Login| Sign Up| Help| Contact|

Patent Searching and Data


Title:
GLYCOSYLATED MONO(2-HYDROXYETHYL) TEREPHTHALIC ACID AND GLYCOSYLATED BIS(2-HYDROXYETHYL) TEREPHTHALIC ACID
Document Type and Number:
WIPO Patent Application WO/2017/162825
Kind Code:
A1
Abstract:
The invention relates to a compound, characterized by a mono(2-hydroxyethyl) terephthalic acid (MHET) and a bis(2-hydroxyethyl) terephthalic acid which are chemically bound to a saccharide. The invention further relates to a corresponding compound for the use as a synthetic building block for polymers or fine chemicals.

Inventors:
SEIBEL, Jürgen (Pleicherwall, Würzburg, 97070, DE)
TIMM, Malte (Otto-Hahn-Straße 51, Gerbrunn, 97218, DE)
Application Number:
EP2017/056995
Publication Date:
September 28, 2017
Filing Date:
March 23, 2017
Export Citation:
Click for automatic bibliography generation   Help
Assignee:
JULIUS-MAXIMILIANS-UNIVERSITÄT WÜRZBURG (Am Sanderring 2, Würzburg, 97070, DE)
International Classes:
C12P19/44; C07H15/18; C08L67/00
Other References:
RENAUDET, O. & SPINELLI, N.: "Synthesis and Biological Applications of Glycoconjugates", part Kapitel 12 2011, ISBN: 978-1-60805-277-6, article KREN, V.: "Glycosidases in Synthesis of Glycomometics and Unnatural Carbohydrates", pages: 226 - 239, XP002771139
YOSHIDA, S. ET AL.: "A bacterium that degrades and assimilates poly(ethylene terephthalate)", SCIENCE, vol. 351, no. 6278, 11 March 2016 (2016-03-11), pages 1196 - 1199, XP002771140
DATABASE UniProt [online] 17 February 2016 (2016-02-17), YOSHIDA, S. ET AL.: "SubName: Full=Lipase", XP002771141, Database accession no. A0A0K8P6T7
DATABASE UniProt [online] 16 March 2016 (2016-03-16), YOSHIDA, S. ET AL.: "RecName: Full=Beta-glucosidase, EC=3.2.1.21", XP002771142, Database accession no. A0A0K8P3N6
LIT. S. YOSHIDA, SCIENCE, vol. 351, 2016, pages 1196
U. BORNSCHEUER, SCIENCE, vol. 351, 2016, pages 1154
FUJIWARA ET AL., INFECT IMMUN., vol. 68, no. 5, 2000, pages 2475 - 83
Attorney, Agent or Firm:
WEINMANN, Lasse et al. (HOFFMANN EITLE PATENT- UND RECHTSANWÄLTE PARTMBB, Arabellastraße 30, Munich, 81925, DE)
Download PDF:
Claims:
Patentansprüche

1 . Verbindung, umfassend glycosylierte Mono(2-hydroxyethyl) terephthalsaure (MHET) oder glycosylierte Bis(2-hydroxyethyl) terephthalsaure (BHET).

2. Verbindung gemäß Anspruch 1 , wobei das MHET oder BHET und ein Saccharid über eine glycosidische Bindung chemisch aneinander gebunden sind.

3. Verbindung, umfassend chemisch an ein Saccharid gebundene Mono(2- hydroxyethyl) terephthalsaure (MHET) oder Bis(2-hydroxyethyl) terephthalsaure.

4. Verbindung gemäß Anspruch 3, wobei das MHET oder BHET und das Saccharid über eine glycosidische Bindung chemisch aneinander gebunden sind.

5. Verbindung gemäß mindestens einem der Ansprüche 2 bis 4, wobei das Saccharid ein Monosaccharid oder Disaccharid ist.

6. Verbindung gemäß Anspruch 5, wobei das Monosaccharid oder Disaccharid ausgewählt ist aus einer Gruppe, die Hexosen und Pentosen enthält.

7. Verbindung gemäß Anspruch 5, wobei das Monosaccharid oder Disaccharid ausgewählt ist aus α -Glucose, ß-Glucose, α-Fructose, ß- Fructose, a- Galactose und ß-Galactose, α-Mannose und ß-Mannose, Xylose, N-Acetylglucosamin, Glucosamin und Glucuronsäure.

8. Verbindung gemäß mindestens einem der Ansprüche 1 bis 7, wobei die Verbindung durch enzymatische Glycosylierung von MHET oder BHET erhältlich ist.

9. Verbindung gemäß mindestens einem der Ansprüche 1 bis 8, wobei die Verbindung durch durch enzymatische Glycosylierung von MHET oder BHET entsteht.

10. Verbindung gemäß Anspruch 8 oder 9, wobei die enzymatische Glycosylierung durch eine Glucosidase, eine Galactosidase oder eine Fructosidase katalysiert wird.

1 1 . Verbindung gemäß Anspruch 10, wobei die enzymatische Glycosylierung durch eine Glucosidase katalysiert wird.

12. Verbindung gemäß Anspruch 1 1 , wobei die Glucosidase eine a- Glucosidase oder eine ß-Glucosidase ist.

13. Verbindung gemäß mindestens einem der Ansprüche 8 bis 12, wobei das MHET oder BHET durch bakteriellen Abbau oder enzymatischen Abbau aus Polyethylenterephtalat (PET) erhältlich ist.

14. Verbindung gemäß mindestens einem der Ansprüche 8 bis 13, wobei das MHET oder BHET durch bakteriellen Abbau oder enzymatischen Abbau aus Polyethylenterephtalat (PET) entsteht.

15. Verbindung gemäß Anspruch 13 oder 14, wobei der enzymatische Abbau von PET durch eine Hydrolase katalysiert wird.

16. Verbindung gemäß Anspruch 15, wobei die Hydrolase PETase aus Idionella sakaiensis ist.

17. Verbindung gemäß Anspruch 15 oder 16, wobei die Hydrolase die in SEQ ID NO: 1 gezeigte Aminosäuresequenz umfasst.

18. Verbindung gemäß mindestens einem der Ansprüche 13 bis 17, wobei das Enzym für die enzymatische Glycosylierung von MHET oder BHET und das Enzym für den enzymatischen Abbau von PET zusammen eingesetzt werden.

19. Verbindung gemäß Anspruch 18, wobei ein Mikroorganismus, der das Enzym für die enzymatische Glycosylierung und das Enzym für den enzymatischen Abbau von PET beherbergt, verwendet wird.

20. Verbindung gemäß mindestens einem der Ansprüche 1 bis 19, bestehend aus MHET oder BHET, das über eine glycosidische Bindung chemisch an ein Saccharid gebunden ist.

21 . Verbindung gemäß mindestens einem der Ansprüche 1 bis 20, wobei die Verbindung eine der folgenden Strukturen (a) oder (b) aufweist:

(a)

wobei Ri ein über eine glycosidische Bindung gebundenes Saccharid umfasst, und R2 ein über eine glycosidische Bindung gebundenes Saccharid umfasst oder H ist.

22. Verbindung gemäß mindestens einem der Ansprüche 1 bis 19, wobei die Verbindung weiterhin mindestens einen Methacryl-Rest umfasst.

23. Verbindung gemäß Anspruch 22, wobei die Verbindung die folgende Struktur aufweist:

wobei R1 ein über eine glycosidische Bindung gebundenes Saccharid umfasst und R2 einen Methacryl-Rest umfasst.

Verbindung gemäß Anspruch 23, wobei die Verbindung die folgende Struktur aufweist:

Verbindung gemäß Anspruch 23, wobei die Verbindung die folgend Struktur aufweist:

Verbindung gemäß Anspruch 23, wobei die Verbindung die folgend Struktur aufweist:

27. Verbindung gemäß einem der Ansprüche 1 bis 19, wobei die Verbindung weiterhin eine lipophile Seitenkette umfasst.

28. Verbindung gemäß Anspruch 27, wobei die Verbindung die folgende Struktur aufweist:

wobei Ri ein über eine glycosidische Bindung gebundenes Saccharid umfasst und R2 eine lipophile Seitenkette, bevorzugt eine gesättigte oder ungesättigte aliphatische Kohlenwasserstoffseitenkette, oder einen Linker umfasst.

29. Verbindung gemäß Anspruch 28, wobei R2 eine gesättigte oder ungesättigte aliphatische C5 bis C20 Kohlenwasserstoffseitenkette, bevorzugt eine gesättigte oder ungesättigte aliphatische C5 bis C15 Kohlenwasserstoffseitenkette, bevorzugter eine gesättigte oder ungesättigte aliphatische Cs bis C12 Kohlenwasserstoffseitenkette, noch bevorzugter eine gesättigte oder ungesättigte aliphatische C 10 Kohlenwasserstoffseitenkette und besonders bevorzugt eine gesättigte aliphatische C10 Kohlenwasserstoffseitenkette ist.

30. Verbindung gemäß Anspruch 28, ausgewählt aus einer Verbindung, die die folgende Struktur (a) bis (j) aufweist:

60

wobei n 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19 oder 20 ist.

31 . Verbindung gemäß einem der Ansprüche 2 bis 24, 26 bis 29 oder 30(b)-(j), wobei das über eine glycosidische Bindung chemisch an MHET oder BHET gebundene Saccharid methacryliert ist.

32. Polymer einer Verbindung gemäß mindestens einem der Ansprüche 1 bis 31 .

33. Polymer gemäß Anspruch 32, wobei das Polymer ein Biohybridpolymer ist.

34. Verfahren zur Herstellung einer Verbindung, die glycosylierte Mono(2- hydroxyethyl) terephthalsäure (MHET) oder glycosylierte Bis(2- hydroxyethyl) terephthalsäure (BHET) umfasst, wobei das Verfahren den Schritt der enzymatischen Glycosylierung von Mono(2-hydroxyethyl) terephthalsäure (MHET) oder Bis(2-hydroxyethyl) terephthalsäure (BHET) umfasst.

35. Verfahren gemäß Anspruch 34, wobei im Schritt der enzymatischen Glycosylierung das MHET oder BHET und ein Saccharid über eine glycosidische Bindung chemisch aneinander gebunden werden.

36. Verfahren gemäß Anspruch 35, wobei das Saccharid ein Monosaccharid oder Disaccharid ist.

37. Verfahren gemäß Anspruch 36, wobei das Monosaccharid oder Disaccharid ausgewählt ist aus einer Gruppe, die Hexosen und Pentosen enthält.

38. Verfahren gemäß Anspruch 37, wobei das Monosaccharid oder Disaccharid ausgewählt ist aus α -Glucose, ß-Glucose, α-Fructose, ß-Fructose, a- Galactose und ß-Galactose, α-Mannose und ß-Mannose, Xylose, N- Acetylglucosamin, Glucosamin und Glucuronsäure.

39. Verfahren gemäß mindestens einem der Ansprüche 34 bis 38, wobei die enzymatische Glycosylierung durch eine Glucosidase, eine Galactosidase oder eine Fructosidase katalysiert wird.

40. Verfahren gemäß Anspruch 39, wobei die enzymatische Glycosylierung durch eine Glucosidase katalysiert wird.

41 . Verfahren gemäß Anspruch 40, wobei die Glucosidase eine a-Glucosidase oder eine ß-Glucosidase ist.

42. Verfahren gemäß mindestens einem der Ansprüche 34 bis 41 , wobei das MHET oder BHET durch bakteriellen Abbau oder enzymatischen Abbau aus Polyethylenterephtalat (PET) erhältlich ist.

43. Verfahren gemäß mindestens einem der Ansprüche 34 bis 42, wobei das Verfahren vor dem Schritt der enzymatischen Glycosylierung vorzugsweise einen Schritt des bakteriellen Abbaus oder enzymatischen Abbaus von Polyethylenterephtalat (PET) zu MHET oder BHET umfasst.

44. Verfahren gemäß Anspruch 42 oder 43, wobei der enzymatische Abbau von PET durch eine Hydrolase katalysiert wird.

45. Verfahren gemäß Anspruch 44, wobei die Hydrolase PETase aus Idionella sakaiensis ist.

46. Verfahren gemäß Anspruch 44 oder 45, wobei die Hydrolase die in SEQ ID NO: 1 gezeigte Aminosäuresequenz umfasst.

47. Verfahren gemäß mindestens einem der Ansprüche 42 bis 46, wobei das Enzym für die enzymatische Glycosylierung von MHET oder BHET und das Enzym für den enzymatischen Abbau von PET zusammen eingesetzt werden.

48. Verfahren gemäß Anspruch 47, wobei ein Mikroorganismus, der das Enzym für die enzymatische Glycosylierung und das Enzym für den enzymatischen Abbau von PET beherbergt, verwendet wird.

49. Verfahren gemäß einem der Ansprüche 34 bis 48, wobei in einem weiteren Schritt ein Methacryl-Rest chemisch an das glycosylierte MHET oder BHET gebunden wird, wobei der Methacryl-Rest bevorzugt durch eine enzymatische Veresterung chemisch an das glycosylierte MHET oder BHET gebunden wird, wobei die enzymatische Veresterung bevorzugt durch eine Lipase katalysiert wird.

50. Verfahren gemäß Anspruch 49, wobei der Methacryl-Rest durch Zugabe von Vinylmethylmethacrylat chemisch an das glycosylierte MHET oder BHET gebunden wird.

51 . Verfahren gemäß mindestens einem der Ansprüche 34 bis 48, wobei in einem weiteren Schritt eine lipophile Seitenkette, bevorzugt eine gesättigte oder ungesättigte aliphatische Kohlenwasserstoffseitenkette, chemisch an das glycosylierte MHET oder BHET gebunden wird.

52. Verfahren gemäß Anspruch 51 , wobei die lipophile Seitenkette eine gesättigte oder ungesättigte C5 bis C20 Kohlenwasserstoffseitenkette, bevorzugt eine gesättigte oder ungesättigte C5 bis C15 Kohlenwasserstoffseitenkette, bevorzugter eine gesättigte oder ungesättigte Cs bis C12 Kohlenwasserstoffseitenkette, noch bevorzugter eine gesättigte oder ungesättigte C10 Kohlenwasserstoffseitenkette und besonders bevorzugt eine gesättigte C10 Kohlenwasserstoffseitenkette ist.

53. Verfahren gemäß Anspruch 52, wobei die lipophile Seitenkette eine gesättigte C10 Kohlenwasserstoffseiten kette ist,

54. Verfahren gemäß einem der Ansprüche 51 bis 53, wobei die lipophile Seitenkette durch Zugabe von Decanol gebunden wird.

55. Verfahren gemäß mindestens einem der Ansprüche 34 bis 54, wobei nach dem Schritt der enzymatischen Glycosylierung ein Schritt der Polymerisieung folgt.

56. Polymer, erhältlich durch das Verfahren gemäß einem der Ansprüche 34 bis 55.

57. Polymer gemäß Anspruch 56, wobei das Polymer ein Biohybridpolymer ist.

58. Mikroorganismus, welcher mindestens ein Enzym für die enzymatische Glycosylierung von MHET und/oder BHET und mindestens ein Enzym für den enzymatischen Abbau von PET beherbergt.

59. Mikroorganismus gemäß Anspruch 58, wobei der Mikroorganismus ein rekombinanter Mikroorganismus ist und das Enzym für die enzymatische Glycosylierung von MHET und/oder BHET und/oder das Enzym für den enzymatischen Abbau von PET ein rekombinantes Enzym ist.

60. Mikroorganismus gemäß Anspruch 58 oder 59, wobei das Enzym für die enzymatische Glycosylierung eine Glucosidase, eine Galactosidase oder eine Fructosidase ist.

61 . Mikroorganismus gemäß Anspruch 60, wobei das Enzym für die enzymatische Glycosylierung eine Glucosidase ist.

62. Mikroorganismus gemäß Anspruch 61 , wobei die Glucosidase eine a- Glucosidase oder eine ß-Glucosidase ist.

63. Mikroorganismus gemäß mindestens einem der Ansprüche 58 bis 62, wobei das Enzym für den enzymatischen Abbau von PET eine Hydrolase ist.

64. Mikroorganismus gemäß Anspruch 63, wobei die Hydrolase PETase aus Idionella sakaiensis ist.

65. Mikroorganismus gemäß Anspruch 63 oder 64, wobei die Hydrolase die in SEQ ID NO: 1 gezeigte Aminosäuresequenz umfasst.

Description:
BESCHREIBUNG

GLYCOSYLIERTE MONO(2-HYDROXYETHYL) TEREPHTHALSÄURE UND GLYCOSYLIERTE BIS(2-HYDROXYETHYL) TEREPHTHALSÄURE

GEBIET DER ERFINDUNG

Die Erfindung betrifft eine Mono(2-hydroxyethyl)terephthalsäure bzw. Bis(2- hydroxyethyl) terephthalsäure enthaltende Verbindung, die zur Verwendung als Feinchemikalien, Wirkstoff, oder Ausgangsstoff für die Biohybhdpolymere dient.

STAND DER TECHNIK

S. Yoshida et. al berichteten über den Baktehenstamm /. sakaiensis. Dieser ist in der Lage an dem Polyethylenterephthalat (Kurzzeichen PET), ein durch Polykondensation hergestellter thermoplastischer Kunststoff aus der Familie der Polyester, anzuheften und diesen abzubauen. Das Enzym PETase wird von dem Bakterienstamm freigesetzt, es hydrolysiert PET und dabei ensteht Mono(2- hydroxyethyl) terephthalsäure (MHET) (Fig. 1 ) (Lit. S. Yoshida et. al. Science 351 , 1 196 (2016);

U. Bornscheuer, Science 351 , 1 154 (2016). In einem weiteren Schritt wird MHET zu den Monomeren Ethylenglycol und Terephthalsäure hydrolysiert.

BESCHREIBUNG DER ERFINDUNG

PET dient u.a. der Herstellung von Kunststoffflaschen (PET-Flaschen), Folien und Textilfasern. Die weltweite Produktion liegt bei 40 Millionen Tonnen im Jahr. Bislang war es schwierig, PET zu nutzbaren Stoffen abzubauen bzw. für die Synthese zu nutzen.

Diese Aufgabe wird erfindungsgemäß gelöst durch die Glycosylierung von dem Stoff Mono(2-hydroxyethyl) terephthalsäure (MHET) und Glycosylierung von dem Stoff Bis(2-hydroxyethyl) terephthalsäure (BHET).

Die vorliegende Erfindung bietet den Vorteil, dass sie es ermöglicht aus Abfallbzw. Abbauprodukten der PET-Herstellung neue chemische Verbindungen zu erzeugen. Diese chemischen Verbindungen umfassen erfindungsgemäß glycosylierte Mono(2-hydroxyethyl) terephthalsäure (MHET) oder glycosylierte Bis(2-hydroxyethyl) terephthalsäure (BHET). Diese chemischen Verbindungen können auf verschiedene Weise vorteilhaft verwendet werden, beispielsweise als Feinchemikalien, Wirkstoffe oder Biopolymere. Somit ermöglicht es die Erfindung, aus PET- Abfall- bzw. Abbauprodukten neue Chemikalien herzustellen.

Ein weiterer vorteilhafter Aspekt der Erfindung ist es, dass die Glycosylierung von Mono(2-hydroxyethyl) terephthalsäure (MHET) oder Bis(2-hydroxyethyl) terephthalsäure (BHET) sowie die weiteren optionalen Verfahrensschritte der Erfindung fast vollständig enzymatisch ausgeführt werden können.

Zudem besitzen die glycosylierten Verbindungen erfindungsgemäß vorteilhafte Oberflächeneigenschaften. Aufgrund dieser Eigenschaften können die Verbindungen gemäß der Erfindung vielseitig verwendet werden, wie etwa als Zellkultursubstrate.

Außerdem begünstigt erfindungsgemäß die Glycosylierung der Verbindungen der vorliegenden Erfindung ihre biologische Abbaubarkeit und Biokompatibilität. Aus diesem Grund können die Verbindungen der Erfindung erfindungsgemäß in vorteilhafter Weise in medizinischen Anwendungen, insbesondere in biomedizinischen Anwendungen, verwendet werden.

Die vorliegende Erfindung stellt somit die folgenden bevorzugten Ausführungsformen bereit:

Bevorzugte Ausführungsformen:

1 . Verbindung, umfassend glycosylierte Mono(2-hydroxyethyl) terephthalsäure (MHET) oder glycosylierte Bis(2-hydroxyethyl) terephthalsäure (BHET).

2. Verbindung gemäß Ausführungsform 1 , wobei das MHET oder BHET und ein Saccharid über eine glycosidische Bindung chemisch aneinander gebunden sind.

3. Verbindung, umfassend chemisch an ein Saccharid gebundene Mono(2- hydroxyethyl) terephthalsäure (MHET) oder Bis(2-hydroxyethyl) terephthalsäure.

4. Verbindung gemäß Ausführungsform 3, wobei das MHET oder BHET und das Saccharid über eine glycosidische Bindung chemisch aneinander gebunden sind.

5. Verbindung gemäß mindestens einer der Ausführungsformen 2 bis 4, wobei das Saccharid ein Monosaccharid oder Disaccharid ist.

6. Verbindung gemäß Ausführungsform 5, wobei das Monosaccharid oder Disaccharid ausgewählt ist aus einer Gruppe, die Hexosen und Pentosen enthält.

7. Verbindung gemäß Ausführungsform 5, wobei das Monosaccharid oder Disaccharid ausgewählt ist aus α -Glucose, ß-Glucose, α-Fructose, ß- Fructose, a- Galactose und ß-Galactose, α-Mannose und ß-Mannose, Xylose, N-Acetylglucosamin, Glucosamin und Glucuronsäure.

8. Verbindung gemäß mindestens einer der Ausführungsformen 1 bis 7, wobei die Verbindung durch enzymatische Glycosylierung von MHET oder BHET erhältlich ist. Verbindung gemäß mindestens einer der Ausführungsformen 1 bis 8, wobei die Verbindung durch durch enzymatische Glycosylierung von MHET oder BHET entsteht. Verbindung gemäß Ausführungsform 8 oder 9, wobei die enzymatische Glycosylierung durch eine Glucosidase, eine Galactosidase oder eine Fructosidase katalysiert wird. Verbindung gemäß Ausführungsform 10, wobei die enzymatische Glycosylierung durch eine Glucosidase katalysiert wird. Verbindung gemäß Ausführungsform 1 1 , wobei die Glucosidase eine a- Glucosidase oder eine ß-Glucosidase ist. Verbindung gemäß mindestens einer der Ausführungsformen 8 bis 12, wobei das MHET oder BHET durch bakteriellen Abbau oder enzymatischen Abbau aus Polyethylenterephtalat (PET) erhältlich ist. Verbindung gemäß mindestens einer der Ausführungsformen 8 bis 13, wobei das MHET oder BHET durch bakteriellen Abbau oder enzymatischen Abbau aus Polyethylenterephtalat (PET) entsteht. Verbindung gemäß Ausführungsform 13 oder 14, wobei der enzymatische Abbau von PET durch eine Hydrolase katalysiert wird. Verbindung gemäß Ausführungsform 15, wobei die Hydrolase PETase aus Idionella sakaiensis ist. Verbindung gemäß Ausführungsform 15 oder 16, wobei die Hydrolase die in SEQ ID NO: 1 gezeigte Aminosäuresequenz umfasst. Verbindung gemäß mindestens einer der Ausführungsformen 13 bis 17, wobei das Enzym für die enzymatische Glycosylierung von MHET oder BHET und das Enzym für den enzymatischen Abbau von PET zusammen eingesetzt werden. Verbindung gemäß Ausführungsform 18, wobei ein Mikroorganismus, der das Enzym für die enzymatische Glycosylierung und das Enzym für den enzymatischen Abbau von PET beherbergt, verwendet wird. Verbindung gemäß mindestens einer der Ausführungsformen 1 bis 19, bestehend aus MHET oder BHET, das über eine glycosidische Bindung chemisch an ein Saccharid gebunden ist. Verbindung gemäß mindestens einer der Ausführungsformen 1 bis 20, wobei die Verbindung eine der folgenden Strukturen (a) oder (b) aufweist: (a)

wobei Ri ein über eine glycosidische Bindung gebundenes Saccharid umfasst, und R 2 ein über eine glycosidische Bindung gebundenes Saccharid umfasst oder H ist.

Verbindung gemäß mindestens einer der Ausführungsformen 1 bis 19, wobei die Verbindung weiterhin mindestens einen Methacryl-Rest umfasst. Verbindung gemäß Ausführungsform 22, wobei die Verbindung die folgende Struktur aufweist:

wobei Ri ein über eine glycosidische Bindung gebundenes Saccharid umfasst und R2 einen Methacryl-Rest umfasst. Verbindung gemäß Ausführungsform 23, wobei die Verbindung die folgende Struktur aufweist:

Verbindung gemäß Ausführungsform 23, wobei die Verbindung die folgende Struktur aufweist:

Verbindung gemäß Ausführungsform 23, wobei die Verbindung die folgende Struktur aufweist:

Verbindung gemäß einer der Ausführungsformen 1 bis 19, wobei die Verbindung weiterhin eine lipophile Seitenkette umfasst. Verbindung gemäß Ausführungsform 27, wobei die Verbindung die folgende Struktur aufweist:

wobei Ri ein über eine glycosidische Bindung gebundenes Saccharid umfasst und R2 eine lipophile Seitenkette, bevorzugt eine gesättigte oder ungesättigte aliphatische Kohlenwasserstoffseitenkette, oder einen Linker umfasst.

Verbindung gemäß Ausführungsform 28, wobei R2 eine gesättigte oder ungesättigte aliphatische C 5 bis C20 Kohlenwasserstoffseitenkette, bevorzugt eine gesättigte oder ungesättigte aliphatische C 5 bis C15 Kohlenwasserstoffseitenkette, bevorzugter eine gesättigte oder ungesättigte aliphatische Cs bis C12 Kohlenwasserstoffseitenkette, noch bevorzugter eine gesättigte oder ungesättigte aliphatische C 10 Kohlenwasserstoffseiten kette und besonders bevorzugt eine gesättigte aliphatische C10 Kohlenwasserstoffseiten kette ist.

Verbindung gemäß Ausführungsform 28, ausgewählt aus einer Verbindung, die die folgende Struktur (a) bis (j) aufweist:

 wobei n 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19 oder 20 ist. Verbindung gemäß Ausführungsform 2 bis 24, 26 bis 29 oder 30(b)-(j), wobei das über eine glycosidische Bindung chemisch an MHET oder BHET gebundene Saccharid methacryliert ist. Polymer einer Verbindung gemäß mindestens einer der Ausführungsformen 1 bis 31 . Polymer gemäß Ausführungsform 32, wobei das Polymer ein Biohybridpolymer ist. Verfahren zur Herstellung einer Verbindung, die glycosylierte Mono(2- hydroxyethyl) terephthalsäure (MHET) oder glycosylierte Bis(2- hydroxyethyl) terephthalsäure (BHET) umfasst, wobei das Verfahren den Schritt der enzymatischen Glycosylierung von Mono(2-hydroxyethyl) terephthalsäure (MHET) oder Bis(2-hydroxyethyl) terephthalsäure (BHET) umfasst. Verfahren gemäß Ausführungsform 34, wobei im Schritt der enzymatischen Glycosylierung das MHET oder BHET und ein Saccharid über eine glycosidische Bindung chemisch aneinander gebunden werden. Verfahren gemäß Ausführungsform 35, wobei das Saccharid ein Monosaccharid oder Disaccharid ist. Verfahren gemäß Ausführungsform 36, wobei das Monosaccharid oder Disaccharid ausgewählt ist aus einer Gruppe, die Hexosen und Pentosen enthält. Verfahren gemäß Ausführungsform 37, wobei das Monosaccharid oder Disaccharid ausgewählt ist aus α -Glucose, ß-Glucose, α-Fructose, ß- Fructose, a- Galactose und ß-Galactose, α-Mannose und ß-Mannose, Xylose, N-Acetylglucosamin, Glucosamin und Glucuronsäure. Verfahren gemäß mindestens einer der Ausführungsformen 34 bis 38, wobei die enzymatische Glycosylierung durch eine Glucosidase, eine Galactosidase oder eine Fructosidase katalysiert wird. Verfahren gemäß Ausführungsform 39, wobei die enzymatische Glycosylierung durch eine Glucosidase katalysiert wird. Verfahren gemäß Ausführungsform 40, wobei die Glucosidase eine a- Glucosidase oder eine ß-Glucosidase ist. Verfahren gemäß mindestens einer der Ausführungsformen 34 bis 41 , wobei das MHET oder BHET durch bakteriellen Abbau oder enzymatischen Abbau aus Polyethylenterephtalat (PET) erhältlich ist. Verfahren gemäß mindestens einer der Ausführungsformen 34 bis 42, wobei das Verfahren vor dem Schritt der enzymatischen Glycosylierung vorzugsweise einen Schritt des bakteriellen Abbaus oder enzymatischen Abbaus von Polyethylenterephtalat (PET) zu MHET oder BHET umfasst. Verfahren gemäß Ausführungsform 42 oder 43, wobei der enzymatische Abbau von PET durch eine Hydrolase katalysiert wird. Verfahren gemäß Ausführungsform 44, wobei die Hydrolase PETase aus Idionella sakaiensis ist. Verfahren gemäß Ausführungsform 44 oder 45, wobei die Hydrolase die in SEQ ID NO: 1 gezeigte Aminosäuresequenz umfasst. Verfahren gemäß mindestens einer der Ausführungsformen 42 bis 46, wobei das Enzym für die enzymatische Glycosylierung von MHET oder BHET und das Enzym für den enzymatischen Abbau von PET zusammen eingesetzt werden. Verfahren gemäß Ausführungsform 47, wobei ein Mikroorganismus, der das Enzym für die enzymatische Glycosylierung und das Enzym für den enzymatischen Abbau von PET beherbergt, verwendet wird. Verfahren gemäß einer der Ausführungsformen 34 bis 48, wobei in einem weiteren Schritt ein Methacryl-Rest chemisch an das glycosylierte MHET oder BHET gebunden wird, wobei der Methacryl-Rest bevorzugt durch eine enzymatische Veresterung chemisch an das glycosylierte MHET oder BHET gebunden wird, wobei die enzymatische Veresterung bevorzugt durch eine Lipase katalysiert wird. Verfahren gemäß Ausführungsform 49, wobei der Methacryl-Rest durch Zugabe von Vinylmethylmethacrylat chemisch an das glycosylierte MHET oder BHET gebunden wird. Verfahren gemäß mindestens einer der Ausführungsformen 34 bis 48, wobei in einem weiteren Schritt eine lipophile Seitenkette, bevorzugt eine gesättigte oder ungesättigte aliphatische Kohlenwasserstoffseitenkette, chemisch an das glycosylierte MHET oder BHET gebunden wird. Verfahren gemäß Ausführungsform 51 , wobei die lipophile Seitenkette eine gesättigte oder ungesättigte C 5 bis C20 Kohlenwasserstoffseitenkette, bevorzugt eine gesättigte oder ungesättigte C 5 bis C15 Kohlenwasserstoffseitenkette, bevorzugter eine gesättigte oder ungesättigte Cs bis C12 Kohlenwasserstoffseitenkette, noch bevorzugter eine gesättigte oder ungesättigte C10 Kohlenwasserstoffseitenkette und besonders bevorzugt eine gesättigte C10 Kohlenwasserstoffseitenkette ist. Verfahren gemäß Ausführungsform 52, wobei die lipophile Seitenkette eine gesättigte C10 Kohlenwasserstoffseiten kette ist, Verfahren gemäß einer der Ausführungsformen 51 bis 53, wobei die lipophile Seitenkette durch Zugabe von Decanol gebunden wird. Verfahren gemäß mindestens einer der Ausführungsformen 34 bis 54, wobei nach dem Schritt der enzymatischen Glycosylierung ein Schritt der Polymerisierung folgt. Polymer, erhältlich durch das Verfahren gemäß einer der Ausführungsformen 34 bis 55. Polymer gemäß Ausführungsform 56, wobei das Polymer ein Biohybridpolymer ist. Mikroorganismus, welcher mindestens ein Enzym für die enzymatische Glycosylierung von MHET und/oder BHET und mindestens ein Enzym für den enzymatischen Abbau von PET beherbergt. Mikroorganismus gemäß Ausführungsform 58, wobei der Mikroorganismus ein rekombinanter Mikroorganismus ist und das Enzym für die enzymatische Glycosylierung von MHET und/oder BHET und/oder das Enzym für den enzymatischen Abbau von PET ein rekombinantes Enzym ist. Mikroorganismus gemäß Ausführungsform 58 oder 59, wobei das Enzym für die enzymatische Glycosylierung eine Glucosidase, eine Galactosidase oder eine Fructosidase ist. Mikroorganismus gemäß Ausführungsform 60, wobei das Enzym für die enzymatische Glycosylierung eine Glucosidase ist. Mikroorganismus gemäß Ausführungsform 61 , wobei die Glucosidase eine α-Glucosidase oder eine ß-Glucosidase ist. Mikroorganismus gemäß mindestens einer der Ausführungsformen 58 bis 62, wobei das Enzym für den enzymatischen Abbau von PET eine Hydrolase ist. Mikroorganismus gemäß Ausführungsform 63, wobei die Hydrolase PETase aus Idionella sakaiensis ist. Mikroorganismus gemäß Ausführungsform 63 oder 64, wobei die Hydrolase die in SEQ ID NO: 1 gezeigte Aminosäuresequenz umfasst. Verbindung, die durch enzymatische Glycosylierung von Mono(2- hydroxyethyl) terephthalsäure (MHET) oder Bis(2-hydroxyethyl) terephthalsäure ensteht, wobei MHET oder Bis(2-hydroxyethyl) terephthalsäure durch bakteriellen Abbau oder enzymatischen Abbau aus PET entsteht.

Verbindung, gekennzeichnet durch ein chemisch an ein Saccharid gebundenes Mono(2-hydroxyethyl) terephthalsäure (MHET) bzw. Bis(2- hydroxyethyl) terephthalsäure. 68. Verbindung nach Ausführungsform 66 und 67, wobei das MHET oder Bis(2- hydroxyethyl) terephthalsaure und das Saccharid über eine glycosidische Bindung chemisch aneinander gebunden sind. 69. Verbindung, die nach Glycosylierung von Mono(2-hydroxyethyl) terephthalsaure (MHET) oder Bis(2-hydroxyethyl) terephthalsaure polymerisiert werden kann.

70. Verbindung nach Ausführungsform 66 oder 67, wobei das Saccharid ein Monosaccharid oder Disaccharid ist.

71 . Verbindung nach Ausführungsform 70, wobei das Monosaccharid oder Disaccharid ausgewählt ist aus einer Gruppe, die Hexosen und Pentosen (a -Glucose, ß-Glucose, a-Fructose, ß-Fructose, a- Galactose und ß- Galactose, α-Mannose und ß-Mannose, Xylose, N-Acetylglucosamin,

Glucosamin, Glucuronsäure) enthält.

KURZE BESCHREIBUNG DER ZEICHNUNGEN

Fig. 1 : Abbildung aus: U. Bornscheuer, Science 351 , 1 154 (2016); Abbau von PET durch /. sakaiensis.

Fig. 2: Beispielhafte Darstellung der Glucosylierung von aus PET gewonnenem

MHET durch Verwendung von Mikroorganismen.

Fig. 3: Ein Biohybridpolymer aus glucosyliertem MHET.

Fig. 4: Glycosyliertes MHET dient als Wirkstoff, Feinchemikalie oder der Synthese von Polymeren.

Fig. 5: Beispielhafte Struktur eines Biohybridpolymer aus glucosyliertem MHET oder Bis(2-hydroxyethyl) terephthalsaure.

Fig. 6: Glycosyliertes MHET und glycosyliertes Bis(2-hydroxyethyl) terephthalsaure kann mit Methacrylat verknüpft werden. Dazu wird Methacrylat enzymatisch mit einer oder mehreren Alkohol-Funktionen von MHET bzw. Bis(2- hydroxyethyl) terephthalsaure verestert.

Fig. 7: Glycosyliertes MHET und glycosyliertes Bis(2-hydroxyethyl) terephthalsaure kann mit Methacrylat verknüpft werden. Dazu wird Methacrylat enzymatisch mit einer oder mehreren Alkohol-Funktionen von MHET bzw. Bis(2- hydroxyethyl) terephthalsaure verestert.

Fig. 8: Synthetisierte glycosylierte BHET-Methacrylate und glycosylierte MHET- Methacrylate lassen sich mit Hilfe eines Radikalstarters z.B. Kaliumperoxodisulfat polymerisieren.

Fig. 9: Synthetisierte glycosylierte BHET-Methacrylate und glycosylierte MHET- Methacrylate lassen sich mit Hilfe eines Radikalstarters z.B. Kaliumperoxodisulfat polymerisieren.

Fig. 10: Synthetisierte glycosylierte BHET-Methacrylate und glycosylierte MHET- Methacrylate lassen sich mit Hilfe eines Radikalstarters z.B. Kaliumperoxodisulfat polymerisieren.

Fig. 1 1 : Glycosyliertes MHET und glycosyliertes Bis(2-hydroxyethyl) terephthalsaure kann ebenfalls mit aliphatischen Alkoholen verknüpft werden. Dazu z.B. Dodecanol enzymatisch mit ΒΗΕΤ-α-Glc verestert.

Fig. 12: Anstelle des Decanols sind auch Thiole, Amine und weitere Alkohole mit glycosylierten BHET konjugierbar.

Fig. 13: Beispielhafte Darstellung der Struktur von α-glycosyliertem MHET. Fig. 14: Beispielhafte Darstellung der Struktur von MHET.

Fig. 15: Beispielhafte Darstellung der Struktur von ß-glycosyliertem MHET.

Fig. 16: 1 H-NMR-Spektrum von ß-glycosyliertem MHET.

Fig. 17: 13 C-NMR-Spektrum von ß-glycosyliertem MHET.

Fig. 18: Beispielhafte Darstellung der Struktur von Di-1 ,3-ß-glucosyliertem MHET.

Fig. 19: Beispielhafte Darstellung der Struktur von ß-galactosyliertem MHET.

Fig. 20: 1 H-NMR-Spektrum von ß-galactosyliertem MHET.

Fig. 21 : 13 C-NMR-Spektrum von ß-galactosyliertem MHET.

Fig. 22: Beispielhafte Darstellung der Struktur von α-glucosyliertem Bis(2- hydroxyethyl)terephtalat.

Fig. 23: 1 H-NMR-Spektrum von a-glucosyliertem Bis(2-hydroxyethyl)terephtalat. Fig. 24: 13 C-NMR-Spektrum von a-glucosyliertem Bis(2-hydroxyethyl)terephtalat. Fig. 25: Beispielhafte Darstellung der Struktur von Di- a-1 ,6-glucosyliertem Bis(2- hydroxyethyl)terephtalat.

Fig. 26: 1 H-NMR-Spektrum von Di- a-1 ,6-glucosyliertem Bis(2- hydroxyethyl)terephtalat.

Fig. 27: 13 C-NMR-Spektrum von Di- a-1 ,6-glucosyliertem Bis(2- hydroxyethyl)terephtalat.

Fig. 28: Beispielhafte Darstellung der Struktur von ß-glucosyliertem Bis(2- hydroxyethyl)terephtalat.

Fig. 29: 1 H-NMR-Spektrum von ß-glucosyliertem Bis(2-hydroxyethyl)terephtalat. Fig. 30: 13 C-NMR-Spektrum von ß-glucosyliertem Bis(2-hydroxyethyl)terephtalat. Fig. 31 : Beispielhafte Darstellung der Struktur von ß-galactosyliertem Bis(2- hydroxyethyl)terephtalat.

Fig. 32: 1 H-NMR-Spektrum von ß-galactosyliertem Bis(2-hydroxyethyl)terephtalat. Fig. 33: 13 C-NMR-Spektrum von ß-galactosyliertem Bis(2-hydroxyethyl)terephtalat. Fig. 34: Beispielhafte Darstellung der Struktur von Di- ß-glucosyliertem Bis(2- hydroxyethyl)terephtalat.

Fig. 35: 1 H-NMR-Spektrum von Di- ß-glucosyliertem Bis(2- hydroxyethyl)terephtalat.

Fig. 36: 13 C-NMR-Spektrum von Di- ß-glucosyliertem Bis(2- hydroxyethyl)terephtalat.

Fig. 37: Beispielhafte Darstellung der Struktur von glycosyliertem MA-BHET-a-GIc. Fig. 38: 1 H-NMR-Spektrum von glycosyliertem MA-BHET-a-GIc.

Fig. 39: 13 C-NMR-Spektrum von glycosyliertem MA-BHET-a-GIc.

Fig. 40: Beispielhafte Darstellung der Struktur von glycosyliertem MA 2 -BHET-a-

Glc.

Fig. 41 : 1 H-NMR-Spektrum von glycosyliertem MA 2 -BHET-a-Glc.

Fig. 42: 13 C-NMR-Spektrum von glycosyliertem MA 2 -BHET-a-Glc.

Fig. 43: Beispielhafte Darstellung der Struktur von glycosyliertem a-GIc-MHET-

Decanol.

Fig. 44: 1 H-NMR-Spektrum von glycosyliertem a-GIc-MHET-Decanol.

Fig. 45: 13 C-NMR-Spektrum von glycosyliertem a-GIc-MHET-Decanol.

Fig. 46: Beispielhafte Darstellung der Struktur von α-glucosyliertem MHET.

Fig. 47: 1 H-NMR-Spektrum von a-glucosyliertem MHET.

Fig. 48: 13 C-NMR-Spektrum von a-glucosyliertem MHET.

Fig. 49: Nachweis des Polymers; gezeigt ist das 1 H-NMR-Spektrum des Polymers. Fig. 50: Exemplarisches 13 C-NMR-Spektrum von MHET gezeigt

AUSFÜHRLICHE BESCHREIBUNG DER ERFINDUNG

Definitionen und allgemeine Techniken

Falls nicht anders angegeben, sind die in der vorliegenden Erfindung verwendeten Begriffe in der für den Fachmann geläufigen Bedeutung zu verstehen.

Begriffe wie „umfassen" oder„umfassend" werden hier derart verwendet, dass jedes Vorkommen dieser Begriffe optional jeweils mit „bestehen aus" bzw. „bestehend aus" ersetzt werden kann.

Begriffe wie„enthalten" oder„enthaltend" werden hier in der für den Fachmann geläufigen Bedeutung verwendet. Optional kann jedes Vorkommen dieser Begriffe jeweils mit„bestehen aus" bzw.„bestehend aus" ersetzt werden.

Der Begriff „Verbindung" wird hier so verwendet, wie er vom Fachmann verstanden werden würde, d.h. dass er insbesondere „chemische Verbindung" meint. Der Begriff „Verbindung, umfassend glycosylierte Mono(2-hydroxyethyl) terephthalsaure (MHET) oder glycosylierte Bis(2-hydroxyethyl) terephthalsaure (BHET)" ist dahingehend zu verstehen, dass mit der jeweiligen Mono(2- hydroxyethyl) terephthalsaure (MHET) bzw. Bis(2-hydroxyethyl) terephthalsaure (BHET) optional auch Ester, Amide, Thioester und Ether der jeweiligen Mono(2- hydroxyethyl) terephthalsaure (MHET) bzw. Bis(2-hydroxyethyl) terephthalsaure (BHET) gemeint sind. In einer Ausführungsform sind Ester, Amide, Thioester und Ether der jeweiligen Mono(2-hydroxyethyl) terephthalsaure (MHET) bzw. Bis(2- hydroxyethyl) terephthalsaure (BHET) nicht von dem Begriff „Verbindung, umfassend glycosylierte Mono(2-hydroxyethyl) terephthalsaure (MHET) oder glycosylierte Bis(2-hydroxyethyl) terephthalsaure (BHET)" umfasst.

Als glycosidische Bindung bezeichnet man die chemische Bindung zwischen dem anomeren Kohlenstoffatom eines Glycons, also eines Saccharids, und dem Hetero- oder seltener Kohlenstoffatom eines Aglycons, eines„Nichtzuckers". Eine glycosidische Bindung kann sowohl eine α-glycosidische Bindung als auch eine ß- glycosidische Bindung sein. Die Präfixe α und ß definieren die anomere Konfiguration.

Eine glycosidische Bindung kann durch enzymatische Glycosylierung entstehen. Enzymatische Glycosylierung kann durch eine Glycosidase katalysiert werden, Glycosidasen gehören zur Enzymklasse der Hydrolasen und sind klassifiziert unter EC 3.2.1 .. Glycosidasen können reversibel a- oder ß-glycosidische Bindungen hydrolysieren. Beispiele für Glycosidasen umfassen Glucosidasen, Galactosidasen, Sialidasen, Mannosidasen, Fucosidasen, Xylosidasen, Glucuronidase, α-L-Arabinofuranosidase, exo-ß-Glucosaminidase, Galacturonase, Glucosaminidase, N-Acetylglucosaminidase und Fructosidasen. Speziell kann eine Glycosidase eine a- oder ß-Glucosidase sein. Weiterhin kann eine Glycosidase eine ß- Galactosidase sein.

Lipophil kann insbesondere hydrophob bedeuten. Lipophile Seitenketten umfassen beispielsweise Kohlenwasserstoffe, und insbesondere aliphatische Kohlenwasserstoffe. Eine Kohlenwasserstoffseitenkette ist eine Seitenkette, die aus Kohlenstoff und Wasserstoff besteht. Dabei kann die Kohlenwasserstoffseitenkette gesättigt oder ungesättigt vorliegen. Eine ungesättigte Kohlenwasserstoffseitenkette schließt sowohl eine einfach als auch eine mehrfach ungesättigte Kohlenwasserstoffseitenkette ein. Die Kohlenwasserstoffseitenkette kann Zweifachbindungen und Dreifachbindungen zwischen zwei Kohlenstoffatomen umfassen. Weiterhin können gegebenenfalls einzelne Kohlenstoffatome in der Kohlenwasserstoff kette durch Heteroatome ersetzt werden. Die Kohlenwasserstoff kette kann unverzweigt oder verzweigt sein. Die Kohlenwasserstoff kette kann acyclisch oder cyclisch sein.

Bei Mehrfachglycosylierungen wird typischerweise zuerst der Akzeptor glycosyliert. Wenn genügend monoglycosylierter Akzeptor in der Reaktionsmischung vorliegt, kann es zu Mehrfachglycosylierungen kommen.

Als Glycosidasen für die enzymatischen Synthesen können beispielsweise verwendet werden: α-Glucosidase (Saccharose Isomerase): in Suspension von Mikroorganismen (Protaminobacter rubrum Z 12 (CBD 574.77)). Sie kann bevorzugt für die Monoglucosylierung eingesetzt werden. Der optimale pH Wert für die enzymatische Reaktion beträgt pH = 6; α-Glucosidase, GTFR aus Streptococcus oralis überträgt zuerst eine Glukose auf den Akzeptor. Nach längerer Reaktionszeit wird eine weitere Glucoseeinheit auf die Glukose des glucosylierten Akzeptors übertragen, wie beispielsweise in Beispiel (6) demonstriert. Der optimale pH Wert für die enzymatische Reaktion beträgt pH = 6. GTFR aus S. oralis kann wie in Fujiwara et al. (Fujiwara et al., Infect Immun., 2000; 68(5):2475-83 2000) aufgereinigt werden. ß-Glucosidase aus Mandeln EC.3.2.1 .21 , CAS 9001 -22-3 (BioChemika 49290, WA10531 ). Der optimale pH Wert für die enzymatische Reaktion beträgt pH = 5,2. ß-Galactosidase aus Aspergillus oryzae, CAS 9031 -1 1 -2 (Sigma G5160-25KU). Der optimale pH Wert für die enzymatische Reaktion beträgt pH= 5,2. ß-Fructosidase aus Hefe (Boehringer Mannheim GmbH, Bestellnummer 104914). Der optimale pH Wert für die enzymatische Reaktion beträgt pH = 5,2.

Für die enzymatische Veresterung bzw. Umesterung kann die Lipase Novozymes 435 verwendet werden. Der optimale pH Wert für die enzymatische Reaktion beträgt pH = 7,5.

Allgemeine Beschreibung zur Trennung von Reaktionsgemischen und Isolierung von Reaktionsprodukten gemäß der Erfindung:

Alle erfindungsgemäßen Verbindungen können isoliert vorliegen. Dementsprechend umfassen alle erfindungsgemäßen Verfahren vorzugsweise das Isolieren der jeweiligen Verbindung.

Dies kann bevorzugt wie folgt durchgeführt werden:

Die Reaktionsgemische werden von Lösungsmitteln abdestilliert oder lyophilisiert. Glycosyliertes MHET bzw. glycoysliertes BHET wird säulenchromatographisch getrennt. Das Chromatographiematerial ist Kieselgel 60 (Macherey Nagel, 0,044- 0,063 mm). Pro Gramm zu trennendes Reaktionsgemisch werden 100 g Kieselgel genutzt. Das Trenngefäß sind Glasäulen. Bevorzugt werden Säulen mit dem Durchmesser zur Länge von 1 :20 genutzt. Das Kieselgel wird in einem Lösungsmittelgemisch aus Ethylacetat: Isopropanol: Wasser (Volumenverhältnis 6:3:1 ), bei unpolareren Substanzen wird ein Gemisch aus Ethylacetat: Methanol (Volumenverhältnis 12:1 ) genutzt, aufgeschwämmt und die Säule befüllt. Anschließend wird das Reaktionsgemisch in so wenig Laufmittel wie möglich gelöst (vorzugsweise 1 g in 1 ml) und auf die Säule gegeben. Die Trennung erfolgt durch Eluation mit dem Laufmittel. Das Eluat wird in Gefäßen (a 10 mL) aufgefangen und per HPLC bestimmt, in welchen Gefäßen das Produkt enthalten ist. Die Gefäße mit Produkt werden vereinigt und die Lösungsmittel verdampft. Man erhält einen Feststoff. Ausführungsformen

In der Erfindung wird MHET oder Bis(2-hydroxyethyl) terephthalsaure mit Hilfe eines Enzyms und einem Glycosubstrat glycosyliert. Als Glycosubstrate werden Disaccharide (z.B. Saccharose, Lactose, Maltose), Oligosaccharide (Maltooligosaccharide) oder Polysaccharide (Dextran, Fructooligosaccharide, Chitin, Mannan, Cellulose) eingesetzt. Die Herstellung von glycosyliertem MHET oder Bis(2-hydroxyethyl) terephthalsaure kann ausgehend von MHET oder Bis(2- hydroxyethyl) terephthalsaure erfolgen. MHET oder Bis(2-hydroxyethyl) terephthalsaure kann aus PET mit Hilfe einer Hydrolase hergestellt werden z.B. mit der PETase aus l.sakaiensis, z.B. mit der in SEQ ID NO: 1 gezeigten Aminosäuresequenz:

MNFPRASRLMQAAVLGGLMAVSAAATAQTNPYARGPNPTAASLEASAGPFTVR SFTVSRPSGYGAGTVYYPTNAGGTVGAIAIVPGYTARQSSIKWWGPRLASHGFV VITIDTNSTLDQPSSRSSQQMAALRQVASLNGTSSSPIYGKVDTARMGVMGWSM GGGGSLISAANNPSLKAAAPQAPWDSSTNFSSVTVPTLIFACENDSIAPVNSSAL PIYDSMSRNAKQFLEINGGSHSCANSGNSNQALIGKKGVAWMKRFMDNDTRYS TFACENPNSTRVSDFRTANCS (SEQ ID NO: 1 ). Beide Enzyme können zusammen eingesetzt werden. Ein Mikroorganismus, der beide Enzyme beherbergt, kann ebenfalls der Herstellung dienen (siehe Fig. 2).

Die erfindungsgemäß angegebene Verbindung ist durch ein chemisch an ein Saccharid gebundenes MHET oder Bis(2-hydroxyethyl) terephthalsäure gekennzeichnet. Glycosyliertes MHET oder Bis(2-hydroxyethyl) terephthalsäure kann als ein Wirkstoff eingesetzt werden. Glycosyliertes MHET oder Bis(2- hydroxyethyl) terephthalsäure kann ebenfalls zu Biohybridpolymeren polymerisiert werden, (siehe Fig. 3)

Besonders bevorzugt sind das MHET oder Bis(2-hydroxyethyl) terephthalsäure und das Saccharid über eine glycosidische Bindung chemisch aneinander gebunden. Als glycosidische Bindung bezeichnet man die chemische Bindung zwischen dem anomeren Kohlenstoffatom eines Glycons, also eines Saccharids, und dem Hetero- oder seltener Kohlenstoffatom eines Aglycons, eines „Nichtzuckers". Verbindungen, die eine glycosidische Bindung enthalten, werden allgemein als Glycoside bezeichnet. Die Hydrolyse einer glycosidischen Bindung in einem Glycosid wird insbesondere durch Glucosidasen reversibel katalysiert, wobei das Glycon, vorliegend also das Saccharid, und das Agiycon, hier MHET oder Bis(2-hydroxyethyl) terephthalsaure, unter Verbrauch eines Wassermoleküls freigesetzt werden.

Vorzugsweise ist das Saccharid ein Monosaccharid. Monosaccharide sind Einfachzucker mit einem Grundgerüst aus mindestens drei verketteten Kohlenstoffatomen, die eine Carbonylgruppe (-C=O) und mindestens eine Hydroxylgruppe (-OH) aufweisen.

Glycosyliertes MHET oder Bis(2-hydroxyethyl) terephthalsaure dient als Feinchemikalie, Wirkstoff oder Ausgangsstoff für Biohybridpolymere (s. Fig. 4). So kann durch Polykondensation von glycosylierten MHET oder Bis(2-hydroxyethyl) terephthalsaure ein hergestellter thermoplastischer Kunststoff aus der Familie der Polyester enstehen. So wird durch Polykondensation von glycosylierten MHET oder Bis(2-hydroxyethyl) terephthalsaure ein thermoplastischer Kunststoff aus der Familie der Polyester enstehen.

Ebenso kann durch Umesterung von di- und monoglucosylierter Bis(2- hydroxyethyl) terephthalsaure mit Ethandiol ein Polyester hergestellt werden. Da es sich um eine Gleichgewichtsreaktion handelt, wird abgespaltenes Ethandiol albdestilliert. Es kommt zur Anreicherung der glycosylierten Bis(2-hydroxyethyl) terephthalsaure. Ebenso wird Mono- und diglycosylietes Bis(2-hydroxyethyl) terephthalsaure mit Terephthalsaure direkt zu einem Polyester verestert.

Als Katalysator kann z.B. Antimon(lll)-oxid eingesetzt werden.

Ein Biohybridpolymer aus glucosyliertem MHET oder Bis(2-hydroxyethyl) terephthalsaure kann die Struktur aus Fig. 5 annehmen.

Glvcosylierte MHET- und BHET-Methacrylate

Ebenso kann glycosyliertes MHET und glycosyliertes Bis(2-hydroxyethyl) terephthalsaure mit Methacrylat verknüpft werden. Dazu wird Methacrylat enzymatisch mit einer oder mehreren Alkohol-Funktionen von MHET bzw. Bis(2- hydroxyethyl) terephthalsäure verestert (Fig. 6, Fig. 7). Bei der Umsetzung von ΒΗΕΤ-α-Glc mit Vinylmethylacrylat bei 50°C und der Lipase Novozymes 435 ensteht bei Einsatz des Lösungsmittels tert-Butylalkohol das zweifach veresterte Produkt MA 2 -BHET-a-Glc und das einfach glycosylierte ΜΑ-ΒΗΕΤ-α-Glc (Fig. 6).

Polymerisation von qlvcosylierten BHET-Methacrylaten und qlvcosylierten MHET- Methacrylaten

Die so synthetisierten glycosylierten BHET-Methacrylate und glycosylierten MHET-Methacrylate lassen sich mit Hilfe eines Radikal Starters z.B. Kaliumperoxodisulfat polymerisieren (Fig. 8, Fig.9, Fig.10).

Ebenso besteht auch die Möglichkeit, diverse Methacrylate in verschiedenen Verhältnissen miteinander zu mischen und die Gemische zu polymerisieren. So können auch Blockpolymere entstehen.

Glvcosylierte MHET- und BHET-Lipide

Glycosyliertes MHET und glycosyliertes Bis(2-hydroxyethyl) terephthalsäure kann ebenfalls mit aliphatischen Alkoholen verknüpft werden. Dazu wird z.B. Decanol enzymatisch mit ΒΗΕΤ-α-Glc verestert (Fig. 1 1 ). Bei der Umsetzung von BHET-a- Glc mit Decanol bei 50°C und der Lipase Novozymes 435 ensteht bei Einsatz des Lösungsmittels tert-Butanol bevorzugt α-Glc-MHET-Decanol (Fig .1 1 ). Ebenso sind Anstelle des Decanols auch Thiole, Amine und weitere Alkohole mit glycosylierten BHET konjugierbar. Dies erlaubt die Einführung unterschiedlicher Linker, die u.a. Biotin enthalten oder für bioorthogonale Clickreaktionen zum Aufbau von Zellkulturgerüsten genutzt werden können (Fig. 12).

Besonders bevorzugt ist das Monosaccharid ausgewählt aus einer Gruppe, die Pentosen und Hexosen enthält. Hexosen weisen ein Kohlenstoffgrundgerüst mit sechs Kohlenstoffatomen auf und unterscheiden sich grundsätzlich durch die Art der Carbonylfunktion. Bei einer nicht endständigen Carbonylfunktion (Ri-C(O)-R 2 ), einer Ketogruppe, spricht man von Ketohexosen. Bei einer endständigen Carbonylfunktion, einer Aldehydgruppe, handelt es sich um Aldohexosen.

Pentosen (C 5 H10O 5 ) weisen ein Kohlenstoffgrundgerüst mit fünf Kohlenstoffatomen auf.

Die Hexosen sind vorzugsweise ausgewählt aus einer Gruppe, die α-Glucose, ß- Glucose, a-Fructose, ß-Fructose, a-Mannose, ß-Mannose, α-Galactose und ß- Galactose, N-Acetylglucosamin, Glucosamin, Glucuronsäure enthält. Je nachdem, welches Saccharid chemisch an das MHET oder Bis(2-hydroxyethyl) terephthalsäure gebunden ist, unterscheidet sich auch die Nomenklatur der Verbindung. Bei einer chemisch an das MHET oder Bis(2-hydroxyethyl) terephthalsäure gebundenen a- bzw. ß-Glucose handelt es sich bei der Verbindung um a- bzw. ß-glucosyliertes MHET oder Bis(2-hydroxyethyl) terephthalsäure . Bei einer a- bzw. ß-Galactose als chemisch gebundenes Saccharid spricht man von a- bzw. ß-galactosyliertem MHET oder Bis(2- hydroxyethyl) terephthalsäure . Ist eine a- bzw. ß-Fructose als Saccharid an das MHET gebunden, handelt es sich um a- bzw. ß-fructosyliertes MHET oder Bis(2- hydroxyethyl) terephthalsäure.

Vorteilhaft sind die Pentosen ausgewählt aus einer Gruppe, die Xylose, Arabinose oder Xylose enthält.

In einer besonders vorteilhaften Ausgestaltung der Erfindung ist α-Glucose über eine glycosidische Bindung mit MHET oder Bis(2-hydroxyethyl) terephthalsäure verbunden. Die Synthese des α-glycosylierten MHET oder Bis(2-hydroxyethyl) terephthalsäure erfolgt unter Wasserabspaltung aus α-Glucose und MHET oder Bis(2-hydroxyethyl) terephthalsäure. Hierbei entsteht α-glycosyliertes MHET oder Bis(2-hydroxyethyl) terephthalsäure.

Die Verbindung α-glycosylierten MHET ist vorzugsweise gekennzeichnet durch die in Fig. 13 gezeigte Strukturformel. Bei der Synthese des α-glycosylierten MHET wird eine glycosidische Bindung zwischen der a-Glucose und dem MHET geknüpft. Die Bindung erfolgt besonders vorteilhaft selektiv über die am 1 ' -Kohlenstoffatom gebundene Hydroxylgruppe des MHET. Das die α-Glucose mit dem MHET verbrückende Sauerstoffatom stammt vom MHET. Grundsätzlich erfolgt diese Bindungsknüpfung - unabhängig vom eingesetzten Saccharid - vorzugsweise selektiv über die am 1 ' - Kohlenstoffatom gebundene Hydroxylgruppe des MHETs. Das eingesetzte Enzym ist für die Selektivität der Bindungsknüpfung am 1 ' C-Atom verantwortlich.

Im Folgenden werden Ausführungsbeispiele der Erfindung anhand von Herstellungsverfahren der Verbindung näher erläutert.

BEISPIELE

Alle folgenden Ausführungsbeispiele wurden experimentell durchgeführt.

(1 ) Herstellung von MHET

MHET ist beispielhaft in Fig. 14 dargestellt.

Zu einer Lösung aus Terephthalsäure (2.00g, 12.04 mmol) in DMF (15ml) wurde NaHCO3 (3.05g, 36 mmol) gegeben. Die Mischung wurde 50min bei 85°C gerührt. Dann wurde 2-Bromo-1 -ethanol (0.75g, 426 μΙ, 6mmol) hinzugefügt und weitere 4h bei 85 °C gerührt. Der Reaktionsverlauf wird per Dünnschichtchromatographie (MeOH/CH 2 Cl2, 1 :4) verfolgt. Anschließend wird das Reaktionsgemisch über Silika filtriert und nach dem Einengen an Silika (MeOH/CH 2 Cl2, 1 :4) getrennt.

Zum spektroskopischen Nachweis von MHET wurden 1 H-NMR-Spektren und 13 C- NMR-Spektren aufgenommen.

Das 1 H-NMR-Spektrum 1 wurde bei 400 MHz in deuteriertem Dimethylsulfoxid aufgenommen, die Zuordnung der Signale ist Tabelle 1 zu entnehmen.

Tabelle 1 : Signalzuordnung 1 H-NMR-Spektrum von MHET Relatives Kopplungskonstante δ [ppm] Zuordnung Multiplizität

Integral J [Hz]

8.01 H-3, H-7 2H Dublett 8,37

7.93 H-4, H-6 2H Dublett 8,37

4.28 H-1 ' 2H Triplett

3.71 H-2' 2H Triplett

In Fig. 50 ist ein exemplarisches 13 C-NMR-Spektrum von MHET gezeigt. Das 13 C- NMR-Spektrum 1 1 wurde bei 100 MHz ebenfalls in deuteriertem Dimethylsulfoxid aufgenommen. Die Zuordnung der Signale ist in Tabelle 2 aufgeführt.

Tabelle 2: Signalzuordnung des 13 C-NMR-Spektrums von MHET

Über die jeweils aus den Tabellen entnehmbaren chemischen Verschiebungen der Signale der H- bzw. C-Atome und der Integralwerte (im Falle der H-Atome) ist eindeutig MHET bestimmt. Ebenso wurde ein Massenspektrum gemessen. Dies bestätigt ebenfalls MHET.

MS (ESI, negativ): berechnet für Ci 0 H 9 O 5 (M-H) " 209.045; gem. 209.045 (2) Herstellung von g-glucosyliertem MHET

MHET (0,05 mol/L) und Saccharose (0,4 mol/L) werden in 0,05 M Phosphatpuffer (0,05 mol/L, pH = 6) gelöst und eine Suspension von Mikroorganismen (Protaminobacter rubrum Z 12 (CBS 574.77)) hinzugefügt. In einem alternativen Ausführungsbeispiel wird eine a-Glucosidase-Lösung (100 U in Phosphatpuffer) hinzugefügt. Saccharose besteht aus a-D-Glucose und ß-D-Fructose, die über eine a,ß-1 ,2- glycosidische Bindung verknüpft sind. Der Mikroorganismus Protaminobacter rubrum Z 12 enthält ein Enzym, eine α-Glucosidase. Es katalysiert die Spaltung der eingesetzten Saccharose in a-D-Glucose und ß-D-Fructose. Die a-D-Glucose bindet während der Reaktion chemisch an das MHET.

Hierzu wird die Reaktionsmischung bei einer Temperatur von 37 °C im Wasserbad geschüttelt. Nach optimaler Produktbildung wird die Reaktion beendet. Das Produkt α-glycosyliertes MHET wird erhalten. Die optimale Produktbildung wird durch kontinuierliche Probenentnahme und Dünnschichtchromatographie ermittelt. α-glucosyliertes MHET ist in Fig. 13 beispielhaft dargestellt.

Die Versuchergebnisse der Ausführungsform mit einer Suspension von Mikroorganismen (Protaminobacter rubrum Z 12 (CBS 574.77)) sind wie folgt.

Das Produkt wird mit Massenspektrometrie (MT203) bestätigt.

MS (ESI, negativ): berechnet für Ci 6 H1 9 Oi 0 (M-HV 371 .0978; gem. 371 .09727

(3) Herstellung von ß-qlucosyliertem MHET

MHET (0,05 mol/L) und Cellobiose (0,4 mol/L) werden in Natnumacetatpuffer (0,05 mol/L, pH = 5,2) oder Phosphatpuffer (0,05 mol/L, pH = 7) gelöst und eine ß- Glucosidase -Lösung (100 U in Natnumacetatpuffer oder Phosphatpuffer) hinzugefügt. Die Cellobiose ist ein Disaccharid aus zwei ß-1 ,4-glucosidisch miteinander verknüpften Glucosemolekülen. Das Enzym ß-Glucosidase ermöglicht den Abbau der Cellobiose zu Glucose. Die Glucose bindet während der Reaktion chemisch an das MHET.

Die Reaktionsmischung wird ebenfalls bei einer Temperatur von 37 °C im Wasserbad geschüttelt. Nach optimaler Produktbildung wird die Reaktion beendet. Man erhält nach Säulenchromatographie ß-glucosyliertes MHET. ß-glucosyliertes MHET ist in Fig. 15 beispielhaft dargestellt. Die Versuchergebnisse der Ausführungsform mit Natriumacetatpuffer sind wie folgt.

Das Produkt wird mit Massenspektrometrie (MT204) bestätigt.

MS (ESI, negativ): berechnet für Ci 6 H1 9 Oi 0 (M-HV 371 .0978; gem. 371 .0972.

Weitere Versuchsergebnisse sind in Fig. 16, Fig. 17 und den folgenden Tabellen dargestellt.

Tabelle 3: Signalzuordnung 1 H-NMR-Spektrum von ß-glucosyliertem MHET

Tabelle 4: Signalzuordnung 13 C-NMR-Spektrum von ß-glucosyliertem MHET δ [ppm] Zuordnung 167.50 C-1 ", C-8"

134.17 C-2", C-5"

130.52 C-3", C-4",

130.50 C-6", C-7"

104.68 C-1

78.04 C-5

77.99 C-3

75.01 C-2

71 .55 C-4

68.62 c-r

65.75 C-2'

62.71 C-6

Di-1 .3-ß-qlucosyliertes MHET

MS (ESI, positiv): berechnet für C 2 2H 3 oNaOi 5 (M-HV 557.1482; gem. 557.1477. Di-1 ,3-ß-glucosyliertes MHET ist beispielhaft in Fig. 18 dargestellt. Weitere Versuchsergebnisse sind in den folgenden Tabellen dargestellt.

Tabelle 5: Signalzuordnung 1 H-NMR-Spektrum von Di-1 ,3-ß-glucosyliertem

MHET

Dublett vom

3.88 H-6a 1H 11,786,54

Dublett

Dublett vom

3.69 H-6b 1H 11,865,46

Dublett

Dublett vom

3.64 H-6"'b 1H 11,766,16

Dublett

3.57 H-3 1H Triplett 8,57

H-2, H-2'",

H-3'", H-4,

3.45-3.21 7H Multiplett

H-4'", H-5,

H-5'"

Tabelle 6: Signalzuordnung 13 C-NMR-Spektrum von Di-1 ,3-ß-glucosyliertem

MHET

62.56 C-6, C-6'

(4) Herstellung von ß-galactosyliertem MHET

MHET (0,05 mol/L) und Lactose (0,4 mol/L) werden in Nathumacetatpuffer (0,05 mol/L, pH = 5,2) oder Phosphatpuffer (0,05 mol/L, pH = 7) gelöst und eine ß- Galactosidase-Lösung (100 U in Natriumacetatpuffer oder Phosphatpuffer) hinzugefügt. Lactose besteht aus den D-Galactose und D-Glucose, die über eine ß-1 ,4-glycosidische Bindung verbunden sind. ß-Galactosidase katalysiert die Hydrolyse dieser Bindung enzymatisch, wobei Galactose entsteht, die während der Reaktion chemisch an das MHET bindet.

Die Reaktionsmischung wird hierzu bei einer Temperatur von 37 °C im Wasserbad geschüttelt. Nach optimaler Produktbildung wird die Reaktion beendet. Das Produkt ß-galactosyliertes MHET wird säulenchromatographisch isoliert. ß-galactosyliertes MHET ist in Fig. 19 beispielhaft dargestellt. Die Versuchergebnisse der Ausführungsform mit Natriumacetatpuffer sind wie folgt.

Das Produkt wird mit Massenspektrometrie (MT206) bestätigt.

MS (ESI, negativ): berechnet für Ci 6 H1 9 Oi 0 (M-H) " 371 .0978; gem. 371 .0975. Weitere Versuchsergebnisse sind in Fig. 20, Fig. 21 und in den folgenden Tabellen dargestellt.

Tabelle 7: Signalzuordnung 1 H-NMR-Spektrum von ß-galactosyliertem MHET

4.22 Η-1 'a 1 H Multiplett

3.96 Η-1 'b 1 H Multiplett

Dublett vom

3.84 H-4 1 H 3,32 0,92

Dublett

3.76 H-6a 1 H Multiplett

3.72 H-6b 1 H Multiplett

Dublett vom

3.56 H-2 1 H 9,72 7,52

Dublett

3.56 - 3.51 H-3 1 H Multiplett

Dublett vom

3.48 H-5 1 H 9,72 3,32

Dublett

Tabelle 8: Signalzuordnung 13 C-NMR-Spektrum von ß-galactosyliertem MHET

(5) Herstellunq von fructosyliertem MHET

MHET(0,05 mol/L) und Saccharose (0,4 mol/L) wurden in Natriumacetatpuffer (0,05 mol/L, pH = 5,2) gelöst und eine Fructosidase-Lösung (100 U in Natriumacetatpuffer) hinzugefügt. Die Fructosidase-Lösung katalysiert die Spaltung der Saccharose in a-D-Glucose und ß-D-Fructose enzymatisch. Die ß-D- Fructose bindet während der Reaktion chemisch an das MHET.

Die Reaktionsmischung wird hierzu ebenfalls bei einer Temperatur von 37 °C im Wasserbad geschüttelt. Nach optimaler Produktbildung wird die Reaktion beendet.

(6) Herstellung von g-glucosyliertem Bis(2-hvdroxyethyl)terephtalat

Bis(2-hydroxyethyl)terephtalat (0,05 mol/L) und Saccharose (0,4 mol/L) werden in 0,05 M Phosphatpuffer (0,05 mol/L, pH = 7) gelöst oder werden in 0,05 M Phosphatpuffer (0,05 mol/L, pH = 6) gelöst und eine Suspension von Mikroorganismen (Protaminobacter rubrum Z 12 (CBD 574.77)) hinzugefügt. In einem alternativen Ausführungsbeispiel wird eine α-Glucosidase -Lösung (100 U in Phosphatpuffer) hinzugefügt.

Saccharose besteht aus a-D-Glucose und ß-D-Fructose, die über eine a,ß-1 ,2- glycosidische Bindung verknüpft sind. Der Mikroorganismus Protaminobacter rubrum Z 12 enthält ein Enzym, eine α-Glucosidase. Es katalysiert die Spaltung der eingesetzten Saccharose in a-D-Glucose und ß-D-Fructose. Die a-D-Glucose bindet während der Reaktion chemisch an das Bis(2-hydroxyethyl)terephtalat.

Hierzu wird die Reaktionsmischung bei einer Temperatur von 37 °C im Wasserbad geschüttelt. Nach optimaler Produktbildung wird die Reaktion beendet. Das Produkt α-glycosyliertes Bis(2-hydroxyethyl)terephtalat wird erhalten. Die optimale Produktbildung wird durch kontinuierliche Probenentnahme und Dünnschichtchromatographie ermittelt.

α-glucosyliertes Bis(2-hydroxyethyl)terephtalat ist beispielhaft in Fig. 22 dargestellt. Versuchsergebnisse der Ausführungsform mit 0,05 M Phosphatpuffer (0,05 mol/L, pH = 6) und einer Suspension von Mikroorganismen (Protaminobacter rubrum Z 12 (CBD 574.77)) sind in Fig. 23, Fig. 24 und in den folgenden Tabellen dargestellt.

Tabelle 9: Signalzuordnung 1 H-NMR-Spektrum von α-glucosyliertem Bis(2- hydroxyethyl)terephtalat Relatives Kopplungskonstante δ [ppm] Zuordnung Multiplizität

Integral J[Hz]

H-3", H-4",

8.16 4H Singulett

H-6", H-7"

4.89 H-1 1H Dublett 3,96

4.57-4.53 H-2'" 2H Multiplett

4.41 H-1'" 2H Multiplett

4.09 Η-1'a 1H Multiplett

3.87 H-2' 2H Multiplett

3.88-3.84 Η-1'b 1H Multiplett

3.79 - 3.74 H-6a 1H Multiplett

H-3, H-4,

3.69 - 3.62 3H Multiplett

H-6b

Dublett vom

3.41 H-2 1H 9,723,76

Dublett

3.30 H-5 1H Multiplett

Tabelle 10: Signalzuordnung 13 C-NMR-Spektrum von α-glucosyliertem Bis(2- hydroxyethyl)terephtalat

67.96 C-1 '"

67.00 c-r

65.70 C-2'"

62.59 C-6

61 .05 C-2'

Di- a-1 ,6-qlucosyliertenn Bis(2-hvdroxyethyl)terephtalat

Di-a-1 ,6-glucosyliertes Bis(2-hydroxyethyl)terephtalat ist beispielhaft in Fig. 25 dargestellt. Weitere Versuchsergebnisse sind in Fig. 26, Fig. 27 und in den folgenden Tabellen dargestellt.

Tabelle n : Signalzuordnung 1 H-NMR-Spektrum von Di-a-1 ,6-glucosyliertem

Bis(2-hydroxyethyl)terephtalat

Doubelt

3.73 H-5"" 1 H Triplett 9,26

Dublett vom

3.21 H-2"" 1 H 9,06 7,78

Dublett

3.31 H-5 1 H MeOH

Tabelle 12: Signalzuordnung 13 C-NMR-Spektrum von Di-a-1 ,6-glucosyliertem

Bis(2-hydroxyethyl)terephtalat

(7) Herstellung von ß-qlucosyliertem Bis(2-hvdroxyethyl)terephtalat

Bis(2-hydroxyethyl)terephtalat (0,05 mol/L) und Cellobiose (0,4 mol/L) werden in Natnumacetatpuffer (0,05 mol/L, pH = 5.2) gelöst und eine ß-Glucosidase -Lösung (100 U in Natnumacetatpuffer) hinzugefügt. Die Cellobiose ist ein Disaccharid aus zwei ß-1 ,4-glucosidisch miteinander verknüpften Glucosemolekülen. Das Enzym ß-Glucosidase ermöglicht den Abbau der Cellobiose zu Glucose. Die Glucose bindet während der Reaktion chemisch an das Bis(2-hydroxyethyl)terephtalat.

Die Reaktionsmischung wird ebenfalls bei einer Temperatur von 37 °C im Wasserbad geschüttelt. Nach optimaler Produktbildung wird die Reaktion beendet. Man erhält nach Säulenchromatographie ß-glucosyliertes Bis(2- hydroxyethyl)terephtalat (siehe Fig. 28). Weitere Versuchsergebnisse sind in Fig. 29, Fig. 30 und in den folgenden Tabellen dargestellt. Tabelle 13: Signalzuordnung 1 H-NMR-Spektrum von ß-glucosyliertem Bis(2- hydroxyethyl)terephtalat

3.30 - 3.28 H-4 1 H Multiplett

Dublett vom

3.21 H-2 1 H 9,06 7,78

Dublett

Tabelle 14: Signalzuordnung 13 C-NMR-Spektrum von ß-glucosyliertem Bis(2- hydroxyethyl)terephtalat

(8) Herstellung von ß-qalactosyliertem Bis(2-hvdroxyethyl)terephtalat

Bis(2-hydroxyethyl)terephtalat (0,05 mol/L) und Lactose (0,4 mol/L) werden in Natnumacetatpuffer (0,05 mol/L, pH5,2) oder Phosphatpuffer (0,05 mol/L, pH = 7) gelöst und eine ß-Galactosidase-Lösung (100 U in Natnumacetatpuffer oder Phosphatpuffer) hinzugefügt. Lactose besteht aus den D-Galactose und D- Glucose, die über eine ß-1 ,4-glycosidische Bindung verbunden sind, ß- Galactosidasen katalysiert die Hydrolyse dieser Bindung enzymatisch, wobei Galactose entsteht, die während der Reaktion chemisch an das Bis(2- hydroxyethyl)terephtalat bindet.

Die Reaktionsmischung wird hierzu bei einer Temperatur von 37 °C im Wasserbad geschüttelt. Nach optimaler Produktbildung wird die Reaktion beendet. Das Produkt ß-galactosyliertes Bis(2-hydroxyethyl)terephtalat wird säulenchromatographisch isoliert. ß-galactosyliertes Bis(2-hydroxyethyl)terephtalat ist beispielshaft in Fig. 31 dargestellt. Versuchsergebnisse der Ausführungsform mit Natriumacetatpuffer sind in Fig.32, Fig. 33 und in den folgenden Tabellen dargestellt.

Tabelle 15: Signalzuordnung 1 H-NMR-Spektrum von ß-galactosyliertem Bis(2- hydroxyethyl)terephtalat

Dublett

3.55 - 3.52 H-5 1 H Multiplett

Dublett vom

3.48 H-3 1 H 9,70 3,34

Dublett

Tabelle 16: Signalzuordnung 13 C-NMR-Spektrum von ß-galactosyliertem Bis(2- hydroxyethyl)terephtalat

Di- ß-qalakosyliertem Bis(2-hvdroxyethyl)terephtalat

MS (ESI, positiv): berechnet für C 2 H 34 NaOi 6 (M-HV 601 .1745; gem. 601 .1739

Di- ß-qlucosyliertem Bis(2-hvdroxyethyl)terephtalat Di- ß-glucosyliertes Bis(2-hydroxyethyl)terephtalat ist beispielshaft in Fig. 34 dargestellt.

Das Produkt wird mit Massenspektrometrie bestätigt.

MS (ESI, positiv): berechnet für C 2 H 3 Oi 6 Na (M-H) + 601 .1745, gem. 601 .1739 Weitere Versuchsergebnisse sind in Fig.35, Fig. 36 und in den folgenden Tabellen dargestellt.

Tabelle 17: Signalzuordnung 1 H-NMR-Spektrum von Di- ß-glucosyliertem Bis(2- hydroxyethyl)terephtalat

Tabelle 18: Signalzuordnung 13 C-NMR-Spektrum von Di- ß-glucosyliertem Bis(2- hydroxyethyl)terephtalat δ [ppm] Zuordnung 165.31 C-1 ", C-8"

133.80 C-2", C-5"

C-3", C-4",

129.77

C-6", C-7"

103.30 C-1

77.01 C-5

76.59 C-3

73.33 C-2

70.00 C-4

66.69 c-r

64.97 C-2'

61 .07 C-6

(9) Herstellung von fructosyliertem BHET

BHET(0,05 mol/L) und Saccharose (0,4 mol/L) wurden in Natriumacetatpuffer (0,05 mol/L, pH = 5,2) gelöst und eine Fructosidase-Lösung (100 U in Natriumacetatpuffer) hinzugefügt. Die Fructosidase-Lösung katalysiert die Spaltung der Saccharose in α-D-Glucose und ß-D-Fructose enzymatisch. Die ß-D- Fructose bindet während der Reaktion chemisch an das BHET.

Die Reaktionsmischung wird hierzu ebenfalls bei einer Temperatur von 37 °C im Wasserbad geschüttelt. Nach optimaler Produktbildung wird die Reaktion beendet.

MS (ESI, positiv): berechnet für Ci 6 Hi 9 NaOi 0 (M-HV 439.1216; gem. 439.121 1

(10) Herstellung von Polyester aus g-glucosyliertem MHET

a-glucosyliertes MHET (20 mg) wird auf 250°C 50 sec erhitzt. Dabei gibt es eine Gasentstehung. Es verbleibt ein braun-weißer Feststoff, der in Wasser teilweise suspendiert und gelöst vorliegt. Die Dünnschichtchromatographie Untersuchung (MeOH/CH 2 Cl2) weist aus, dass ein hochpolymerer Stoff aus dem Susbtrat enstanden ist und ebenfalls UV-aktiv ist.

(1 1 ) Herstellung von glvcosvlierten MA-BHET-a-GIc In 2 ml tert-Butanol werden 40 mg α-glucosyliertes BHET und 72 μΙ Vinylnnethylacrylat gelöst. Dann werden 25 mg Novozymes 435 (auf Acryl-Harz immobilisiert) dazugegeben. Bei 50°C wird die Suspension für 18 h geschüttelt. Die Suspension wird anschließend zentrifugiert, der Überstand dekantiert und am Rotationsverdampfer eingeengt. Der Rückstand wird an Kieselgel 60 (Macherey Nagel, 0,044-0,063 mm) chromatographiert. (Laufmittelsystem: 1 1 Volumen Ethylacetat zu 1 Volumen Methanol). Es wurde ein weißer Feststoff erhalten.

Glycosyliertes ΜΑ-ΒΗΕΤ-α-Glc ist beispielhaft in Fig. 37 dargestellt. Weitere Versuchsergebnisse sind in Fig.38, Fig. 39 und in den folgenden Tabellen dargestellt.

NMR in deuteriertem (CD 3 ) 2 SO gemessen.

Tabelle 19: Signalzuordnung 1 H-NMR-Spektrum von glycosyliertem MA-BHET-a- Glc

Dublett von

3.94 Η-1'a 1H 11,545,01

Triplett

Dublett von

3.75 Η-1'b 1H 11,624,59

Triplett

3.60-3.56 H-6a 1H Multiplett

H-6b, H-4, H-

3.47-3.38 3H Multiplett

3

3.23-3.18 H-2 1H Multiplett

3.09 - 3.04 H-5 1H Multiplett

Dublett von

3.41 H-4"" 1H 9,723,76

Dublett

Tabelle 20: Signalzuordnung 13 C-NMR-Spektrum von glycosyliertenn MA-BHET- a-GIc

54.86 C-2'"

54.17 C-1 '"

53.12 C-6

8.90 C-4""

(12) Herstellung von qlvcosylierten MA?-BHET-g-Glc

In 2 ml tert-Butanol werden 40 mg α-glucosyliertes BHET und 72 μΙ Vinylmethylacrylat gelöst. Dann werden 25 mg Novozymes 435, auf Acryl-Harz immobilisiert, dazugegeben. Bei 50°C wird die Suspension für 30 h geschüttelt. Die Suspension wird anschließend zentrifugiert, der Überstand dekantiert und am Rotationsverdampfer eingeengt. Der Rückstand wird an Kieselgel chromatographiert. (Laufmittelsystem: 1 1 Volumen Ethylacetat zu 1 Volumen Methanol). Es wurde ein weißer Feststoff erhalten.

Glycosyliertes MA 2 -BHET-a-Glc ist beispielshaft in Fig. 40 dargestellt. Weitere Versuchsergebnisse sind in Fig.41 , Fig. 42 und in den folgenden Tabellen dargestellt.

NMR in CD 3 OD gemessen.

Tabelle 21 : Signalzuordnung 1 H-NMR-Spektrum von glycosyliertem MA 2 -BHET- a-GIc

4.62-4.60 Η-1'" 2H Multiplett

4.57-4.55 H-2' 2H Multiplett

4.52-4.50 Η-2'" 2H Multiplett

Dublett von

4.43 H-6a 1H 11,802,12

Dublett

Dublett von

4.18 H-6b 1H 11,846,40

Dublett

4.08-4.03 Η-1'a 1H Multiplett

3.94-3.83 H-5, Η-1'b 2H Multiplett

Dublett von

3.66 H-3 1H 9,548,98

Dublett

Unter MeOH

-3.31 H-2 1H

Peak

Dublett von

3.41 H-4 1H 9,723,76

Dublett

H-4"" + Dublett von

1.90 + 1.89 2H 1,581,02 + 1,501,02

H-4 Dublett

Tabelle 22: Signalzuordnung 13 C-NMR-Spektrum von glycosyliertenn MA 2 -BHET- a-GIc

130.67 C-6", C-7"

126.61

C-3"", C-3

126.38

100.43 C-1

74.91 C-3

73.39 C-4

71 .96 C-2

71 .45 C-5

67.19 c-r

65.66 C-2'

65.19 C-6

64.34 C-1 '"

63.65 C-2'"

18.42 18.39 C-4"", C-4

(13) Herstellung von qlvcosylierten a-GIc-MHET-Decanol

In 2 ml tert-Butanol werden 40 mg α-glucosyliertes BHET und 120 μΜ -Decanol zugegeben. Dann werden 25 mg Novozymes 435, auf Acryl-Harz immobilisiert, dazugegeben. Bei 50°C wird die Suspension für 24 h geschüttelt. Die Suspension wird anschließend, zentrifugiert der Überstand dekantiert und am Rotationsverdampfer eingeengt. Der Rückstand wird an Kieselgel chromatographiert. (Laufmittelsystem: 1 1 Volumen Ethylacetat zu 1 Volumen Methanol). Es wurde ein weißer Feststoff erhalten.

Glycosyliertes α-Glc-MHET-Decanol ist beispielshaft in Fig. 43 dargestellt. Weitere Versuchsergebnisse sind in Fig.44, Fig. 45 und in den folgenden Tabellen dargestellt.

NMR in CDCI 3 gemessen.

Tabelle 23: Signalzuordnung 1 H-NMR-Spektrum von glycosyliertem a-GIc- MHET-Decanol Relatives Kopplungskonstante δ [ppm] Zuordnung Multiplizität

Integral J[Hz]

H-3", H-4",

8.10 4H Singulett

H-6", H-7"

4.96 H-1 1H Dublett 3,88

Dublett von

4.61 H-2"a 1H Dublett von 12,186,283,10

Dublett

Dublett von

4.52 H-2"b 1H Dublett von 12,176,313,05

Dublett

4.34 H-1'" 2H Triplett 6,72

Dublett von

4.09 H-1"a 1H Dublett von 11,706,243,04

Dublett

Dublett von

3.87 H-1"b 1H Dublett von 11,696,293,09

Dublett

Dublett von

3.82 H-6 2H 5,884,00

Dublett

3.73 H-3 1H Triplett 9,18

Dublett von

3.71 H-2 1H 9,574,04

Dublett

3.58 H-4 1H Triplett 9,30

3.52

H-5 1H Multiplett

3.49

Dublett vom

1.78 H-2'" 2H 14,466,98

Triplett

1.46

H-3'" 2H Multiplett

1.41

1.38

H-(4,5,6,7,8,9)"' 12H Multiplett

1.22 0.88 H-10'" 3H Singulett

Tabelle 24: Signalzuordnung 13 C-NMR-Spektrum von glycosyliertem

MHET-Decanol

(14) Alternative Herstellung von g-glucosyliertem MHET In 2 ml 50 mM HEPES-Puffer pH 7,5 werden 40 mg α-glucosyliertes BHET. Dann werden 25 mg Novozymes 435, auf Acryl-Harz immobilisiert, dazugegeben. Bei 50°C wird die Suspension für 24 h geschüttelt. Der pH-Wert von 7,5 des Ansatzes wird durch Zugabe von 1 N NaOH Lösung konstant gehalten. Die Suspension wird anschließend zentrifugiert, der Überstand dekantiert und am Rotationsverdampfer eingeengt. Der Rückstand wird an Kieselgel chromatographiert. (Laufmittelsystem: 6 Volumen Ethylacetat zu 3 Volumen Isopropanol und 1 Volumen Wasser). Es wurde ein weißer Feststoff erhalten.

α-Glucosyliertes MHET ist beispielhaft in Fig. 46 dargestellt. Weitere Versuchsergebnisse sind in Fig.47, Fig. 48 und in den folgenden Tabellen dargestellt.

NMR in CD 3 OD gemessen.

Tabelle 25: Signalzuordnung 1 H-NMR-Spektrum von α-glucosyliertem MHET

Dublett

Unter MeOH

-3.31 H-5 1 H

Peak

Tabelle 26: Signalzuordnung 13 C-NMR-Spektrum von α-glucosyliertem MHET

(15) Polymerisation von MA-BHET-a-GIc

Zu 2 ml DMSO werden 1 ml Wasser gegeben und 50 mg ΜΑ-ΒΗΕΤ-α-Glc und 1 mg K 2 OsS2. Diese Lösung wird 2 Stunden mit Stickstoff gespühlt. Dann wird die Reaktion verschlossen und 12 Stunden bei 50°C geschüttelt. Mittels Gefriertrocknung wurden die Lösemittel entfernt, dann wurde ein Teil des Rückstandes über Nacht in deuteriertem Methanol bei 50°C gelöst und ein 1 H- NMR 400 MHz gemessen. Versuchsergebnisse sind in Fig.49 dargestellt. GEWERBLICHE ANWENDBARKEIT

Die vorliegende Erfindung ist in vielfältiger Weise gewerblich anwendbar. Beispielsweise wird die Weiterverwendung von Abbau Produkten aus der Hydrolyse von PET in Form von Biohybridpolymeren ermöglicht. Gemäß der Erfindung haben Biohybridpolymere beispielsweise eine erhöhte Bioverträglichkeit, Kompostierbarkeit und/oder ermöglichen eine verbesserte Adhäsion von kultivierten Zellen auf Oberflächen.




 
Previous Patent: WIND TURBINE ROTOR BLADE

Next Patent: A TRANSMISSION