both protein monomer chains have amino acid sequences of native biologically active protein or are essentially the same sequences of at least 95% identity. The suitable linker moiety has an amino acid sequence, selected from the group, consisting of (S-G 4 ) n -S, wherein n=2-7, and SGLEA-(EAAAK) m -ALEA-(EAAA ) m - ALEGS, wherein m=2-8. In preferred embodiment of present invention said suitable linker moiety has an amino acid sequence, selected from the group, consisting of SEQ ID No:1 , SEQ ID No:2, SEQ ID No:3, SEQ ID No:4 and SEQ ID No:5 (Table 1 )
Table 1
Examples of used linker sequences
Heterodimer constructions of present invention may comprise G-CSF and any other hematopoietic factor, which may act synergetically with G-CSF In addition to this, according to method of present invention heterodimer constructions may be designed with any partner of growth factor depending on particular features of their biological interactions with specific receptors. In one of the most preferable embodiment of present invention said G-CSF heteromultimer is heterodimer of granulocyte colony-stimulating factor and stem cell factor having amino acid sequence selected from the group of sequences SEQ ID No: 6, SEQ ID No:7, SEQ ID No:8, SEQ ID No:9 and SEQ ID No: 10 (Table 2).
Table 2
Amino acid sequences and molecular mass of heterodimer proteins
Sequence Heterodimer Molecular Amino acid sequence of heterodimer protein Number. protein mass, kDa
MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYV
SEQ ID No:6 SCF-L2-GCSF 38,03 PGMDVLPSHCWISEMWQLSDSLTDLLDKFSNIS
EGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSF
KSPEPRLFTPEEFFRIFNRSIDAFKDFWASETSD
CWSSTLSPEKDSRVSVTKPFMLPPVAASGGGG
SGGGGSTPLGPASSLPQSFLLKCLEQVRKIQGD
G AALQ E KLC AT YKLC HPEELVLLGHSLGI P WAP L
SSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGI
SPELGPTLDTLQLDVADFATTIWQQMEELGMAPA
LQPTQGAMPAFASAFQRRAGGVLVASHLQSFLE
VSYRVLRHLAQP
SEQ ID No:7 SCF-L3-GCSF 38,35 MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYV
PGMDVLPSHCWISEMWQLSDSLTDLLDKFSNIS
EGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSF
KSPEPRLFTPEEFFRIFNRSIDAFKDFWASETSD
CWSSTLSPEKDSRVSVTKPFMLPPVAASGGGG
SGGGGSGGGGSTPLGPASSLPQSFLLKCLEQVR
Kl QG DG AALQ E KLC ATYKLC H P E ELVL LG H S LG I P
WAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQ
ALEGISPELGPTLDTLQLDVADFATTIWQQMEEL
GMAPALQPTQGAMPAFASAFQRRAGGVLVASHL
QSFLEVSYRVLRHLAQP
SEQ ID NO:8 SCF-L5-GCSF 38,98 MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYV
PGMDVLPSHCWISEMWQLSDSLTDLLDKFSNIS
EGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSF
KSPEPRLFTPEEFFRIFNRSIDAFKDFWASETSD
CWSSTLSPEKDSRVSVTKPFMLPPVAASGGGG
SGGGGSGGGGSGGGGSGGGGSTPLGPASSLP
QSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHP
EELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQL
HSGLFLYQGLLQALEGISPELGPTLDTLQLDVADF
ATTIWQQMEELGMAPALQPTQGAMPAFASAFQR
RAGGVLVASHLQSFLEVSYRVLRHLAQP
SEQ ID NO:9 SCF-L7-GCSF 39,61 MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYV
PGMDVLPSHCWISEMWQLSDSLTDLLDKFSNIS
EGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSF
KSPEPRLFTPEEFFRIFNRSIDAFKDFWASETSD
CWSSTLSPEKDSRVSVTKPFMLPPVAASGGGG
SGGGGSGGGGSGGGGSGGGGSGGGGSGGGG
STPLGPASSLPQSFLLKCLEQVRKIQGDGAALQE
KLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQ
ALQLAGCLSQLHSGLFLYQGLLQALEGISPELGP
TLDTLQLDVADFATTIWQQMEELGMAPALQPTQ GAM P AF AS AF Q R R AG G VLVAS H LQS F LE VS YR V
LRHLAQP
SEQ ID NO:10 SCF-La-GCSF 42,38 MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYV
PGMDVLPSHCWISEMWQLSDSLTDLLDKFSNIS
EGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSF
KSPEPRLFTPEEFFRIFNRSIDAFKDFWASETSD
CWSSTLSPEKDSRVSVTKPFMLPPVAASGLEAE
AAAKEAAAKEAAAKEAAAKALEAEAAAKEAAAKE
AAAKEAAAKALEGSTPLGPASSLPQSFLLKCLEQ
VRKIQGDGAALQEKLCATYKLCHPEELVLLGHSL
GIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGL
LQALEGISPELGPTLDTLQLDVADFATTIWQQME
ELGMAPALQPTQGAMPAFASAFQRRAGGVLVAS
HLQSFLEVSYRVLRHLAQP
Another important object of the present invention is method of preparation of fused G-CSF and SCF protein as defined above and disclosed in more details in a below presented examples, which method enabled to isolate and purify the target fused protein assuring maximal possible activity of both synergeticaly acting therapeutic proteins.
In the structure of heterodimer according this invention full amino acid sequence of stem cell factor monomer has been selected as the N-terminal partner while as C-terminal partner is the full amino acid sequence of monomer of granulocyte colony-stimulating factor. Such an order of partners fusing into heterodimer construction via properly selected linker sequence appeared rationale since about all sequence of SCF (1-148) is important for its biological function. N-terminus of G-CSF is responsible for interaction with receptor.
For skilled persons of this field it is evident that in present invention the heteromultimer constructions may encompass G-CSF and any other hematopoietic factor acting synergistically with G-CSF. Besides, heteromultimer constructions of G-CSF according to this invention can be designed with partner of any growth factor considering specificy of their biological interactions with receptors to purposefully select the order of partners genetic fusion, i.e., defining which partner will occupy N- and which C-terminus position.
According to this invention the main steps for SCF-G-CSF heterodimer protein preparation and quality control involve following stages:
- preparation of genetic construct and construction of bacterial strain- producer,
- development processes of protein biosynthesis, renaturation and chromatography purification, - development of in-process control methods to handle protein quality,
- formulation of purified protein for long-term storage ,
protein characterization and in vitro bioassay with G-CSF proliferation test,
- determination of protein pharmacokinetic and pharmacodynamic properties in vivo .
The genes of SCF and G-CSF heterodimer form were constructed fusing gene copies via linker sequence into one DNA fragment which was cloned into expression plasmid (for example, pET-21 b) and into strain-producer (for example, E.coli BL21 (DE3). Selected clones were cultivated in a proper selected medium at +37°C. Biosynthesis of the target protein was induced by IPTG (isopropil-p-D-thiogalactopyranoside). Lysate of biomass was prepared by boiling with sodium dodecylsulfate (SDS), and was analyzed by electrophoresis. Prepared constructions of fused G-CSF proteins are specified in Table 2.
Sequences of heterodimer constructions were controlled and verified by determining primary nucleotide sequence which corresponded to predicted heterodimer sequence encoding both protein partners connected via linker sequence. Linker amino acids sequence containing element of alpha helix structure EAAAK with periodic repeats of this structure from 2 to 8 times was selected.
It was found that the use of 54 amino acids residue sequence which is in the form of structurised alpha helix it is possible to distance both partners of heterodimer construction in such a length which exclude their inter-interaction and steric hindrance assuring free interaction of each partner with its specific receptor. Such construct of heterodimer allow both partners exhibit the synergy of their biological function by a similar mode as their combined use in solution. In addition to this the developed heterodimer construction exhibited in vivo longer survival time in comparison to that of monomeric form of SCF or G- CSF.
Conformance of amino acids sequence of heterodimer to theoretical gene encoding sequence was confirmed by mass spectrometry (MS) analysis of purified protein checking the conformity of determined molecular mass to theoretical. Functionality of both heterodimer partners was confirmed by Western blot analysis (Fig 2) using antibodies specific to SCF and G-CSF parts of heterodimer. Purity of heterodimer and purity alteration over protein purification steps is presented in Fig. 1. In addition to this, the association status of purified heterodimer was determined by analytical SE-HPLC and high 98% monomer content of fused SCF-G-CSF heterodimer protein was found (Fig. 3). Finally purified protein substance was formulated in a two distinct buffer systems and thermal protein denaturation patterns were determined. This allowed choose acetate buffer system (Fig. 4), as appropriate for long-term storage of the protein and provide formulated protein for in vivo studies. In vitro bioassay of heterodimer G-CSF part in proliferation test using mouse myeloid leukaemia cell line G-NFS-60 (13 example) and alteration of neutrophil count in rat model system (Fig. 5) confirmed the correctness of heterodimer structure and its biological activity. Apart that, the alteration of G-CSF concentration in rat blood over time revealed the extension of heterodimer circulation time (Fig. 6).
The substance of purified protein is used for formulation of pharmaceutical composition. According to this invention the heterodimer of granulocyte colony-stimulating factor and stem cell factor is designated to produce active pharmaceutical substance and pharmaceutical composition and dosage form on its basis for treating of diseases and conditions in same indications where monomeric form of granulocyte colony-stimulating factor and stem cell factors protein or combination of both is currently used, including oncohematology, treatment of neurological diseases and ophthalmology.
Therefore, yet another main object of this invention is pharmaceutical composition, comprising a therapeutically effective amount of heterodimer of granulocyte colony- stimulating factor and stem cell factor as above in combination with pharmaceutically acceptable carrier, diluent, excipient and/or auxiliary substances. Besides pharmaceutically effective amount of fused protein defined above, the pharmaceutical composition of present invention could be formulated with following further ingredients:
-carier compounds such as monosaccharide (glucose, dextrose), disaccharides (sacharose, fructose) polyhydroxyl alcohols (sorbitol, manitol);
-buffer substance for defined pH value (acetic, phosphorous, citric acids, Tris substance, Good buffer substances);
-additive of salts for isotonicity (NaCI, sodium or ammonium sulphate);
-surface active agents (detergents) for protection of protein from damage and degradation at the air-liquid interface (polysorbate 20 or 80, Pluronic type compounds);
- stabilizing agents (polyethylene(propylene) glycols, amino acids Met, His, Asp, Arg, Gly);
- chelating agents (EDTA, EGTA, IDA);
- antimicrobial agents (cresol, benzyl alcohol);
- SH-agents (glutathione, Cys, acetylCys);
- other auxiliary compounds. Embodiments of the Invention
Represented below is information on specific examples on preparation of fused G-CSF proteins, and properties thereof. These examples are presented for illustrative purpose and are not limiting the scope of the present invention.
Examples 1-5
Construction of SCF-G-CSF heterodimer protein expression vector and strain- producer
DNA sequences for target fusion protein construction were obtained using synthetic DNA fragments. Human SCF gene fragment was constructed with the restriction sites for the enzymes Ndel and Kpn2l on the fragment 5' and 3' ends respectively. Linker sequences of L2, L3, L5, L7, La fragments were obtained with the restriction sites of Kpn2l and BamHI on the fragment 5' and 3' ends respectively. Human G-CSF gene fragment was obtained with the restriction sites BamHI and Hindlll on the fragments 5' and 3' ends respectively (coding sequence of STOP codon was included into the 3'-end of the fragment). Each sequence in the Table 3 below was obtained by combining SCF fragment with G-CSF fragment joined via selected linker sequence with the help of DNA ligase. The fragments obtained were exposed with restriction enzymes Ndel and Hindlll, and ligated into an expression plasmid pET21b (Novagen) at the same sites. Final recombinant plasmid was sequenced. Constructed variants of the sequences are given in the Table 3. Selected plasmids were transformed into the bacteria strain E. coli BL21 (DE3). The selected colonies were cultivated in LB medium at 37°C to the optical density (ODeoonm) 0.8-1.2. Biosynthesis of heterodimeric protein was induced with 0.5-1 mM IPTG (isopropyl- β -D- thiogalactopyranoside), induction time was 2.5-3 h. Biomass lysates obtained by the boiling in 1% of sodium dodecylsulfate (SDS) were analyzed by the method of polyacrylamide gel electrophoresis.
Table 3
Gene sequences for heterodimer proteins
Examp Number of DNA Sequence of fused protein
le No. sequence and
fused protein
1 SEQ ID NO: 11 ATGGAAGGGATCTGCCGTAATCGTGTGACTAATAATGTAAA
AGACGTCACTAAATTGGTGGCAAATCTTCCAAAAGACTACA SCF-L2-GCSF TGATCACCCTCAAATATGTCCCGGGGATGGATGTTTTGCCA
AGTCATTGTTGGATAAGCGAGATGGTAGTACAATTGTCAGA CAGCTTGACTGATCTTCTGGACAAGTTTTCAAATATTTCTGA AGGCTTGAGTAATTATTCCATCATAGACAAACTTGTGAATAT AGTCGATGACCTTGTGGAGTGCGTCAAAGAAAACTCATCTA AGGATCTAAAAAAATCATTCAAGAGCCCAGAACCCCGTCTC TTTACTCCTGAAGAATTCTTTCGTATTTTTAATCGTTCCATT GATGCCTTCAAGGACTTTGTAGTGGCATCTGAAACTAGTGA
TTGTGTGGTTTCTTCAACATTAAGTCCTGAGAAAGATTCCC
GTGTCAGTGTCACAAAACCA I I I ATGTTACCCCCTGTTGCA
GCCTCCGGAGGTGGTGGTTCTGGTGGTGGTGGATCCACA
CCTTTAGGACCTGCTAGCTCCCTGCCCCAGAGCTTCCTGC
TCAAGTGCTTAGAGCAAGTGAGGAAGATCCAGGGCGATGG
CGCAGCGCTCCAGGAGAAGCTGTGTGCCACCTACAAGCTG
TGCCACCCCGAGGAGCTGGTGCTGCTCGGACACTCTCTGG
GCATCCCCTGGGCTCCCCTGAGCTCCTGCCCCAGCCAGG
CCCTGCAGCTGGCAGGCTGCTTGAGCCAACTCCATAGCGG
CCTTTTCCTCTACCAGGGGCTCCTGCAGGCCCTGGAAGGG
ATATCCCCCGAGTTGGGTCCCACCTTGGACACACTGCAGC
TGGACGTCGCCGACTTTGCCACCACCATCTGGCAGCAGAT
GGAAGAACTGGGAATGGCCCCTGCCCTGCAGCCCACCCA
GGGTGCCATGCCGGCCTTCGCCTCTGCTTTCCAGCGCCG
GGCAGGAGGGGTCCTGGTTGCTAGCCATCTGCAGAGCTTC
CTGGAGGTGTCGTACCGCGTTCTACGCCACCTTGCGCAGC
CGTAA
SEQ ID NO: 12 ATGGAAGGGATCTGCCGTAATCGTGTGACTAATAATGTAAA
AGACGTCACTAAATTGGTGGCAAATCTTCCAAAAGACTACA SCF-L3-GCSF TGATCACCCTCAAATATGTCCCGGGGATGGATG I I I I GCCA
AGTCATTGTTGGATAAGCGAGATGGTAGTACAATTGTCAGA CAGCTTGACTGATCTTCTGGACAAGTTTTCAAATATTTCTGA AGGCTTGAGTAATTATTCCATCATAGACAAACTTGTGAATAT AGTCGATGACCTTGTGGAGTGCGTCAAAGAAAACTCATCTA AGGATCTAAAAAAATCATTCAAGAGCCCAGAACCCCGTCTC I I I ACTCCTGAAGAATTCTTTCGTATTTTTAATCGTTCCATT GATGCCTTCAAGGACTTTGTAGTGGCATCTGAAACTAGTGA TTGTGTGGTTTCTTCAACATTAAGTCCTGAGAAAGATTCCC GTGTCAGTGTCACAAAACCA I I I
ATGTTACCCCCTGTTGCAGCC TCCGG GGTGGTGGTTCrG
GTGGTGGTGG TTC TGGTGGTGGTGGA TCCACACCTTTAGG
ACCTGCTAGCTCCCTGCCCCAGAGCTTCCTGCTCAAGTGC
TTAGAGCAAGTGAGGAAGATCCAGGGCGATGGCGCAGCG
CTCCAGGAGAAGCTGTGTGCCACCTACAAGCTGTGCCACC
CCGAGGAGCTGGTGCTGCTCGGACACTCTCTGGGCATCCC
CTGGGCTCCCCTGAGCTCCTGCCCCAGCCAGGCCCTGCA
GCTGGCAGGCTGCTTGAGCCAACTCCATAGCGGCCTTTTC
CTCTACCAGGGGCTCCTGCAGGCCCTGGAAGGGATATCCC
CCGAGTTGGGTCCCACCTTGGACACACTGCAGCTGGACGT
CGCCGACTTTGCCACCACCATCTGGCAGCAGATGGAAGAA
CTGGGAATGGCCCCTGCCCTGCAGCCCACCCAGGGTGCC
ATGCCGGCCTTCGCCTCTGCTTTCCAGCGCCGGGCAGGA
GGGGTCCTGGTTGCTAGCCATCTGCAGAGCTTCCTGGAGG
TGTCGTACCGCGTTCTACGCCACCTTGCGCAGCCGTAA
SEQ ID NO:13 ATGGAAGGGATCTGCCGTAATCGTGTGACTAATAATGTAAA
AGACGTCACTAAATTGGTGGCAAATCTTCCAAAAGACTACA SCF-L5-GCSF TGATCACCCTCAAATATGTCCCGGGGATGGATGTTTTGCCA
AGTCATTGTTGGATAAGCGAGATGGTAGTACAATTGTCAGA CAGCTTGACTGATCTTCTGGACAAGTTTTCAAATATTTCTGA AGGCTTGAGTAATTATTCCATCATAGACAAACTTGTGAATAT AGTCGATGACCTTGTGGAGTGCGTCAAAGAAAACTCATCTA AGGATCTAAAAAAATCATTCAAGAGCCCAGAACCCCGTCTC TTTACTCCTGAAGAATTC I I I CGTATTTTTAATCGTTCCATT GATGCCTTCAAGGACTTTGTAGTGGCATCTGAAACTAGTGA TTGTGTGG I I I CTTCAACATTAAGTCCTGAGAAAGATTCCC GTGTCAGTGTCACAAAACCATTT
ATGT ACCCCCJGTJGCAGCCTCCGGAGGTGGTGGTTCTG
GTGGTGGTGG TTC TGGTGGTGG TGGTTC TGGTGGTGG TG
GTTCTGGTGGTGGTGGATCCACACC I I I AGGACCTGCTAG
CTCCCTGCCCCAGAGCTTCCTGCTCAAGTGCTTAGAGCAA
GTGAGGAAGATCCAGGGCGATGGCGCAGCGCTCCAGGAG
AAGCTGTGTGCCACCTACAAGCTGTGCCACCCCGAGGAGC
TGGTGCTGCTCGGACACTCTCTGGGCATCCCCTGGGCTCC
CCTGAGCTCCTGCCCCAGCCAGGCCCTGCAGCTGGCAGG
CTGCTTGAGCCAACTCCATAGCGGCC I I I I CCTCTACCAGG
GGCTCCTGCAGGCCCTGGAAGGGATATCCCCCGAGTTGG
GTCCCACCTTGGACACACTGCAGCTGGACGTCGCCGACTT
TGCCACCACCATCTGGCAGCAGATGGAAGAACTGGGAATG
GCCCCTGCCCTGCAGCCCACCCAGGGTGCCATGCCGGCC
TTCGCCTCTGCTTTCCAGCGCCGGGCAGGAGGGGTCCTG
GTTGCTAGCCATCTGCAGAGCTTCCTGGAGGTGTCGTACC
GCGTTCTACGCCACCTTGCGCAGCCGTAA
SEQ ID NO:14 ATGGAAGGGATCTGCCGTAATCGTGTGACTAATAATGTAAA
AGACGTCACTAAATTGGTGGCAAATCTTCCAAAAGACTACA SCF-L7-GCSF TGATCACCCTCAAATATGTCCCGGGGATGGATG I I I I GCCA
AGTCATTGTTGGATAAGCGAGATGGTAGTACAATTGTCAGA
CAGCTTGACTGATCTTCTGGACAAGTTTTCAAATATTTCTGA
AGGCTTGAGTAATTATTCCATCATAGACAAACTTGTGAATAT
AGTCGATGACCTTGTGGAGTGCGTCAAAGAAAACTCATCTA
AGGATCTAAAAAAATCATTCAAGAGCCCAGAACCCCGTCTC
TTTACTCCTGAAGAATTCTTTCGTATTTTTAATCGTTCCATT
GATGCCTTCAAGGACTTTGTAGTGGCATCTGAAACTAGTGA
TTGTGTGGTTTCTTCAACATTAAGTCCTGAGAAAGATTCCC
GTGTCAGTGTCACAAAACCATTT
ATGTTACCCCCTGTTGCAGCC TCCGGAGGTGGTGGTTCTG
GTGGTGGTGGTTCTGGTGGTGGTGGTTCTGGTGGTGGTG
GTTCTGGTGGTGGTGGTTCTGGTGGTGGTGGTTCTGGTGG
TGG TGG/A TCCACACCTTTAGGACCTGCTAGCTCCCTGCCC
CAGAGCTTCCTGCTCAAGTGCTTAGAGCAAGTGAGGAAGA
TCCAGGGCGATGGCGCAGCGCTCCAGGAGAAGCTGTGTG
CCACCTACAAGCTGTGCCACCCCGAGGAGCTGGTGCTGCT
CGGACACTCTCTGGGCATCCCCTGGGCTCCCCTGAGCTCC
TGCCCCAGCCAGGCCCTGCAGCTGGCAGGCTGCTTGAGC
CAACTCCATAGCGGCCTTTTCCTCTACCAGGGGCTCCTGC
AGGCCCTGGAAGGGATATCCCCCGAGTTGGGTCCCACCTT
GGACACACTGCAGCTGGACGTCGCCGACTTTGCCACCACC
ATCTGGCAGCAGATGGAAGAACTGGGAATGGCCCCTGCCC
TGCAGCCCACCCAGGGTGCCATGCCGGCCTTCGCCTCTG
CTTTCCAGCGCCGGGCAGGAGGGGTCCTGGTTGCTAGCC
ATCTGCAGAGCTTCCTGGAGGTGTCGTACCGCGTTCTACG
CCACCTTGCGCAGCCG
SEQ ID NO: 15 CATATGGAAGGGATCTGCCGTAATCGTGTGACTAATAATGT AAAAGACGTCACTAAATTGGTGGCAAATCTTCCAAAAGACT
SCF-La-GCSF ACATGATCACCCTCAAATATGTCCCGGGGATGGATGTTTTG
CCAAGTCATTGTTGGATAAGCGAGATGGTAGTACAATTGTC
AGACAGCTTGACTGATCTTCTGGACAAGTTTTCAAATATTTC
TGAAGGCTTGAGTAATTATTCCATCATAGACAAACTTGTGA
ATATAGTCGATGACCTTGTGGAGTGCGTCAAAGAAAACTCA
TCTAAGGATCTAAAAAAATCATTCAAGAGCCCAGAACCCCG
TCTCTTTACTCCTGAAGAATTCTTTCGTATTTTTAATCGTTC
CATTGATGCCTTCAAGGACTTTGTAGTGGCATCTGAAACTA
GTGATTGTGTGGTTTCTTCAACATTAAGTCCTGAGAAAGAT
TCCCGTGTCAGTGTCACAAAACCATTTATGTTACCCCCTGT
TGCAGCCTCCGGACTTGAGGCTGAAGCAGCAGCTAAAGAA
GCAGCAGCTAAAGAAGCAGCAGCTAAAGAAGCAGCAGCTA
AAGCTCTCGAGGCTGAAGCAGCAGCTAAAGAAGCAGCAGC
TAAAGAAGCAGCAGCTAAAGAAGCAGCAGCTAAAGCTCTT
GAGGGA TCCACACCTTTAGGACCTGCTAGCTCCCTGCCCC
AGAGCTTCCTGCTCAAGTGCTTAGAGCAAGTGAGGAAGAT
CCAGGGCGATGGCGCAGCGCTCCAGGAGAAGCTGTGTGC
CACCTACAAGCTGTGCCACCCCGAGGAGCTGGTGCTGCTC
GGACACTCTCTGGGCATCCCCTGGGCTCCCCTGAGCTCCT
GCCCCAGCCAGGCCCTGCAGCTGGCAGGCTGCTTGAGCC
AACTCCATAGCGGCCTTTTCCTCTACCAGGGGCTCCTGCA
GGCCCTGGAAGGGATATCCCCCGAGTTGGGTCCCACCTTG
GACACACTGCAGCTGGACGTCGCCGACTTTGCCACCACCA
TCTGGCAGCAGATGGAAGAACTGGGAATGGCCCCTGCCCT
GCAGCCCACCCAGGGTGCCATGCCGGCCTTCGCCTCTGC
TTTCCAGCGCCGGGCAGGAGGGGTCCTGGTTGCTAGCCAT
CTGCAGAGCTTCCTGGAGGTGTCGTACCGCGTTCTACGCC
ACCTTGCGCAGCCGTAATAAGCTT
Appropriate are various versions of DNA sequence that encodes the sequences of native partners of heterodimer construction or sequence identical to native by at least 95%. In below cited examples SCF-GCSF heterodimer means construct of SCF and G-CSF monomer units fused via linker sequence of La protein according the invention, which amino acids sequence is SEQ ID Nr: 10 (Table 2).
Example 6
Biosynthesis of SCF-G-CSF heterodimer protein
SCF-G-CSF heterodimer producer E.coli BL21 (DE3) pET21 b-SCF-GCSF-La was grown in flasks and/or bioreactor.
For inoculum preparation 60 ml LB medium (MO BIO laboratories, Inc.) in 250 ml flask was used. Ampicillin {Roth) concentration was 100 mg/l. Flasks were shaked at +37°C with 220 rpm agitation. After ~16 hours the culture was transferred into 5L volume bioreactor (Sartorius AG) with effective medium volume of 3L (2% v/v of inoculum). The medium consisted of 1 1.28 g/L M9 type media (Sigma); and 5 g/L yeast extract (Fluka). The additives of media as 4 g/L glucose, 1 g/L MgS0 {Sigma); 100 mg/L ampicillin were sterilized separately and added to bioreactor aseptically. Fermentation was run at +37°C; keeping medium pH at 6.8 automatically adjusting with 1 M solutions of NaOH or 1 M HCI; and keeping saturation by 0∑ at ~20% with the aid of air velocity and agitation speed changes. After the optical density at 600 nm (OD600) reached value 1.3 - 1.6, the IPTG (isopropyl-β- D-thio-galactopyranoside) was added for induction (final concentration 1 mM) and fermentation was continued for further 2 hours. Biomass was collected by centrifugation at +4°C for 30 min at 3500 - 4000 rpm. Biomass was stored in frozen state at -20°C.
The expression level of target SCF-G-CSF heterodimer protein constitutes 20.95 ± 3.45 %.
Example 7
Isolation of SCF-G-CSF heterodimer inclusion bodies (IB) from E.coli cells
12 g of frozen E.coli biomass was homogenized in 240 ml of 0.1 M Tris-HCI buffer pH 7.0 containing 5 mM EDTA adding further 0.24 g lyzocyme, 0.24 ml Triton X-100, 2.4 ml of 100 mM phenylmethylsulfonylfluoride (PMSF) solution in ethanol and 1.68 ml 2-mercaptoethanol (final concentration 100 mM). Homogenizate is stirred on magnetic stirrer for 30 min at room temperature, and the cells were disrupted by ultrasonic (22kHz) for 10 minutes in ice bath and centrifuged with Beckman centrifuge at +4°C for 25 minutes at 14000 rpm. The pellet of IB was collected and washed two times by homogenization in 240 ml solution of 20 mM Tris- HCI buffer pH 8.0 containing the additives of 1 M NaCI and 0.1 % polysorbate 80 and once with 240 ml of 20 mM Tris-HCI buffer pH 8.0. After each homogenization cycle the suspension obtained was centrifuged with Beckman centrifuge at +4°C for 25 minutes at 14000 rpm.
Example 8
Solubilization of SCF-G-CSF heterodimer inclusion bodies in the presence of reducing agent
IB isolated from 12 g of E.coli biomass were solubilized in 120 ml of 50 mM Tris-HCI buffer pH 8.0 containing 8 M urea, and 0.5 mM DTT with mixing on magnetic stirrer for 2 hours at +4°C After that the solubilisate was centrifuged with Beckman centrifuge at +4°C for 25 minutes at 14000 rpm. Example 9
Renaturation of SCF-G-CSF heterodimer
Solubilisate of IB in a buffer solution containing 8M urea (185 mg of total protein) was diluted 4 times with 50 mM Tris-HCI buffer pH 8.0. Heterodimer protein was renatured in 50 mM Tris-HCI buffer pH 8.0 containing 2M urea, 0.125 mM DTT, and 0.625 mM oxidized glutathione (GSSG) by gentle mixing for 24 hours at +4°C. After that the renaturation solution was centrifuged with Beckman centrifuge for 25 minutes at 14000 rpm.
Example 10
Anion-exchange chromatography of SCF-G-CSF heterodimer protein over DEAE- Sepharose FF sorbent
Purification of renatured SCF-G-CSF heterodimer protein is performed at room temperature by using the column containing DEAE-Sepharose FF anion-exchanger and AKTA Purifier chromatography system.
Glass column (XK 26 or XK 16/20,„GE Healthcare") containing 60 ml of DEAE-Sepharose FF sorbent was equilibrated with 50 mM Tris-HCI buffer pH 7.5. Solution of renatured SCF- G-CSF heterodimer (185 mg protein containing 27% of correctly folded heterodimer protein determined by RP-HPLC analysis) was loaded into the column at flow-rate of 5 ml/min. Not retained protein was removed by column washing with 5 column volumes (CV) of 50 mM Tris-HCI buffer pH 7.5 at a flow-rate of 3 ml/min. Absorbance of eluate fractions (volume of 15 ml each) was monitored at 280, 254 and 215 nm. Adsorbed protein was eluted from the column by step-wise elution mode increasing the ionic strength of eluent by steadily increasing the concentration of NaCI (Table 4) from 0 M to 0.5 M over total 8 CV. Eluent flow-rate was 3 ml/min.
Table 4
Step-wise elution over DEAE-Sepharose FF column
Samples from eluate fraction (10 ml each) were drawn for protein analysis by Bradford assay, for target protein amount per cent by RP-HPLC analysis and purity assessment by SDS-PAGE. Fractions containing highest amount of target correctly folded heterodimer protein were combined for further chromatography step.
After chromatography cycle the sorbent was regenerated. Example 11
Mixed-mode chromatography of SCF-G-CSF heterodimer protein over hydroxyapatite CHT sorbent
The pool of combined fractions with heterodimer protein recovered from DEAE-Sepharose FF column was further chromatographied over hydroxyapatite CHT (CHT™ Ceramic Hydroxyapatite) sorbent. Glass column (XK 16/20, „GE Healthcare") containing 18 ml of CHT hydroxyapatite was connected to AKTA Purifier chromatography system and equilibrated at room temperature with 50 mM Tris-HCI buffer pH 7.2. SCF-G-CSF heterodimer protein recovered from DEAE-Sepharose FF column (18 mg total protein with 63% of correctly folded heterodimer) was loaded into the column at a flow-rate 3 ml/min. Not retained protein was removed by washing with 5 CV of 5 mM NaH 2 P0 4 buffer pH 7.2 containing 0.1 M NaCI at a flow-rate of 3 ml/min. Absorbance of eluate fractions (10 ml volume, each) was monitored at 280, 254 and 215 nm. Adsorbed protein was eluted from the column with linear gradient of NaH 2 P0 4 concentration from 5 mM to 500 mM over 10 column volumes (CV) at a flow-rate of 3 ml/min. Samples from eluate fraction (5 ml each) were drawn for protein analysis by Bradford assay, analysis of target protein per cent by RP- HPLC and purity assessment by SDS-PAGE. Fractions containing highest amount of target correctly folded heterodimer protein were combined for further chromatography step.
The rest of adsorbed proteins were removed from the column by washing with 5 CV of 0.5 M NaH 2 P0 4 solution pH 7.0.
Example 12
Cation-exchange chromatography of SCF-G-CSF heterodimer protein over SP- Sepharose FF sorbent
The third SCF-G-CSF heterodimer chromatography purification step is performed over SP- Sepharose FF cation-exchanger. For this purpose, the glass column (XK 16/20, „GE Healthcare") containing 8 ml of sorbent was connected to AKTA Purifier chromatography system and equilibrated at room temperature with 20 mM Na acetate buffer pH 4.7. Protein solution recovered from hydroxyapatite CHT column (5 mg protein containing 77% of correctly folded heterodimer as judged by RP-HPLC analysis) was loaded onto the column at a flow-rate of 3 ml/min. Not retained protein was washed out with 5 CV of 20 mM Na acetate buffer pH 4.7 at a flow-rate of 3 ml/min.
Absorbance of eluate fractions (5 ml volume, each) was monitored at 280, 254 and 215 nm. Adsorbed protein was eluted from the column with linear gradient of NaCI from 0 mM to 500 mM over 10 column volumes (CV) at a flow-rate of 3 ml/min. Samples from eluate fraction (3 ml each) were drawn for protein analysis by Bradford assay, analysis of target protein per cent by RP-HPLC and purity assessment by SDS-PAGE. Fractions containing highest amount of target correctly folded heterodimer protein were combined and concentrated to about 1 mg/ml and transferred to storage buffer system e.g., 20 mM acetic acid/NaOH buffer pH 4.0 by diafiltration using Amicon ® Ultra-15 filter devices. After that the protein solution is filtered over 0.22 μιτι MustangE type filter device retaining endotoxins. Purified protein solution in Na acetate buffer is stored at +4°C.
Example 13
Testing of SCF-G-CSF heterodimer in vitro biological activity
In vitro biological activity of SCF-G-CSF heterodimer was determined using G-NFS-60 cell line in RPMI 1640 growth medium [Weinstein Y, Ihle JN, Lavu S, Reddy EP, Truncation of the c-myb gene by retroviral integration in an interleukin 3-dependent myeloid leukemia cell line. Proc. Natl. Acad. Sci. USA, 1986, vol. 83, p. 5010-5014]. Biologically active G-CSF protein stimulated proliferation of this cell line upon G-CSF interaction with its receptor on the surface of these cells. For bioassay the G-NFS-60 cells are cultivated in 96 wells plate for 48-72 hours adding into growth medium various amounts (0,1-10 ng/ml) of tested heterodimer sample. As a reference, the sample of Neupogen™ (active substance Filgrastim), which claimed specific biological activity is 100 MlU/mg) is used. Cell proliferation is evaluated by colorimetry using MTS dye. The number of viable cells is directly proportional to biological activity of G-CSF. This evidenced, that the heterodimer may interact in vivo with respective receptors eliciting biological events, which might be exploited for therapeutic purposes. The determined biological activity of SCF-G-CSF heterodimer is equal to 14,95±3,88 MlU/mg. Example 14
Testing of SCF-G-CSF heterodimer biological function in vivo in rats modeling systems
Pharmacokinetic (pK) and pharmacodynamic (pD) parameters of SCF-G-CSF heterodimer protein were evaluated in vivo using Wistar clone female 4 months age rats of 200 - 220g weight. For evaluation of proteins pK parameters the experimental rats were divided into groups of 3-5 rats in each. Testing and control protein sample were injected subcutaneously. For testing of heterodimer protein the samples containing 500 and 1000 pg of the protein per 1 kg of rat weight was used. For control samples the G-CSF preparation Tevagrastim™ and £.co//-derived recombinant human SCF prepared by internal Profarma UAB technology and the mixture of these both proteins with the same protein concentrations referring to 1 kg of animal weight were used. For concentration testing of recombinant protein the blood samples were collected after 3, 6 and 18 hours post injection. Blood samples of 0.8 - 1.0 ml were taken from rat tail vein, incubated at room temperature for 1.0 - 1 .5 hours and for 12 hours at fridge at + 4°C. For serum separation the samples were centrifuged at room temperature for 15 min at 1500 rpm and the collected serum was aliquoted into 2-3 sterile tubes and frozen at -80°C.
Before the start of experiments and 24, 48 and 72 hours post injection the blood samples were analyzed with blood analyzer Hemavet 950. Pharmacodynamic effect of tested recombinant proteins was observed by analysis of the dynamic of blood neutrophils (granulocytes) count alteration. For this purpose samples of 20 μΙ blood from rat tail vein were drawn, mixed with 5 μΙ of 7.5% solution of EDTA, incubated for 10 min and analyzed with Hemavet 950. Analysis data are presented in Fig. 5.
Samples of blood sera were tested by ELISA method with PeproTech kits for human G-CSF analysis in serum (Human G-CSF ELISA Development Kit). Analysis data are presented in Fig.6.
Data presented in Fig. 5 showed that neutrophils count after injection of SCF-G-CSF heterodimer protein was higher than the count after injection of G-CSF monomer at its 500 pg/kg and 1000 pg/kg doses. In the case of SCF-G-CSF heterodimer, neutrophils count value after 48 hours was higher than in the case of SCF and G-CSF monomer mixture, and enabled to state that SCF-G-CSF heterodimer protein functioned longer than protein monomer mixture. From the other part the mixture of SCF and G-CSF monomer exhibited synergy of their function compared to the function of separate protein. Analogous synergy exhibited heterodimer form of SCF-G-CSF confirming the fact that properly designed structure of heterodimer may save the synergy effect of partner functioning. This evidenced the advantages for the use of such a fused protein constructions for therapy as hematopoietic agent in oncohematology, as neurotropic agent for the treatment of neurological diseases and as neuroprotective agent in ophtalmology. Besides there is no need to use registered forms of both protein drug products - it is more rational to develop adequately acting heterodimer constructions. Data presented in Fig. 6 showed that the survival profile of heterodimer protein over time is different from the alteration over time of G-CSF monomer form, which concentration after 6 hours decrease by more than 2 times, while in the case of heterodimer its concentration increased over the same time by more than twice. Differently from G-CSF monomer, the SCF-G-CSF heterodimer form remains in the serum and after 18 hours, indicating that its residence time in serum is longer by about three times than in the case of G-CSF monomer (Tevagrastim™).
Therefore, heterodimer protein according to this invention exhibited extension of circulation time in serum. This indicated that at the proper design of two selected protein fusion it is possible to achieve the longer circulation time in serum of the heterodimer form which in vivo is able to play the same role as the mixture of both nonmodified protein monomers.
In the present invention the extension of circulation half-life is achieved by increasing the molecular mass of heterodimer construction as well as properly selecting the order of partners fusion and the structure and the length of linker sequence.
Both structure of developed heteromultimer (heterodimer) construction and selection of heterodimer isolation and purification process steps along with compatibility thereof within the whole process confirmed that the equivalent amount of heteromultimer will exhibit in vivo synergetic effects of biological function, similarly as combined functioning of both partners. Industrial applicability
This invention has large implementation options for therapeutic use.