Login| Sign Up| Help| Contact|

Patent Searching and Data


Title:
HIGH-THROUGHPUT ASSAY FOR EVALUATING DIPEPTIDYL PEPTIDASE I ACTIVITY
Document Type and Number:
WIPO Patent Application WO/2010/048306
Kind Code:
A1
Abstract:
A method of screening a compound which modulates dipeptidyl peptidase I (DPPI) activities comprises the steps of adding a peptide substrate of DPPI to a reaction mixture which comprises DPPI and a compound, wherein the peptide substrate of DPPI has at least 3 amino acids and binds to a binding site of DPPI in addition to the S1-S2 site; and measuring the molecular weight of the substrate, wherein a change in the molecular weight of the substrate is indicative of the presence of DPPI activity.

Inventors:
OLSON, Matthew (400 Kirsten Avenue, Spring City, Pennsylvania, 19475, US)
TODD, Matthew (413 Vineyard Lane, Downingtown, Pennsylvania, 19335, US)
Application Number:
US2009/061509
Publication Date:
April 29, 2010
Filing Date:
October 21, 2009
Export Citation:
Click for automatic bibliography generation   Help
Assignee:
JOHNSON & JOHNSON PHARMACEUTICAL RESEARCH & DEVELOPMENT, L.L.C. (920 U.S. Route 202, Raritan, New Jersey, 08869, US)
OLSON, Matthew (400 Kirsten Avenue, Spring City, Pennsylvania, 19475, US)
TODD, Matthew (413 Vineyard Lane, Downingtown, Pennsylvania, 19335, US)
International Classes:
C12Q1/37; C07K7/06; C07K7/08; C07K14/81
Attorney, Agent or Firm:
HERBERT, Toni-Junell et al. (Patton Boggs LLP, 8484 Westpark Drive Suite 90, McLean Virginia, 22102, US)
Download PDF:
Claims:

CLAIMS

We claim

1. A method of screening a compound which modulates dipeptidyl peptidase I(DPPI) activities, comprising the steps of: a. adding a substrate of DPPI to a reaction mixture which comprises DPPI and said compound, wherein said substrate of DPPI comprises at least 3 amino acids and binds to a binding site of DPPI in addition to the S 1 -S 2 site; and b. measuring the molecular weight and/or the change in mass ratio of said substrate and product, wherein a decrease in the molecular weight of said substrate is indicative of the presence of said DPPI activity.

2. The method of claim 1, wherein said substrate is label-free.

3. The method of claim 1, wherein said substrate has from 3 to 100 amino acids.

4. The method of claim 1, wherein said substrate has from about 10 to about 50 amino acids.

5. The method of claim 1, wherein said substrate is selected from the group consisting of SEQ ID NOs: 1-7.

6. The method of claim 1, wherein said substrate is SEQ ID NO: 1.

7. The method of claim 1, wherein said compound is 2-(piperidin-l-ylcarbonyl)phenol.

8. The method of claim 1, wherein said compound is 2-(piperidin-l-ylcarbonyl)aniline.

9. A DPPI substrate selected from the group consisting of SEQ ID NOs: 1-7.

10. The DPPI substrate of SEQ ID NO: 1

Description:

HIGH-THROUGHPUT ASSAY FOR EVALUATING DIPEPTIDYL PEPTIDASE I ACTIVITY

CROSS-REFERENCE TO RELATED APPLICATIONS

This application claims benefit to United States Provisional Patent Application No. 61/107,046 filed October 21, 2008, the contents of which are incorporated by reference herein in their entirety.

BACKGROUND OF THE INVENTION

1. Field of the Invention

A method is provided for identifying agonists and antagonists of dipeptidyl peptidase I in a high-throughput format. The method uses a peptide substrate that is label-free and binds to multiple substrate binding sites of dipeptidyl peptidase I.

2. Description of the Related Art

Dipeptidyl peptidase I (DPPI) or cathepsin C is a member of the lysosomal papain- type cysteine protease family that also includes cathepsin B, K, H, L, O, and S (Bouma and Gruber, 1996, Biochem. Biophys. Acta 113: 350-358; Turk et al, 2000, Biochem. Biophys. Acta 1477: 98-111). This protease family activates serine proteinases in immune and inflammatory cells.

The physiological role of DPPI is to convert inactive proenzymes into active enzymes by removing two amino acids as a dipeptide unit from the N-terminal end of the proenzymes in immune and inflammatory cells (reviewed by Caughey, G.H., 2002, Molecular Immunology 38: 1353-1357; Wolters et al., 2001, J. Biol. Chem. 276: 18551-18556; McGuire et al., 1993, J. Biol. Chem. 268: 2458-2467; Pham and Ley, 1999, Proc. Natl. Acad. Sci. 96: 8627-8632; Pham et al., 2004, J. Immunol. 173: 7277-7281). DPPI activates many serine proteinases including chymase, tryptase, cathepsin G, elastase, and neutrophil-elastase, granzymes A and B from T-lymphocytes and natural killer cells; and rheumatoid arthritis proteases (Adkison et al., 2002, J. Clin. Invest. 109: 363-371). The enzymes or serine proteases activated by DPPI are needed for defense responses. In addition, the unregulated DPPI has been shown to cause over-activation of proteases associated with diseases including

chronic obstructive pulmonary disease, Papillon-Lefevre Syndrome, Sepsis, arthritis and other inflammatory disorders. Therefore, DPPI is a potential target for therapeutic treatment.

It is proposed that DPPI consists of four identical monomers. Each monomer is produced from a precursor polypeptide, which is cleaved into a N-terminal exclusion domain, an activation peptide, and a papain-like domain. The papain-like domain is further cleaved into a heavy chain and a light chain. Subsequently, the N-terminal exclusion domain, the heavy and the light chains fold into a monomer, which tetramizes into the mature DPPI of about 20OkDa (Turk et al, 2001 EMBO J., 20: 6570-6582).

Recent crystallization of DPPI identified some structures, including an active site cleft and substrate binding sites, involved in the dipeptidyl proteolytic activity. The substrate binding sites reside on the external part of the papain-like structure and form hydrogen bonds with the substrates. The site that binds to the first amino acid at the N-terminal side of the cleaved bond of the substrate is referred to as the Si binding site, the site that binds to the second amino acid at the N-terminal side is referred to as the S 2 binding site. Further, the site that binds to the first amino acid at the C-terminal side of the cleaved bond of the substrate is referred to as the Si' binding site, and the site that binds to the second amino acid at the C- terminal side is referred to as the S 2 ' binding site, etc (Turk et al., 2001, EMBO J., 20:6570- 6582; Molgaard et al., 2007, Biochem. J., 401 :645-650). The corresponding site in a DPPI substrate is referred to as Pi, P 2 , Pi', P 2 ' etc, where Pi of the substrate binds to the Si site of DPPI, P 2 of the substrate binds to S 2 of DPPI, and P 1 ' of the substrate binds to the S 1 ' site of DPPI, etc. Based on the crystallographic results of a binding complex of DPPI and a substrate of 6 amino acids, Molgaard et al. proposes a model where DPPI contains the S 2 -Si and Si'-S 4 'substrate binding sites. Since DPPI binds to larger substrates such as human prochymase of 228 amino acids in vivo; the substrate binding sites of DPPI may contain more than S 2 -S 1 -S 1 ^S 4 ', even to S 2 -S 1 -S 1 ^S 18 '.

As DPPI is a potential therapeutic target, several assays for analyzing DPPI activity have been commonly used (Gelman et al., J. Clin. Invest. 1980, 65: 1398-1406; (Tran et al., Arch. Biochem. Biophys. 2002, 403: 160-170). Gelman et al. uses a labeled dipeptide of Gly-Phe-β-naphthylamide as substrate and determined DPPI activity by measuring the concentration of free β-naphthylamide with a spectrophotofluorometer. Similarly, Tran et al. uses several dipeptides labeled with 7-amino-4-methylcoumarin as DPPI substrates and determined DPPI activity by measuring the concentration of free methylcoumarin with a

spectrophotofluorometer. Tran et al. shows that the dipeptide substrate of Ala-Hph-7-amino- 4-methylcoumarin is the best substrate for DPPI, even though the substrate contains a non- physiological residue Hph (homophenylalanine).

These commonly used dipeptide substrates with fluorescence labels have several problems. First, the dipeptide substrate only binds to the Si and S 2 sites. This is partial or incomplete in comparison to biological substrates in vivo which binds to a binding site in addition to the Si and S 2 sites. The incomplete or partial binding may be non-specific and hence lead to the identification of false positive or negative compounds. Also, the additional step of fluorescence detection is needed to detect the DPPI activity. This additional step makes the assay difficult to be adapted for use in a high-throughput format.

Therefore, there is still a need to develop an assay that uses a substrate which is label- free and biologically related for analyzing DPPI activity. Also, there is a need to develop a DPPI assay suitable for use in a high-throughput format to enable efficient screening of a large number of compounds or agents for drug development.

The label-free technology has been combined with a mass spectrometry system to analyze enzymatic reactions. Quercia et al. (J. Biomol. Screen. 12: 473-480, 2007) identifies the kinase AKTl/PKBα inhibitors using mass spectrometry in multiple reaction monitoring. Similarly, Forbes et al. (J. Biomol. Screen. 11 : 628-634, 2007) evaluates phosphortidylserine decarboxylase in 96-well plates using mass spectrometry in multiple reaction monitoring. A mass spectrometry detection system in a high-throughput format has not been applied for analyzing DPPI activity.

The present application provides a method for assaying DPPI activity. The method utilizes a label-free peptide substrate that comprises biologically related amino acid sequences and binding specificity. The assay may be detected using a mass spectrometry system and may be operated in a high-throughput format, which reduces processing time and increases throughput which are desired for screening compounds. The method is also useful for differential tracking of fragment-based compounds for drug development and evaluating other dipeptidyl proteolytic reactions for functional studies.

SUMMARY

An object of the present application is to provide a method for screening compounds which modulate DPPI activities. The method comprises the steps of adding a substrate of DPPI to a reaction mixture which comprises DPPI and the compounds, wherein the substrate has 3 to 100 amino acids and binds to a binding site of DPPI in addition to the S 1 -S 2 site, and measuring a change in the molecular weight of the substrate and/or a change in the mass ratio of the substrate and products, wherein the change in molecular weight of the substrate or mass ratio is indicative of the presence of DPPI activity.

According to one embodiment of the present invention, the compound may be 2- (piperidin- 1 -ylcarbonyl)phenol or 2-(piperidin- 1 -ylcarbonyl)aniline.

Another object is to provide label-free DPPI substrates useful for screening compounds which modulate DPPI activity. Exemplary DPPI substrates may be selected from the group consisting of SEQ ID NOs: 1-7. The DPPI substrate may preferably comprise a peptide having 20 amino acids. The DPPI substrate is preferably label-free.

Other objects and features of the present invention will become apparent from the following detailed description considered in conjunction with the accompanying drawings. It is to be understood, however, that the drawings are designed solely for purposes of illustration and not as a definition of the limits of the invention, for which reference should be made to the appended claims. It should be further understood that the drawings are not necessarily drawn to scale and that, unless otherwise indicated, they are merely intended to conceptually illustrate the structures and procedures described herein.

BRIEF DESCRIPTION OF THE DRAWINGS

In the drawings:

Figure 1. Initial velocity analysis for DPPl kinetic constant in reaction with a 20-mer substrate (A) and a dipeptide substrate (B). (A) About 2 nM of DPPI was used in the reaction with the 20-mer substrate of GEIIGGTECKPHSRPYMAYL and the reaction was monitored using a mass spectrometry system. (B) About 0.4 nM of DPPl was used in the reaction with the dipeptide substrate of GR-α-methylcoumarin and the reaction was monitored using a rate- based format monitoring fluorescence at E M = 460 nm and E x = 380 nm. Initial rates are taken from kinetic data where less than 7% substrate turnover was achieved.

Figure 2. Evaluating the DPPI-modulating activity with two test compounds using a dipeptide substrate (A) and using a 20-mer peptide substrate (B). (A) About 0.4 nM of DPPl and about 10 μM of dipeptide substrate GR-α-methylcoumarin were used in a rate-based format and monitored with fluorescence at E M = 460 nm and E x = 380 nm. (B) About 2nM of DPPI and 20 μM of the 20-mer peptide substrate GEIIGGTECKPHSRPYMAYL were used in a reaction and monitored with a mass spectrometry system. 2-(piperidin-l- ylcarbonyl)phenol is represented by solid squares and 2-(piperidin-l-ylcarbonyl)aniline is represented by solid circles. Revalues is > 0.95.

DETAILED DESCRIPTION OF THE PRESENTLY PREFERRED EMBODIMENTS

To detect the activity of dipeptidyl peptidase I (DPPI) in the presence of an agonist or an antagonist of DPPI, a peptide which is used as a substrate of DPPI, is added into a reaction mixture such that the reaction mixture contains a reaction buffer, an agonist or an antagonist of DPPI, DPPI and a substrate. A buffer system of PIPES, HEPES, sodium phosphate or any buffering system where the pKa is about 7.0 can be used for the DPPI assay. A HEPES buffer system is preferred. For example, a 1OX reaction buffer is 500 mM HEPES at pH 7.0, 1 M NaCl, and 0.05% Tween-20. Other buffer systems commonly known to a person skilled in the art may also be used. Prior to the reaction, DTT or glutathione is added to the IX reaction buffer to a final concentration of 2 mM.

DPPI may be obtained from a commercial source, produced by recombinant DNA technology, or isolated or purified from cells by methods commonly known to a person skilled in the art.

Any peptides of at least 3 amino acids, preferably 5 to 100 amino acids and most preferably 10 to 50 amino acids that binds to more than the S 1 -S 2 substrate binding site of DPPI may be used as a substrate for detecting the proteolytic activity of DPPI. The number of the substrate binding sites of the peptide substrate may be 3 to 100, preferably 5 to 50 and most preferably 6 to 20. Therefore, the peptide substrate binds to DPPI at the S 1 -S 2 substrate binding site and at least one additional substrate binding site of Si'-Sgs', preferably S^-S 48 ' and most preferably Si '-S 4 '.

The peptide substrate of the present application is not labeled or modified with any flurogenic or chromogenic agents. The peptide substrate may be synthesized chemically, expressed using recombinant DNA technology, or isolated or purified from cells by methods commonly known to a person skilled in the art.

As used herein, the term polypeptide refers to three or more amino acids joined to each other by peptide bonds or modified peptide bonds, i.e. peptide isosteres. Polypeptide refers to both short chains, commonly referred to as peptides, oligopeptides or oligomers, and to longer chains, generally referred to as proteins. Polypeptides may contain amino acids other than the 20 naturally occurring amino acids. Polypeptides include amino acid sequences modified either by natural processes, such as post-trans lational processing, or by chemical modification techniques that are well known in the art. Such modifications are well described in research literature. Modifications may occur anywhere in a polypeptide, including the peptide backbone, the amino acid side-chains and the amino or carboxyl termini.

A reaction volume of 5-50 μls, preferably 10 or 20 μls, is aliquoted into a tube or a plate commonly used in the laboratory and assayed for DDPI activity by measuring the substrate turnover. As used herein, the substrate turnover refers to the reduction in the quantity of substrate and the subsequent increase in the quantity of product. The substrate turnover may be measured by monitoring the molecular mass of the substrate and the product. A mass spectrometry system is preferred. By way of example, the concentrations of substrates and products can be determined by single ion monitoring (SIM) technology using the Agilent MSD with Agilent Chemstation software or the like known to a person of ordinary skill in the art. Data was analyzed using Agilent Chemstation and BioTrove Rapidfire Integrator. The assay was designed to tolerate less than 10% substrate turnover for compound testing.

An equilibrium of a general enzymatic reaction is illustrated below:

wherein E is an enzyme, S is a substrate for the enzyme and P is the product of the reaction.

The equilibrium is modified to illustrate the dipeptidyl proteolysis reaction in the DPPI assay with a peptide substrate of the present application:

NH 2 - G-E-I-I-G-G-T-E-C- COOH ^ NH 2 -I-I-G-G-T-E-C..." COOH + NH 2 - G-E-COOH p p p ' p ' p ' p ' p ' p ' p ' p ' p ' p ' rl r 2 r 3 r 4 r 5 "

When initiated, DPPI cleaves and removes two amino acids G-E or Gly-Glu from the N-terminus of the peptide substrate having 20 amino acids, G-E-I-I-G-G-T-E-C-K-P-H-S-R- P-Y-M-A-Y-L. This results in a change of molecular weight or mass of the peptide substrate from 2,224 Da to 2,037 with a difference of 187 Da. The molecular weight or mass of the peptide substrate in the reaction may be detected by a mass spectrometry using single ion monitoring. The change or difference of the peptide substrate detected by SIM is from 1,112 amu (atomic mass unit) to 1,018.5 amu. This may be used to determine the value for the substrate turnover.

Once the rate of the substrate turnover under the initial velocity condition, the kinetic constants for DPPI and the peptide substrate are calculated using the following formula (I):

Y = V MA x((X+Et+K M )-((((Et+X+K M ) 2 )-(4XEt)) 0 5 ))/(2Et) wherein

Y is concentration of substrate turnover X is substrate concentration Et is DPPI concentration K M is substrate concentration at Vi V MAX V M a x is substrate turnover at substrate saturation

For screening test compounds which modulate DPPI activity, the inhibition of DPPI activity may be calculated using the following formula: Quantity of substrate turnover in a positive control:

(SIM pc -SIM NC )

[S] x (SIM spc - SIM SNC ) + (SIM pc -SIM NC ))

Quantity of substrate turnover in a sample containing a test compound:

Percent inhibition = -

OR

(1 - (( μM substrate turnover of sample) x ( μM substrate turnover of pos. control) -1 ) xlOO wherein

[S] is concentration of the substrate (μM)

SIMs is SIM of the substrate in sample (area under curve from amu)

SIMspc is SIM of the substrate in positive control samples (area under curve from amu)

SIMp is SIM of the product in sample (area under curve from amu)

SIMpc is SIM of product for positive control (area under curve from amu)

SIMS P C is SIM of the substrate in positive control samples (area under curve from amu)

SIM NC is SIM of product for negative control (area under curve from amu)

SIMsNc is SIM of substrate for negative control (area under curve from amu) wherein a positive control is a reaction without any test compound, a negative control is a reaction without DPPI or substrate, a sample is a reaction containing a test compound.

When a candidate compound is identified, the IC50 of the DPPI inhibition by the candidate compound is calculated using the formula (II):

wherein

S 1 is net substrate turnover signal of sample

So is net substrate turnover signal of positive control

Smin is net SIM signal of negative control

I is concentration of a candidate compound wherein a positive control is a reaction without any test compound and a negative control is a reaction without DPPI or substrate.

The above described assay may be used in a high-throughput format for screening test compounds, and identifying candidate compounds which modulate the activities of DPPI. In such case, the reaction mixture is first aliquoted to micro-titer plates containing a plurality of wells such as 96- or 386-well plates, then the plates are loaded to a detection system such as a mass spectrometry or the like, which reads the reaction in each well of each plate to generate numeric data.

Thus, while there have been shown and described and pointed out fundamental novel features of the invention as applied to a preferred embodiment thereof, it will be understood that various omissions and substitutions and changes in the form and details of the compounds, methods and devices illustrated, and in their operation, may be made by those skilled in the art without departing from the spirit of the invention. For example, it is expressly intended that all combinations of those elements and/or method steps which perform substantially the same function in substantially the same way to achieve the same results are within the scope of the invention. Moreover, it should be recognized that structures and/or elements and/or method steps shown and/or described in connection with any disclosed form or embodiment of the invention may be incorporated in any other disclosed or described or suggested form or embodiment as a general matter of design choice. It is the intention, therefore, to be limited only as indicated by the scope of the claims appended hereto.

EXAMPLE 1 Preparation of A 1OX HEPES Buffer System and Dipeptidyl Proteinase I

A 1OX reaction buffer of 500 mM HEPES at pH 7.0, 1 M NaCl, and 0.05% Tween-20 was prepared. Prior to the reaction, DTT or other suitable reducing agent was added to IX reaction buffer of 50 mM HEPES at pH 7, 100 mM NaCl and 0.005% Tween-20 to a final

concentration of 2 mM. A reaction volume of 10 or 20 μls was aliquoted into a 384-well polypropylene plate for the DDP-I activity.

DPPI was over-expressed and purified using a bacculovirus system in Hi5 insect cells according to Lauritzen et al. (1998, Protein Expr. Purif 14, 434-442), the content of which is incorporated herein by reference in its entirety. The recombinant baculovirus encoding a DPPI precursor was prepared according to the instructions of the Baculovirus Expression System (Invitrogen, Carlsbad, CA). Briefly, recombinant baculovirus containing cDNA of human and mouse DDP precursors were transfected into the Hi5 insect cells. After about 4-5 days post transfection, the media was harvested and DPPl precursor was purified using a butyl-Sepharose (GE Healthcare) chromatography at pH 4.5. The DPPl -containing fractions were pooled and dialyzed for two days at pH 7.0 to complete activation. During secretion and activation, the signal sequence and the activation peptide were cleaved off and resulted in a fully activated enzyme. The dialyzed heterotrimeric and active DPPl was further purified on Q-Sepharose (GE Healthcare), concentrated by ultrafiltration (Amicon, Ultra-15, 10000 MWCO, Millipore), and dialyzed in a final buffer of 20 mM Bis-Tris/HCl, pH 7.0, 0.1 M NaCl, 2 mM DTT, and 2 mM EDTA. All purification and dialysis steps were carried out at 4 0 C. DPPl was aliquoted, flash- frozen in liquid nitrogen, and stored at -80 0 C. Correct N- termini for three chains were confirmed by N-terminal sequencing.

EXAMPLE 2 Design of Peptide Substrates Which Binds to Multiple Substrate Binding Site of DPPI

The N-terminus peptide sequences of human chymase, cathepsin G, elastase, and tryptase were aligned as below.

Chymase MLLLPLPLLLFLLCSRAEAGEI IGGTECKPHSRPMAYLEIV

Cathpsin G MQPLLLLLAFLLPTGAEAGEI IGGRESRPHSRPYMAYLQI

Elastase -MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQL

Tryptase MLSLLLLALPVLASRAYAAPAPVQALQQAGIVGGQEAPRSKWPWQVSLRV Consensus AEAGEI IGG EAKPHSRPYMVYL

The peptides of GEIIGGTECKPHSRPYMAYL (SEQ ID NO: 1), NH 2 - GEIIGGTECKPHSRPYMAYK-COOH (SEQ ID NO: 2), NH 2 -GEIIGG-COOH (SEQ ID NO: 3), and NH 2 -GEIIGGTE-COOH (SEQ ID NO: 4) were selected as DPPI substrates. The substrates and the corresponding product peptides OfNH 2 -IIGGTECKPHSRPYMAYL- COOH(SEQ ID NO: 8), NH 2 -IIGGTECKPHSRPYMAYK-COOH (SEQ ID NO: 9), NH 2 -

IIGG-COOH (SEQ ID NO: 10), and NH 2 -IIGGTE-COOH (SEQ ID NO: 11) were synthesized (AnaSpec, San Jose, CA) and dissolved in Milli-Q water. The single ion monitoring (SIM) for the peptide substrates and their products were described in Table 1.

A skilled person in the art will recognize that other peptide sequences can be used as substrates according to the method described herein, for example NH 2 -GEIIGGTECK-COOH (SEQ ID NO: 5), NH 2 -GEIIGGTECKPH-COOH (SEQ ID NO: 6), and a peptide OfNH 2 - GEIIGGXEAKPHSRPYMV-YL-COOH (SEQ ID NO: 7) where X is any native or modified amino acid.

EXAMPLE 3 DPPI Assays with the Peptide Substrates

A standard curve for the 20-mer substrate peptide of NH2-GEIIGGTECKPHSRPY- MAYL-COOH (SEQ ID NO: 1) and the 18-mer product peptide (NH2- IIGGTECKPHSRP YMA YL-COOH (SEQ ID NO: 8) was generated by a mass spectrometry system using single-ion monitoring detection.

About 2 nM of DPPI was incubated with about 0.5, 1, 2, 4, 8, 16, 32, 64, 90, 128, 150 μM of the 20-mer substrate in the reaction buffer of 50 mM HEPES (pH 7.0), 100 mM NaCl, 0.005% Tween-20, and 2 mM of DTT or GSH. The reaction was incubated at about 27°C and terminated with about 1/10 volume of 2% trifluoroacetic acid at multiple time points at 0, 2, 5, 10, 20, 30, 45, 60, 75, 90, and 120 mins. An aliquot of about lOμl of the quenched reaction was used for detecting the substrate turnover by RapidFire (BioTrove, Woburn, MA) with a C 4 cartridge. The reaction was loaded onto the cartridge, which was equilibrated with the stationary phase of 0.1% formic acid + 0.02% TFA and developed with the mobile phase of 90% MeCN + 0.1% formic acid + 0.02% TFA at about 1 ml per min. The 20-mer substrate at SIM 1112 amu (atomic mass unit) and the corresponding 18-mer product at SIM

1019 were monitored using Agilent 1100 series LCMSD (Santa Clara, CA) in the positive ion mode monitoring.

Initial reaction rates were taken from kinetic data where less than 7% substrate turnover was achieved. The results, as shown in Figure 1, indicated that the substrate turnover may be represented as a hyperbolic curve. The value for K M , K cat , and second order rate constant were calculated to be about 62 μM, 1.15 sec "1 , and 1.95 x 10 4 M 1 SeC 1 , respectively (Table 2). These values were set up conditions for evaluating test compounds in the DPPI assay.

EXAMPLE 4 Rate-Based DPPI Assays Using the Dipeptide And the Peptide Substrates

The DPPI activity was analyzed with either the dipeptide substrate, GIy -Arg, labeled with alpha-methylcoumarin (AMC), or the 20-mer peptide substrate of SEQ ID NO: 1. For the dipeptide substrate, about 0.4 nM of DPPI was incubated with about 1, 2, 5, 10, 25, 50, 100, 150, 300, 600 μM of the dipeptide substrate in lOul of reaction buffer of 50 mM Hepes (pH 7.0), 100 mM NaCl, 0.005% Tween-20, and 2mM of DTT or GSH. The fluorescence (Eχ=380nm, E M =460nm) was monitored continuously from about 0 to 10 mins, using a Safire II (Tecan, Switzerland) to determine the DPPI activity. The condition for the 20-mer peptide substrate was the same as described above.

The kinetic constant of the DPPI assay with either substrate was shown in Table 2. The values of both k cat and 2 n order rate constant of the reaction containing the 20-mer substrate peptide were reduced compared to those of reaction containing the labeled dipeptide. The results show that the 20-mer substrate has a different kinetic mechanism, which is likely due to the product dissociation being the rate-limiting step. The products of the reaction with the 20-mer substrate include a N-terminal 2-mer peptide and a C-terminal 18-mer peptide. The 18-mer product peptide binds to the DPPI binding sites which cannot be examined using the dipeptide substrate. This suggests that the DPPI assay using the dipeptide substrate may not provide sufficient information on the efficacy of the tested compounds.

Table 2: Summary of kinetic constants of DPPI assay with the 20-mer substrate of GEIIGGTECKPHSRPYMAYL and the dipeptide substrate of GR.

K M (μM) k cat (Mmin "1 ) 2 nd order rate constant (M -1 SeC "1 )

20-mer 62 69 1.95 x 10 4

Dipeptide 64 5667 1.48 x lO 6

EXAMPLE 5 Screening Test Compounds That Modulate DPPI Activities

Two fragment compounds, 2-(piperidin-l-ylcarbonyl)phenol and 2-(piperidin-l- ylcarbonyl)aniline were evaluated for their activity to modulate DPPI. A dilution series of the compounds of about 0.1 mM to about 100 mM was made in 100% DMSO. About one μl of a test compound and about 8μl of about 3.75 nM DDP-I were added to a 384-well polypropylene plate (Greiner Bio-One North America Inc., Monroe, North Carolina). The proteolytic reaction was initiated by the addition of about 1 μl of 200 μM substrate. The reaction was incubated at 27°C for 60 min and terminated with an addition of about 25 μl of 0.1% formic acid + 0.02% TFA. An aliquot of about lOμl of the quenched reaction was analyzed by RapidFire™ as described in Examples 3 and 4.

The results of Experiment 5 were summarized in Figure 2. In the reaction with the dipeptide substrate, neither compound, even in high concentration of 10 mM, affected the DPPI activity. However, in the reaction with the 20-mer substrate, both compounds modulated the DPPI activity in a concentration dependent manner. The semi-log plot analysis showed that the ICso-values for the 2-(piperidin-l-ylcarbonyl)phenol and 2- (piperidin-l-ylcarbonyl)aniline were about 0.1 mM and about 1 mM, respectively. Previously, these compounds have not been shown to modulate DPPI activity.

The present application provides a method for assaying DPPI activity preferably using a label-free peptide as DPPI substrate. The method has several advantages compared to the labeled dipeptide substrate that is commonly used. For example, the label-free substrate provides a direct detection of unmodified compounds and eliminates the limitations due to labeling and secondary detection system. Also, the label-free substrate is easily adapted for a

high-throughput format. In addition, the peptide substrate has similar binding specificity to DPPI active site as those of physiological targets in cells. Further, the increased binding specificity allows for evaluating or identifying compounds that bind outside of the S 1 -S 2 region of the active site. The compounds bind to active sites in addition to S 1 -S 2 , such as Si to S 4 , increases logarithmically and specificity.