Login| Sign Up| Help| Contact|

Patent Searching and Data


Title:
HUMAN GENOME-DERIVED SINGLE EXON NUCLEIC ACID PROBES USEFUL FOR ANALYSIS OF GENE EXPRESSION IN HUMAN ADULT LIVER
Document Type and Number:
WIPO Patent Application WO/2001/057273
Kind Code:
A2
Abstract:
A single exon nucleic acid microarray comprising a plurality of single exon nucleic acid probes for measuring gene expression in a sample derived from human adult liver is described. Also described are single exon nucleic acid probes expressed in the adult liver and their use in methods for detecting gene expression.

Inventors:
Penn, Sharron G. (617 South Delaware Street, San Mateo, CA, 94402, US)
Hanzel, David K. (988 Loma Verde Avenue, Palo Alto, CA, 94303, US)
Chen, Wensheng (210 Easy Street #25, Mountain View, CA, 94043, US)
Rank, David R. (117 El Dorado Commons, Fremont, CA, 94539, US)
Application Number:
PCT/US2001/000664
Publication Date:
August 09, 2001
Filing Date:
January 30, 2001
Export Citation:
Click for automatic bibliography generation   Help
Assignee:
AEOMICA, INC. (928 East Arques Avenue, Sunnyvale, CA, 94085, US)
Penn, Sharron G. (617 South Delaware Street, San Mateo, CA, 94402, US)
Hanzel, David K. (988 Loma Verde Avenue, Palo Alto, CA, 94303, US)
Chen, Wensheng (210 Easy Street #25, Mountain View, CA, 94043, US)
Rank, David R. (117 El Dorado Commons, Fremont, CA, 94539, US)
International Classes:
C07K14/47; C07K14/705; C12N15/10; C12N15/66; C12Q1/68; G06F19/00; A61K38/00; (IPC1-7): C12Q1/68; C07K14/47; G06F19/00
Attorney, Agent or Firm:
Ronning Jr., Royal N. (Amersham Pharmacia Biotech, Inc. 800 Centennial Avenu, Piscataway NJ, 08855, US)
Rollins, Anthony J. (Amersham plc, Amersham Laboratories White Lion Roa, Amersham Bucks HP7 9LL, GB)
Download PDF:
Claims:
CLAIMS
1. A spatiallyaddressable set of single exon nucleic acid probes for measuring gene expression in a sample derived from human adult liver comprising a plurality single exon nucleic probes, said probes comprising any one of the nucleotide sequences set out in SEQ ID NOs : 113, 109 or a complementary sequence, or a portion of such a sequence.
2. A spatiallyaddressable set of single exon nucleic acid probes as claimed in claim 1 wherein each of said plurality of probes is separately and addressably amplifiable.
3. A spatiallyaddressable set of single exon nucleic acid probes as claimed in claim 1 wherein each of said plurality of probes is separately and addressably isolatable from said plurality.
4. A spatiallyaddressable set of single exon nucleic acid probes as claimed in any of claims 1 to 3 wherein said probes comprise any one of the nucleotide sequences set out in SEQ ID NOS. : 13, 11025, 995.
5. A spatiallyaddressable set of single exon nucleic acid probes as claimed in any of claims 1 to 4, wherein each of said plurality of probes is amplifiable using at least one common primer.
6. A spatiallyaddressable set of single exon nucleic acid probes as claimed in any of claims 1 to 5 wherein the set comprises between 5020, 000 single exon nucleic acid probes.
7. A spatiallyaddressable set of single exon nucleic acid probes as claimed in any of claims 1 to 6, wherein the average length of the single exon nucleic acid probes is between 200 and 500 bp.
8. A spatiallyaddressable set of single exon nucleic acid probes as claimed in any of claims 1 to 7, wherein at least 50% of said single exon nucleic acid probes lack prokaryotic and bacteriophage vector sequence.
9. A spatiallyaddressable set of single exon nucleic acid probes as claimed in any of claims 1 to 8, wherein at least 50% of said single exon nucleic acid probes lack homopolymeric stretches of A or T.
10. A spatiallyaddressable set of single exon nucleic acid probes as claimed in any of claims 19 characterised in that said set of probes is addressably disposed upon a substrate.
11. A spatiallyaddressable set of single exon nucleic acid probes as claimed in claim 10 wherein said substrate is selected from glass, amorphous silicon, crystalline silicon and plastic.
12. A microarray comprising a spatially addressable set of single exon nucleic acid probes as claimed in any of claims 111.
13. A single exon nucleic acid probe for measuring human gene expression in a sample derived from human adult liver comprising a nucleotide sequence as set out in any of SEQ ID NOs. :. 113, 109 or a complementary sequence or a fragment thereof wherein said probe hybridizes at high stringency to a nucleic acid molecule expressed in the human adult liver.
14. A single exon nucleic acid probe as claimed in claim 13 comprising a nucleotide sequence as set out. in any of SEQ ID NOs. : 13, 11025, 995 or a complementary sequence or a fragment thereof.
15. A single exon nucleic acid probe for measuring human gene expression in a sample derived from human adult liver which is a nucleic acid molecule having a sequence encoding a peptide comprising a peptide sequence as set out in any of SEQ ID NOs. : 25, 99638, 578, or a complementary sequence or a fragment thereof wherein said probe hybridizes at high stringency to a nucleic acid expressed in the human adult liver.
16. A single exon nucleic acid probe as claimed in any one of claims 13 to 15 wherein said single exon nucleic acid probe comprises between 15 and 25 contiguous nucleotides of said SEQ ID NO.
17. A single exon nucleic acid probe as claimed in any one of claims 13 to 15, wherein said probe is between 325 kb in length.
18. A single exon nucleic acid probe as claimed in any one of claims 1317, wherein said probe is DNA, RNA or PNA.
19. A single exon nucleic acid probe as claimed in any one of claims 1318, wherein said probe is detectably labeled.
20. A single exon nucleic acid probe as claimed in any one of claims 1319, wherein said probe lacks prokaryotic and bacteriophage vector sequence.
21. A single exon nucleic acid probe as claimed in any one of claims 1320, wherein said probe lacks homopolymeric stretches of A or T.
22. A method of measuring gene expression in a sample derived from human adult liver, comprising : contacting the microarray of claim 12, with a first collection of detectably labeled nucleic acids, said first collection of nucleic acids derived from mRNA of human adult liver ; and then measuring the label detectably bound to each probe of said microarray.
23. A method of identifying exons in a eukaryotic genome, comprising : algorithmically predicting at least one exon from genomic sequence of said eukaryote ; and then detecting specific hybridization of detectably labeled nucleic acids to a single exon probe, wherein said detectably labeled nucleic acids are derived from mRNA from the adult liver of said eukaryote, said probe is a single exon probe having a fragment identical in sequence to, or complementary in sequence to, said predicted exon, said probe is included within a microarray according to claim 12, and said fragment is selectively hybridizable at high stringency.
24. A method of assigning exons to a single gene, comprising : identifying a plurality of exons from genomic sequence according to the method of claim 23 ; and then measuring the expression of each of said exons in a plurality of tissues and/or cell types using hybridization to single exon microarrays having a probe with said exon, wherein a common pattern of expression of said exons in said plurality of tissues and/or cell types indicates that the exons should be assigned to a single gene.
25. A nucleic acid sequence as set out in any of SEQ ID NOs : 125, 995 which encodes a peptide.
26. A peptide encoded by a sequence as set out in any of SEQ ID Nos : 125, 995.
27. A peptide comprising a sequence as set out in any of SEQ ID Nos : 25, 99638, 578.
Description:
HUMAN GENOME-DERIVED SINGLE EXON NUCLEIC ACID PROBES USEFUL FOR ANALYSIS OF GENE EXPRESSION IN HUMAN ADULT LIVER CROSS REFERENCE TO RELATED APPLICATIONS The present application is a continuation-in-part of U. S. patent application serial nos. 09/632, 366, filed August 3, 2000 and 09/608, 408, filed June 30, 2000 ; claims the benefit under 35 U. S. C. s 119 (e) of U. S. provisional patent application serial nos. 60/236, 359, filed September 27, 2000, 60/234, 687, filed September 21, 2000, 60/207, 456, filed May 26, 2000, and 60/180, 312, filed February 4, 2000 ; and further claims the benefit under 35 U. S. C. s 119 (a) of UK patent application no. 0024263. 6, filed October 4, 2000, the disclosures of which are incorporated herein by reference in their entireties.

REFERENCE TO SEQUENCE LISTING AND INCORPORATION BY REFERENCE THEREOF The present application includes a Sequence Listing in electronic format, filed pursuant to PCT Administrative Instructions 801-806 on a single CD-R disc, in triplicate, containing a file named ptoADULTLIVER. txt, created 24 January 2001, having 26, 335, 065 bytes. The Sequence Listing contained in said file on said disc is incorporated herein by reference in its entirety.

Field of the Invention The present invention relates to genome-derived single exon microarrays useful for verifying the expression of regions of genomic DNA predicted to encode protein. In particular, the present invention relates to unique genome- derived single exon nucleic acid probes expressed in human

adult liver and single exon nucleic acid microarrays that include such probes.

Background of the Invention For almost two decades following the invention of general techniques for nucleic acid sequencing, Sanger et al., Proc. Natl. Acad. Sci. USA 70 (4) : 1209-13 (1973) ; Gilbert et al., Proc. Natl. Acad. Sci. USA 70 (12) : 3581-4 (1973), these techniques were used principally as tools to further the understanding of proteins-known or suspected-about which a basic foundation of biological knowledge had already been built. In many cases, the cloning effort that preceded sequence identification had been both informed and directed by that antecedent biological understanding.

For example, the cloning of the T cell receptor for antigen was predicated upon its known or suspected cell type-specific expression, by its suspected membrane association, and by the predicted assembly of its gene via T cell-specific somatic recombination. Subsequent sequencing efforts at once confirmed and extended understanding of this family of proteins. Hedrick et al., Nature 308 (5955) : 153-8 (1984).

More recently, however, the development of high throughput sequencing methods and devices, in concert with large public and private undertakings to sequence the human and other genomes, has altered this investigational paradigm : today, sequence information often precedes understanding of the basic biology of the encoded protein product.

One of the approaches to large-scale sequencing is predicated upon the proposition that expressed sequences-that is, those accessible through isolation of mRNA-are of greatest initial interest. This"expressed sequence tag" ("EST") approach has already yielded vast

amounts of sequence data (see for example Adams et al., Science 252 : 1651 (1991) ; Williamson, Drug Discov. Today 4 : 115 (1999)). For nucleic acids sequenced by this approach, often the only biological information that is known a priori with any certainty is the likelihood of biologic expression itself. By virtue of the species and tissue from which the mRNA had originally been obtained, most such sequences are also annotated with the identity of the species and at least one tissue in which expression appears likely.

More recently, the pace of genomic sequencing has accelerated dramatically. When genomic DNA serves as the initial substrate for sequencing efforts, expression cannot be presumed ; often the only a priori biological information about the sequence includes the species and chromosome (and perhaps chromosomal map location) of origin.

With the ever-accelerating pace of sequence accumulation by directed, EST, and genomic sequencing approaches-and in particular, with the accumulation of sequence information from multiple genera, from multiple species within genera, and from multiple individuals within a species-there is an increasing need for methods that rapidly and effectively permit the functions of nucleic sequences to be elucidated. And as such functional information accumulates, there is a further need for methods of storing such functional information in meaningful and useful relationship to the sequence itself ; that is, there is an increasing need for means and apparatus for annotating raw sequence data with known or predicted functional information.

Although the increase in the pace of genomic sequencing is due in large part to technological changes in sequencing strategies and instrumentation, Service, Science 280 : 995 (1998) ; Pennisi, Science 283 : 1822-1823 (1999), there is an important functional motivation as well.

While it was understood that the EST approach would rarely be able to yield sequence information about the noncoding portions of the genome, it now also appears the EST approach is capable of capturing only a fraction of a genome's actual expression complexity.

For example, when the C. elegans genome was fully sequenced, gene prediction algorithms identified over 19, 000 potential genes, of which only 7, 000 had been found by EST sequencing. C. elegans Sequencing Consortium, Science 282 : 2012 (1998). Analogously, the recently completed sequence of chromosome 2 of Arabidopsis predicts over 4000 genes, Lin et al., Nature, 402 : 761 (1999), of which only about 6% had previously been identified via EST sequencing efforts. Although the human genome has the greatest depth of EST coverage, it is still woefully short of surrendering all of its genes. One recent estimate suggests that the human genome contains more than 146, 000 genes, which would at this point leave greater than half of the genes undiscovered. It is now predicted that many genes, perhaps 20 to 50%, will only be found by genomic sequencing.

There is, therefore, a need for methods that permit the functional regions of genomic sequence-and most importantly, but not exclusively, regions that function to encode genes-to be identified.

Much of the coding sequence of the human genome is not homologous to known genes, making detection of open reading frames ("ORFs") and predictions of gene function difficult. Computational methods exist for predicting coding regions in eukaryotic genomes. Gene prediction programs such as GRAIL and GRAIL II, Uberbacher et al., Proc. Natl. Acad. Sci. USA 88 (24) : 11261-5 (1991) ; Xu et al., Genet. Eng. 16 : 241-53 (1994) ; Uberbacher et al., Methods Enzymol. 266 : 259-81 (1996) ; GENEFINDER, Solovyev et al., Nucl. Acids. Res. 22 : 5156-63 (1994) ; Solovyev et al.,

Ismb 5 : 294-302 (1997) ; and GENESCAN, Burge et al., J. Mol.

Biol. 268 : 78-94 (1997), predict many putative genes without known homology or function. Such programs are known, however, to give high false positive rates. Burset et al., Genomics 34 : 353-367 (1996). Using a consensus obtained by a plurality of such programs is known to increase the reliability of calling exons from genomic sequence.

Ansari-Lari et al., Genome Res. 8 (1) : 29-40 (1998) Identification of functional genes from genomic data remains, however, an imperfect art. For example, in reporting the full sequence of human chromosome 21, the Chromosome 21 Mapping and Sequencing Consortium reports that prior bioinformatic estimates of human gene number may need to be revised substantially downwards. Nature 405 : 311-199 (2000) ; Reeves, Nature 405 : 283-284 (2000).

Thus, there is a need for methods and apparatus that permit the functions of the regions identified bioinformatically-and specifically, that permit the expression of regions predicted to encode protein-readily to be confirmed experimentally.

Recently, the development of nucleic acid microarrays has made possible the automated and highly parallel measurement of gene expression. Reviewed in Schena (ed.), DNA Microarrays : A Practical Approach (Practical Approach Series), Oxford University Press (1999) (ISBN : 0199637768) ; Nature Genet. 21 (1) (suppl) : 1-60 (1999) ; Schena (ed.), Microarray Biochip : Tools and Technology, Eaton Publishing Company/BioTechniques Books Division (2000) (ISBN : 1881299376).

It is common for microarrays to be derived from cDNA/EST libraries, either from those previously described in the literature, such as those from the I. M. A. G. E. consortium, Lennon et al., Genomics 33 (1) : 151-2 (1996), or from the construction of"problem specific"libraries targeted at a particular biological question, R. S. Thomas

et al., Cancer Res. (in press). Such microarrays by definition can measure expression only of those genes found in EST libraries, and thus have not been useful as probes for genes discovered solely by genomic sequencing.

The utility of using whole genome nucleic acid microarrays to answer certain biological questions has been demonstrated for the yeast Saccharomyces cerevisiae. De Risi et al., Science 278 : 680 (1997). The vast majority of yeast nuclear genes, approximately 95% however, are single exon genes, i. e., lack introns, Lopez et al., RNA 5 : 1135- 1137 (1999) ; Goffeau et al., Science 274 : 563-67 (1996), permitting coding regions more readily to be identified.

Whole genome nucleic acid microarrays have not generally been used to probe gene expression from more complex eukaryotic genomes, and in particular from those averaging more than one intron per gene.

Diseases of the liver are a significant cause of human morbidity and mortality. Increasingly, genetic factors are being found that contribute to predisposition, onset, and/or aggressiveness of most, if not all, of these diseases ; although causative mutations in single genes have been identified for some, these disorders are believed for the most part to have polygenic etiologies. There is a need for methods and apparatus that permit prediction, diagnosis and prognosis of diseases of the liver particularly those diseases with polygenic etiologies.

Summary of the Invention The present invention solves these and other problems in the art by providing methods and apparatus for predicting, confirming, and displaying functional information derived from genomic sequence. The present invention also provides apparatus for verifying the expression of putative genes identified within genomic

sequence.

In particular, the invention provides novel genome-derived single exon nucleic acid microarrays useful for verifying the expression of putative genes identified within genomic sequence.

The present invention also provides compositions and kits for the ready production of nucleic acids identical'in sequence to, or substantially identical in sequence to, probes on the genome-derived single exon microarrays of the present invention.

Accordingly, in a first aspect of the invention, there is provided a spatially-addressable set of single exon nucleic acid probes for measuring gene expression in a sample derived from human adult liver, comprising a plurality of single exon nucleic acid probes according to any one of the nucleotide sequences set out in SEQ ID NOs : 1-13, 109or a complementary sequence, or a portion of such a sequence.

By plurality is meant at least two, suitably at least 20, most suitably at least 100, preferably at least 1000 and, most preferably, upto 5000.

In one embodiment of the first aspect, each of said plurality of probes is separately and addressably amplifiable.

In an alternative embodiment, each of said plurality of probes is separately and addressably isolatable from said plurality.

In a preferred embodiment, each of said plurality of probes is amplifiable using at least one common primer.

Preferably, each of said plurality of probes is amplifiable using a first and a second common primer.

In yet another embodiment, said set of single exon nucleic acid probes comprises between 50-20, 000 probes, for example, 50-5000.

Suitably, said set of single exon nucleic acid

probes comprises at least 50-1000 discrete single exon nucleic acid probes having a sequence as set out in any of SEQ ID NOS. : 1-25, 995or a complimentary sequence, or a portion of such a sequence.

Preferably, the average length of the single exon nucleic acid probes is between 200 and 500 bp. It is preferred that the average length should be at least 200bp, suitably at least 250bp, most suitably at least 300bp, preferably at least 400bp and, most preferably, 500 bp.

In another embodiment, the single exon nucleic acid probes lack prokaryotic and bacteriophage vector sequence. It is preferred that at least 50%, suitably at least 60%, most suitably at least 70%, preferably at least 75%, more preferably at least 80, 85, 90, 95 or 99% of said single exon nucleic acid probes lack prokaryotic and bacteriophage vector sequence.

In another preferred embodiment, said single exon nucleic acid lack homopolymeric stretches of A or T. It is preferred that at least 50%, suitably at least 60%, most suitably at least 70%, preferably at least 75%, more preferably at least 80, 85, 90, 95 or 99% of said single exon nucleic acid probes lack homopolymeric stretches of A or T.

Preferably, a spatially-addressable set of single exon nucleic acid probes in accordance with the first aspect of the invention is is addressably disposed upon a substrate.

Suitable substrates include a filter membrane which may, preferably, be nitrocellulose or nylon. The nylon may preferably, be positively-charged. Other suitable substrates include glass, amorphous silicon, crystalline silicon, and plastic. Further suitable materials include polymethylacrylic, polyethylene, polypropylene, polyacrylate, polymethylmethacrylate, polyvinylchloride, polytetrafluoroethylene, polystyrene, polycarbonate,

polyacetal, polysulfone, celluloseacetate, cellulosenitrate, nitrocellulose, and mixtures thereof.

In a second aspect of the invention, there is provided a microarray comprising a spatially addressable set of single exon nucleic acid probes in accordance with the first aspect of the invention.

In one embodiment, a genome-derived single-exon microarray is packaged together with such an ordered set of amplifiable probes corresponding to the probes, or one or more subsets of probes, thereon. In alternative embodiments, the ordered set of amplifiable probes is packaged separately from the genome-derived single exon microarray.

In another aspect, the invention provides genome- derived single exon nucleic acid probes useful for gene expression analysis, and particularly for gene expression analysis by microarray. In particular embodiments of this aspect, the present invention provides human single-exon probes that include specifically-hybridizable fragments of SEQ ID Nos. 13, 110-25, 995, wherein the fragment hybridizes at high stringency to an expressed human gene.

In particular embodiments, the invention provides single exon probes comprising SEQ ID Nos. 1-13, 109.

Accordingly, in a third aspect of the invention, there is provided a single exon nucleic acid probe for measuring human gene expression in a sample derived from human adult liver which is a nucleic acid molecule comprising a nucleotide sequence as set out in any of SEQ ID NOs. : 1-13, 109or a complementary sequence or a fragment thereof wherein said probe hybridizes at high stringency to a nucleic acid expressed in the human adult liver.

In one embodiment, a single exon nucleic acid probe in accordance with the third aspect comprises a nucleotide sequence as set out in any of SEQ ID NOs. :

13, 110-25, 995 or a complementary sequence or a fragment thereof.

In a fourth aspect of the invention, there is provided a single exon nucleic acid probe for measuring human gene expression in a sample derived from human adult liver which is a nucleic acid molecule having a sequence encoding a peptide comprising a peptide sequence as set out in any of SEQ ID NOs. : 25, 996-38, 578 or a complementary sequence or a fragment thereof wherein said probe hybridizes at high stringency to a nucleic acid expressed in the human adult liver.

Preferably, a single exon nucleic acid probe in accordance with the third or fourth aspects of the invention comprises between at least 15 and 50 contiguous nucleotides of said SEQ ID NO :. It is preferred that the single exon nucleic acid probe comprises at least 15, suitably at least 20, more suitably at least 25 or preferably at least 50 contiguous nucleotides of said SEQ ID NO :.

In another preferred embodiment, a single exon nucleic acid probe in accordance with the third or fourth aspects of the invention is between 3kb and 25kb in length.

It is preferred that said probe is no more than 3kb, suitably no more than 5kb, more suitably no more than 10kb, preferably 15kb, more preferably 20kb or, most preferably, no more than 20kb in length.

Preferably, a single exon nucleic acid probe in accordance with either the fifth or sixth aspect of the invention is DNA, preferably single-stranded DNA, RNA or PNA.

In another embodiment of either the third or fourth aspect of the invention, a single exon nucleic acid probe is detectably labeled. Suitable detectable labels include a radionuclide, a fluorescent label or a first member of a specific binding pair. Suitable fluorescent

labels include dyes such as cyanine dyes, preferably Cy3 and Cy5 although other suitable dyes will be known to those skilled in the art.

In a particularly preferred embodiment, a single exon nucleic acid probe in accordance with either the third or fourth aspect of the invention lacks prokaryotic and bacteriophage vector sequence. In yet another embodiment, a single exon nucleic acid probe in accordance with either the third or fourth aspect of the invention lacks homopolymeric stretches of A or T.

In a fifth aspect of the invention, there is provided an amplifiable nucleic acid composition, comprising : the single exon nucleic acid probe in accordance with either of the third or fourth aspects of the invention ; and at least one nucleic acid primer ; wherein said at least one primer is sufficient to prime enzymatic amplification of said probe.

In an sixth. aspect of the invention, there is provided a method of measuring gene expression in a sample derived from human adult liver, comprising : contacting the single exon microarray in accordance with the second aspect of the invention, with a first collection of detectably labeled nucleic acids, said first collection of nucleic acids derived from mRNA of human adult liver ; and then measuring the label detectably bound to each probe of said microarray.

In a seventh aspect of the invention, there is provided a method of identifying exons in a eukaryotic genome, comprising : algorithmically predicting at least one exon from genomic sequence of said eukaryote ; and then detecting specific hybridization of detectably labeled nucleic acids to a single exon probe,

wherein said detectably labeled nucleic acids are derived from mRNA from the adult liver of said eukaryote, said probe is a single exon probe having a fragment identical in sequence to, or complementary in sequence to, said predicted exon, said probe is included within a single exon microarray in accordance with the first aspect of the invention, and said fragment is selectively hybridizable at high stringency.

In a eighth aspect of the invention, there is provided a method of assigning exons to a single gene, comprising : identifying a plurality of exons from genomic sequence in accordance with the seventh aspect of the invention ; and then measuring the expression of each of said exons in a plurality of tissues and/or cell types using hybridization to single exon microarrays having a probe with said exon, wherein a common pattern of expression of said exons in said plurality of tissues and/or cell types indicates that the exons should be assigned to a single gene.

In an ninth aspect of the invention, there is provided a nucleic acid sequence as set out in any of SEQ ID NOs : 1-25, 995wherein said sequence encodes a peptide.

In a tenth aspect of the invention, there is provided a peptide encoded by a sequence comprising a sequence as set out in any of SEQ ID NOs : 13, 110-25, 995, or a complementary sequence or coding portion thereof.

In a preferred embodiment, a peptide may be encoded by a sequence comprising a sequence set out in any of SEQ ID NOS. : 1-13, 109.

In a further aspect, the invention provides peptides comprising an amino acid sequence translated from the DNA fragments, said amino acid sequences comprising SEQ

ID NOS. : 25, 996-38, 578.

Accordingly in a eleventh aspect of the invention there is provided a peptide comprising a sequence as set out in any of SEQ ID NOs : 25, 996-38, 578, or fragment thereof.

In another aspect, the invention provides means for displaying annotated sequence, and in particular, for displaying sequence annotated according to the methods and apparatus of the present invention. Further, such display can be used as a preferred graphical user interface for electronic search, query, and analysis of such annotated sequence.

Detailed Description of the Invention Definitions As used herein, the term"microarray"and phrase "nucleic acid microarray"refer to a substrate-bound collection of plural nucleic acids, hybridization to each of the plurality of bound nucleic acids being separately detectable. The substrate can be solid or porous, planar or non-planar, unitary or distributed.

As so defined, the term"microarray"and phrase "nucleic acid microarray"include all the devices so called in Schena (ed.), DNA Microarrays : A Practical Approach (Practical Approach Series), Oxford University Press (1999) (ISBN : 0199637768) ; Nature Genet. 21 (1) (suppl) : 1-60 (1999) ; and Schena (ed.), Microarray Biochip : Tools and Technology, Eaton Publishing Company/BioTechniques Books Division (2000) (ISBN : 1881299376). As so defined, the term"microarray"and phrase"nucleic acid microarray" further include substrate-bound collections of plural nucleic acids in which the nucleic acids are distributably disposed on a plurality of beads, rather than on a unitary

planar substrate, as is described, inter alia, in Brenner et al., Proc. Natl. Acad. Sci. USA 97 (4) : 166501670 (2000) ; in such case, the term"microarray"and phrase"nucleic acid microarray"refer to the plurality of beads in aggregate.

As used herein with respect to a nucleic acid microarray, the term"probe"refers to the nucleic acid that is, or is intended to be, bound to the substrate ; in such context, the term"target"thus refers to nucleic acid intended to be bound thereto by Watson-Crick complementarity. As used herein with respect to solution phase hybridization, the term"probe"refers to the nucleic acid of known sequence that is detectably labeled.

As used herein, the expression"probe comprising SEQ ID NO.", and variants thereof, intends a nucleic acid probe, at least a portion of which probe has either (i) the sequence directly as given in the referenced SEQ ID NO., or (ii) a sequence complementary to the sequence as given in the referenced SEQ ID NO., the choice as between sequence directly as given and complement thereof dictated by the requirement that the probe hybridize to mRNA.

As used herein, the term"open reading frame"and the equivalent acronym"ORF"refer to that portion of an exon that can be translated in its entirety into a sequence of contiguous amino acids i. e. a nucleic acid sequence that, in at least one reading frame, does not possess stop codons ; the term does not require that the ORF encode the entirety of a natural protein.

As used herein, the term"amplicon"refers to a PCR product amplified from human genomic DNA, containing the predicted exon.

As used herein the term"exon"refers to the consensus prediction of the various exon and gene predicting algorithms i. e. a nucleic acid sequence bioinformatically predicted to encode a portion of a

natural protein.

As used herein, the term"peptide"refers to a sequence of amino acids. The sequences referred to as PEPTIDE SEQ ID NOS. : are the predicted peptide sequences that would be translated from one of the exons, or a portion thereof set out in exon SEQ ID NOS. :. The codons encoding the peptide are wholly contained within the exon.

As used herein, a"portions"of a defined nucleotide sequence or sequences can be and, preferably, are fragments unique to that sequence or to one or a combination of those sequences. A fragment unique to a nucleic acid molecule is one that is a signature for the larger nucleic acid molecule.

As used herein, the phrase"expression of a probe"and its linguistic variants means that the ORF present within the probe, or its complement, is present within a target mRNA.

As used herein,"stringent conditions"refers to parameters well known to those skilled in the art. When a nucleic acid molecule is said to be hybridisable to another of a given sequence under"stringent conditions"it is meant that it is homologous to the given sequence.

As used herein, the phrase"specific binding pair"intends a pair of molecules that bind to one another with high specificity. Binding pairs are said to exhibit specific binding when they exhibit avidity of at least 107, preferably at least 108, more preferably at least 109 liters/mole. Nonlimiting examples of specific binding pairs are : antibody and antigen ; biotin and avidin ; and biotin and streptavidin.

As used herein with respect to the visual display of annotated genomic sequence, the term"rectangle"means any geometric shape that has at least a first and a second border, wherein the first and second borders each are capable of mapping uniquely to a point of another visual

object of the display.

As used herein, a"Mondrian"means a visual display in which a single genomic sequence is annotated with predicted and experimentally confirmed functional information.

Brief Description of the Drawings The present invention is further illustrated with reference to the following non-limiting figures and examples in which : FIG. 1 illustrates a process for predicting functional regions from genomic sequence, confirming the functional activity of such regions experimentally, and associating and displaying the data so obtained in meaningful and useful relationship to the original sequence data ; FIG. 2 further elaborates that portion of the process schematized in FIG. 1 for predicting functional regions from genomic sequence ; FIG. 3 illustrates a Mondrian visual display ; FIG. 4 presents a Mondrian showing a hypothetical annotated genomic sequence ; FIG. 5 is a histogram showing the distribution of ORF length and PCR products as obtained, with ORF length shown in black and PCR product length shown in dotted lines ; FIG. 6 is a histogram showing the distribution, among exons predicted according to the methods described, of expression as measured using simultaneous two color hybridization to a genome-derived single exon microarray.

The graph shows the number of sequence-verified products that were either not expressed ("0"), expressed in one or more but not all tested tissues ("1"-"9"), or expressed

in all tissues tested ("10") ; FIG. 7 is a pictorial representation of the expression of verified sequences that showed expression with signal intensity greater than 3 in at least one tissue, with : FIG. 7A showing the expression as measured by microarray hybridization in each of the 10 measured tissues, and the expression as measured"bioinformatically" by query of EST, NR and SwissProt databases ; with FIG. 7B showing the legend for display of physical expression (ratio) in FIG. 7A ; and with FIG. 7C showing the legend for scoring EST hits as depicted in FIG. 7A ; FIG. 8 shows a comparison of normalized CY3 signal intensity for arrayed sequences that were identical to sequences in existing EST, NR and SwissProt databases or that were dissimilar (unknown), where black denotes the signal intensity for all sequence-verified products with a BLAST Expect ("E") value of greater than le-30 (1 x 10-30) ("unknown") and a dotted line denotes sequence-verified spots with a BLAST expect ("E") value of less than le-30 (1 x 10-30) ("known") ; FIG. 9 presents a Mondrian of BAC AC008172 (bases 25, 000 to 130, 000), containing the carbamyl phosphate synthetase gene (AF154830. 1) ; and FIG. 10 is a Mondrian of BAC A049839. f Methods and Apparatus for Predicting, Confirming, Annotating, and Displaying Functional Regions From Genomic Sequence Data FIG. 1 is a flow chart illustrating in broad outline a process for predicting functional regions from genomic sequence, confirming and characterizing the functional activity of such regions experimentally, and then associating and displaying the information so obtained

in meaningful and useful relationship to the original sequence data.

The initial input into process 10 of the present invention is drawn from one or more databases 100 containing genomic sequence data. Because genomic sequence is usually obtained from subgenomic fragments, the sequence data typically will be stored in a series of records corresponding to these subgenomic sequenced fragments.

Some fragments will have been catenated to form larger contiguous sequences ("contigs") ; others will not. A finite percentage of sequence data in the database will typically be erroneous, consisting inter alia of vector sequence, sequence created from aberrant cloning events, sequence of artificial polylinkers, and sequence that was erroneously read.

Each sequence record in database 100 will minimally contain as annotation a unique sequence identifier (accession number), and will typically be annotated further to identify the date of accession, species of origin, and depositor. Because database 100 can contain nongenomic sequence, each sequence will typically be annotated further to permit query for genomic sequence.

Chromosomal origin, optionally with map location, can also be present. Data can be, and over time increasingly will be, further annotated with additional information, in part through use of the present invention, as described below.

Annotation can be present within the data records, in information external to database 100 and linked to the records thereto, or through a combination of the two.

Databases useful as genomic sequence database 100 in the present invention include GenBank, and particularly include several divisions thereof, including the htgs (draft), NT (nucleotide, command line), and NR (nonredundant) divisions. GenBank is produced by the National Institutes of Health and is maintained by the

National Center for Biotechnology Information (NCBI).

Databases of genomic sequence from species other than human, such as mouse, rat, Arabidopsis, C. elegans, C. brigsii, Drosophila, zebra fish, and other higher eukaryotic organisms will also prove useful as genomic sequence database 100.

Genomic sequence obtained by query of genomic sequence database 100 is then input into one or more processes 200 for identification of regions therein that are predicted to have a biological function as specified by the user. Such functions include, but are not limited to, encoding protein, regulating transcription, regulating message transport after transcription into mRNA, regulating message splicing after transcription into mRNA, of regulating message degradation after transcription into mRNA, and the like. Other functions include directing somatic recombination events, contributing to chromosomal stability or movement, contributing to allelic exclusion or X chromosome inactivation, and the like.

The particular genomic sequence to be input into process 200 will depend upon the function for which relevant sequence is to be identified as well as upon the approach chosen for such identification. Process step 200 can be iterated to identify different functions within a given genomic region. In such case, the input often will be different for the several iterations.

Sequences predicted to have the requisite function by process 200 are then input into process 300, where a subset of the input sequences suitable for experimental confirmation is identified. Experimental confirmation can involve physical and/or bioinformatic assay. Where the subsequent experimental assay is bioinformatic, rather than physical, there are fewer constraints on the sequences that can be tested, and in this latter case therefore process 300 can output the

entirety of the input sequence.

The subset of sequences output from process 300 is then used in process 400 for experimental verification and characterization of the function predicted in process 200, which experimental verification can, and often will, include both physical and bioinformatic assay.

Process 500 annotates the sequence data with the functional information obtained in the physical and/or bioinformatic assays of process 400. Such annotation can be done using any technique that usefully relates the functional information to the sequence, as, for example, by incorporating the functional data into the sequence data record itself, by linking records in a hierarchical or relational database, by linking to external databases, by a combination thereof, or by other means well known within the database arts. The data can even be submitted for incorporation into databases maintained by others, such as GenBank, which is maintained by NCBI.

As further noted in FIG. 1, additional annotation can be input into process 500 from external sources 600.

The annotated data is then displayed in process 800, either before, concomitantly with, or after optional storage 700 on nontransient media, such as magnetic disk, optical disc, magnetooptical disk, flash memory, or the like.

FIG. 1 shows that the experimental data output from process 400 can be used in each preceding step of process 10 : e. g., facilitating identification of functional sequences in process 200, facilitating identification of an experimentally suitable subset thereof in process 300, and facilitating creation of physical and/or informational substrates for, and performance of subsequent assay, of functional sequences in process 400.

Information from each step can be passed directly to the succeeding process, or stored in permanent or

interim form prior to passage to the succeeding process.

Often, data will be stored after each, or at least a plurality, of such process steps. Any or all process steps can be automated.

FIG. 2 further elaborates the prediction of functional sequence within genomic sequence according to process 200.

Genomic sequence database 100 is first queried 20 for genomic sequence.

The sequence required to be returned by query 20 will depend, in the first instance, upon the function to be identified.

For example, genomic sequences that function to encode protein can be identified inter alia using gene prediction approaches, comparative sequence analysis approaches, or combinations of the two. In gene prediction analysis, sequence from one genome is input into process 200 where at least one, preferably a plurality, of algorithmic methods are applied to identify putative coding regions. In comparative sequence analysis, by contrast, corresponding, e. g., syntenic, sequence from a plurality of sources, typically a plurality of species, is input into process 200, where at least one, possibly a plurality, of algorithmic methods are applied to compare the sequences and identify regions of least variability.

The exact content of query 20 will also depend upon the database queried. For example, if the database contains both genomic and nongenomic sequence, perhaps derived from multiple species, and the function to be determined is protein coding regions in human genomic sequence, the query will accordingly require that the sequence returned be genomic and derived from humans.

Query 20 can also incorporate criteria that compel return of sequence that meets operative requirements of the subsequent analytical method. Alternatively, or in

addition, such operative criteria can be enforced in subsequent preprocess step 24.

For example, if the function sought to be identified is protein coding, query 20 can incorporate criteria that return from genomic sequence database 100 only those sequences present within contigs sufficiently long as to have obviated substantial fragmentation of any given exon among a plurality of separate sequence fragments.

Such criteria can, for example, consist of a required minimal individual genomic sequence fragment length, such as 10 kb, more typically 20 kb, 30 kb, 40kb, and preferably 50 kb or more, as well as an optional further or alternative requirement that sequence from any given clone, such as a bacterial artificial chromosome ("BAC"), be presented in no more than a finite maximal number of fragments, such as no more than 20 separate pieces, more typically no more than 15 fragments, even more typically no more than about 10-12 fragments.

Results using the present invention have shown that genomic sequence from bacterial artificial chromosomes (BACs) is sufficient for gene prediction analysis according to the present invention if the sequence is at least 50 kb in length, and if additionally the sequence from any given BAC is presented in fewer than 15, and preferably fewer than 10, fragments. Accordingly, query 20 can incorporate a requirement that data accessioned from BAC sequencing be in fewer than 15, preferably fewer than 10, fragments.

An additional criterion that can be incorporated into the query can be the date, or range of dates, of sequence accession. Although the process has been described above as if genomic sequence database 100 were static, it is of course understood that the genomic sequence databases need not be static, and indeed are typically updated on a frequent, even hourly, basis. Thus,

as further described in Examples 1 and 2, infra, it is possible to query the database for newly added sequence, either newly added after an absolute date, or newly added relative to a prior analysis performed using the methods and apparatus of the present invention. In this way, the process herein described can incorporate a dynamic, temporal component.

One utility of such temporal limitation is to identify, from newly accessioned genomic sequence, the presence of novel genes, particularly those not previously identified by EST sequencing (or other sequencing efforts that are similarly based upon gene expression). As further described in Example 1, such an approach has shown that newly accessioned human genomic sequence, when analyzed for sequences that function to encode protein, readily identifies genes that are novel over those in existing EST and other expression databases. This makes the methods of the present invention extremely powerful gene discovery tools. And as would be appreciated, such gene discovery can be performed using genomic sequence from species other than human.

If query 20 incorporates multiple criteria, such as above-described, the multiple criteria can be performed as a series of separate queries or as a single query, depending in part upon the query language, the complexity of the query, and other considerations well known in the database arts.

If query 20 returns no genomic sequence meeting the query criteria, the negative result can be reported by process 22, and process 200 (and indeed, entire process 10) ended 23, as shown. Alternatively, or in addition to report and termination of the initial inquiry, a new query 20 can be generated that takes into account the initial negative result.

When query 20 returns sequence meeting the query

criteria, the returned sequence is then passed to optional preprocessing 24, suitable and specific for the desired analytical approach and the particular analytical methods thereof to be used in process 25.

Preprocessing 24 can include processes suitable for many approaches and methods thereof, as well as processes specifically suited for the intended subsequent analysis.

Preprocessing 24 suitable for most approaches and methods will include elimination of sequence irrelevant to, or that would interfere with, the subsequent analysis.

Such sequence includes repetitive sequence, such as Alu repeats and LINE elements, vector sequence, artificial sequence, such as artificial polylinkers, and the like.

Such removal can readily be performed by identification and subsequent masking of the undesired sequence.

Identification can be effected by comparing the genomic sequence returned by query 20 with public or private databases containing known repetitive sequence, vector sequence, artificial sequence, and other artifactual sequence. Such comparison can readily be done using programs well known in the art, such as CROSS MATCH, or by proprietary sequence comparison programs the engineering of which is well within the skill in the art.

Alternatively, or in addition, undesirable, including artifactual, sequence can be identified algorithmically without comparison to external databases and thereafter removed. For example, synthetic polylinker sequence can be identified by an algorithm that identifies a significantly higher than average density of known restriction sites. As another example, vector sequence can be identified by algorithms that identify nucleotide or codon usage at variance with that of the bulk of the genomic sequence.

Once identified, undesired sequence can be

removed. Removal can usefully be done by masking the undesired sequence as, for example, by converting the specific nucleotide references to one that is unrecognized by the subsequent bioinformatic algorithms, such as"X".

Alternatively, but at present less preferred, the undesired sequence can be excised from the returned genomic sequence, leaving gaps.

Preprocessing 24 can further include selection from among duplicative sequences of that one sequence of highest quality. Higher quality can be measured as a lower percentage of, fewest number of, or least densely clustered occurrence of ambiguous nucleotides, defined as those nucleotides that are identified in the genomic sequence using symbols indicating ambiguity. Higher quality can also or alternatively be valued by presence in the longest contig.

Preprocessing 24 can, and often will, also include formatting of the data as specifically appropriate for passage to the analytical algorithms of process 25.

Such formatting can and typically will include, inter alia, addition of a unique sequence identifier, either derived from the original accession number in genomic sequence database 100, or newly applied, and can further include additional annotation. Formatting can include conversion from one to another sequence listing standard, such as conversion to or from FASTA or the like, depending upon the input expected by the subsequent process.

Preprocessing, which can be optional depending upon the function desired to be identified and the informational requirements of the methods for effecting such identification, is followed by sequence processing 25, where sequences with the desired function are identified within the genomic sequence.

As mentioned above, such functions can include, but are not limited to, encoding protein, regulating

transcription, regulating message transport after transcription into mRNA, regulating message splicing after transcription, of regulating message degradation, and the like. Other functions include directing somatic recombination events, contributing to chromosomal stability or movement, contributing to allelic exclusion or X chromosome inactivation, or the like.

The methods of the present invention are particularly useful for gene discovery, that is, for identifying, from genomic sequence, regions that. function to encode genes, and in a particularly useful embodiment, for identifying regions that function to encode genes not hitherto identified by expression-based or directed cloning and sequencing. In conjunction with verification using the novel single exon microarrays of the present invention, as further described below, the methods herein described become powerful gene discovery tools.

Accordingly, in a preferred embodiment of the present invention, process 25 is used to identify putative coding regions. Two preferred approaches in process 25 for identifying sequence that encodes putative genes are gene prediction and comparative sequence analysis.

Gene prediction can be performed using any of a number of algorithmic methods, embodied in one or more software programs, that identify open reading frames (ORFs) using a variety of heuristics, such as GRAIL, DICTION, and GENEFINDER. Comparative sequence analysis similarly can be performed using any of a variety of known programs that identify regions with lower sequence variability.

As further described in Example 1, below, gene finding software programs yield a range of results. For the newly accessioned human genomic sequence input in Example 1, for example, GRAIL identified the greatest percentage of genomic sequence as putative coding region, 2% of the data analyzed ; GENEFINDER was second, calling 1% ;

and DICTION yielded the least putative coding region, with 0. 8% of genomic sequence called as coding region.

Increased reliability can be obtained when consensus is required among several such methods. Although discussed herein particularly with respect to exon calling, consensus among methods will in general increase reliability of predicting other functions as well.

Thus, as indicated by query 26, sequence processing 25, optionally with preprocessing 24, can be repeated with a different method, with consensus among such iterations determined and reported in process 27.

Process 27 compares the several outputs for a given input genomic sequence and identifies consensus among the separately reported results. The consensus itself, as well as the sequence meeting that consensus, is then stored in process 29a, displayed in process 29b, and/or output to process 300 for subsequent identification of a subset thereof suitable for assay.

Multiple levels of consensus can be calculated and reported by process 27. For example, as further described in Example 1, infra, process 27 can report consensus as between all specific pairs of methods of gene prediction, as consensus among any one or more of the pairs of methods of gene prediction, or as among all of the gene prediction algorithms used. Thus, in Example 1, process 27 reported that GRAIL and GENEFINDER programs agreed on 0. 7% of genomic sequence, that GRAIL and DICTION agreed on 0. 5% of genomic sequence, and that the three programs together agreed on 0. 25% of the data analyzed. Put another way, 0. 25% of the genomic sequence was identified by all three of the programs as containing putative coding region.

Furthermore, consensus can be required among different approaches to identifying a chosen function.

For example, if the function desired to be identified is coding of protein sequence, and a first used

approach to exon calling is gene prediction, the process can be repeated on the same input sequence, or subset thereof, with another approach, such as comparative sequence analysis. In such a case, where comparative sequence analysis follows gene prediction, the comparison can be performed not only on genomic nucleic acid sequence, but additionally or alternatively can be performed on the predicted amino acid sequence translated from the ORFs prior identified by the gene prediction approach.

Although shown as an iterative process, the multiple analyses required to achieve consensus can be done in series, in parallel, or some combination thereof.

Predicted functional sequence, optionally representing a consensus among a plurality of methods and approaches for determination thereof, is passed to process 300 for identification of a subset thereof for functional assay.

In the preferred embodiment of the methods of the present invention, wherein the function sought to be identified is protein coding, process 300 is used to identify a subset thereof suitable for experimental verification by physical and/or bioinformatic approaches.

For example, putative ORFs identified in process 200 can be classified, or binned, bioinformatically into putative genes. This binning can be based inter alia upon consideration of the average number of exons/gene in the species chosen for analysis, upon density of exons that have been called on the genomic sequence, and other empirical rules. Thereafter, one or more among the gene- specific ORFs can be chosen for subsequent use in gene expression assay.

Where such subsequent gene expression assay uses amplified nucleic acid, considerations such as desired amplicon length, primer synthesis requirements, putative exon length, sequence GC content, existence of possible

secondary structure, and the like can be used to identify and select those ORFs that appear most likely successfully to amplify. Where subsequent gene expression assay relies upon nucleic acid hybridization, whether or not using amplified product, further considerations involving hybridization stringency can be applied to identify that subset of sequences that will most readily permit sequence- specific discrimination at a chosen hybridization and wash stringency. One particular such consideration is avoidance of putative exons that span repetitive sequence ; such sequence can hybridize spuriously to nonspecific message, reducing specific signal in the hybridization.

For bioinformatic assay, there are fewer constraints on the sequences that can be tested experimentally, and in this latter case therefore process 300 can output the entirety of the input sequence.

The subset of sequences identified by process 300 as suitable for use in assay is then used in process 400 to create the physical and/or informational substrate for experimental verification of the predictions made in process 200, and thereafter to assay those substrates.

As mentioned, the methods of the present invention are particularly useful for identifying potential coding regions within genomic sequence. In a preferred embodiment of process 400, therefore, the expression of the sequences predicted to encode protein is verified. The combination of the predictive and experimental methods provides a powerful gene discovery engine.

Thus, in another aspect, the present invention provides methods and apparatus for verifying the expression of putative genes identified within genomic sequence. In particular, the invention provides a novel method of verifying gene expression in which expression of predicted ORFs is measured and confirmed using a novel type of nucleic acid microarray, the genome-derived single exon

nucleic acid microarrays of the present invention.

Putative ORFs as predicted by a consensus of gene calling, particularly gene prediction, algorithms in process 200, and as further identified as suitable by process 300, are amplified from genomic DNA using the polymerase chain reaction (PCR). Although PCR is conveniently used, other amplification approaches can also be used. I Amplification schemes can be designed to capture the entirety of each predicted ORF in an amplicon with minimal additional (that is, intronic or intergenic) sequence. Because ORFs predicted from human genomic sequence using the methods of the present invention differ in length, such an approach results in amplicons of varying length.

However, most predicted ORFs are shorter than 500 bp in length, and although amplicons of at least about 100 or 200 base pairs can be immobilized as probes on nucleic acid microarrays, early experimental results using the methods of the present invention have suggested that longer amplicons, at least about 400 or 500 base pairs, are more effective. Furthermore, certain advantages derive from application to the microarray of amplicons of defined size.

Therefore, amplification schemes can alternatively, and preferably, be designed to amplify regions of defined size, preferably at least about 300, 400 or 500 bp, centered about each predicted ORF. Such an approach results in a population of amplicons of limited size diversity, but that typically contain intronic and/or intergenic nucleic acid in addition to putative ORF.

Conversely, somewhat fewer than 10% of ORFs predicted from human genomic sequence according to the methods of the present invention exceed 500 bp in length.

Portions of such extended ORFs, preferably at least about 300, 400 or 500 bp in length, can be amplified. However, it

has been discovered that the percentage success at amplifying pieces of such ORFs is low, and that such putative exons are more effectively amplified when larger fragments, at least about 1000 or 1500 bp, and even as large as 2000 bp are amplified.

The putative ORFs selected in process 300 are thus input into one or more primer design programs, such as PRIMER3 (available online for use at http ://www-genome. wi. mit. edu/cgi-bin/primer/), with a goal of amplifying at least about 500 base pairs of genomic sequence centered within or about ORFs predicted to be no more than about 500 bp, or at least about 1000-1500 bp of genomic sequence for ORFs predicted to exceed 500 bp in length, and the primers synthesized by standard techniques.

Primers with the requisite sequences can be purchased commercially or synthesized by standard techniques.

Conveniently, a first predetermined sequence can be added commonly to the ORF-specific 5'primer and a second, typically different, predetermined sequence commonly added to each 3'ORF-unique primer. This serves to immortalize the amplicon, that is, serves to permit further amplification of any amplicon using a single set of primers complementary respectively to the common 5'and common 3'sequence elements. The presence of these "universal"priming sequences further facilitates later sequence verification, providing a sequence common to all amplicons at which to prime sequencing reactions. The common 5'and 3'sequences further serve to add a cloning site should any of the ORFs warrant further study.

Such predetermined sequence is usefully at least about 10, 12 or 15 nt in length, and usually does not exceed about 25 nt in length. The"universal"priming sequences used in the examples presented infra were each 16 nt long.

The genomic DNA to be used as substrate for

amplification will come from the eukaryotic species from which the genomic sequence data had originally been obtained, or a closely related species, and can conveniently be prepared by well known techniques from somatic or germline tissue or cultured cells of the organism. See, e. g., Short Protocols in Molecular Biology : A Compendium of Methods from Current Protocols in Molecular Biology, Ausubel et al. (eds.), 4th edition (April 1999), John Wiley & Sons (ISBN : 047132938X) and Maniatis et al., Molecular Cloning : A Laboratory Manual, 2nd edition (December 1989), Cold Spring Harbor Laboratory Press (ISBN : 0879693096). Many such prepared genomic DNAs are available commercially, with the human genomic DNAs additionally having certification of donor informed consent.

Although the intronic and intergenic material flanking putative coding regions in the amplicons could potentially interfere with hybridizations during microarray experiments, we have found, surprisingly, that differential expression ratios are not significantly affected. Rather, the predominant effect of exon size is to alter the absolute signal intensity, rather than its ratio. Equally surprising, the art had suggested that single exon probes would not provide sufficient signal intensity for high stringency hybridization analyses ; we find that such probes not only provide adequate signal, but have substantial advantages, as herein described.

After partial purification, as by size exclusion spin column, with or without confirmation as to amplicon quality as by gel electrophoresis, each amplicon (single exon probe) is disposed in an array upon a support substrate.

Methods for creating microarrays by deposition and fixation of nucleic acids onto support substrates are well known in the art (Reviewed by Schena et al., see

above).

Typically, the support substrate will be glass, although other materials, such as amorphous or crystalline silicon or plastics. Such plastics include polymethylacrylic, polyethylene, polypropylene, polyacrylate, polymethylmethacrylate, polyvinylchloride, polytetrafluoroethylene, polystyrene, polycarbonate, polyacetal, polysulfone, celluloseacetate, cellulosenitrate, nitrocellulose, or mixtures thereof, can also be used. Typically, the support will be rectangular, although other shapes, particularly circular disks and even spheres, present certain advantages. Particularly advantageous alternatives to glass slides as support substrates for array of nucleic acids are optical discs, as described in WO 98/12559.

The amplified nucleic acids can be attached covalently to a surface of the support substrate or, more typically, applied to a derivatized surface in a chaotropic agent that facilitates denaturation and adherence by presumed noncovalent interactions, or some combination thereof.

Robotic spotting devices useful for arraying nucleic acids on support substrates can be constructed using public domain specifications (The MGuide, version 2. 0, http ://cmgm. stanford. edu/pbrown/mguide/index. html), or can conveniently be purchased from commercial sources (MicroArray GenII Spotter and MicroArray GenIII Spotter, Molecular Dynamics, Inc., Sunnyvale, CA). Spotting can also be effected by printing methods, including those using ink jet technology.

As is well known in the art, microarrays typically also contain immobilized control nucleic acids.

For controls useful in providing measurements of background signal for the genome-derived single exon microarrays of the present invention, a plurality of E. coli genes can

readily be used. As further described in Example 1, 16 or 32 E. coli genes suffice to provide a robust measure of background noise in such microarrays.

As is well known in the art, the amplified product disposed in arrays on a support substrate to create a nucleic acid microarray can consist entirely of natural nucleotides linked by phosphodiester bonds, or alternatively can include either nonnative nucleotides, alternative internucleotide linkages, or both, so long as complementary binding can be obtained in the hybridization.

If enzymatic amplification is used to produce the immobilized probes, the amplifying enzyme will impose certain further constraints upon the types of nucleic acid analogs that can be generated.

Although particularly described herein as using high density microarrays constructed on planar substrates, the methods of the present invention for confirming the expression of ORFs predicted from genomic sequence can use any of the known types of microarrays, as herein defined, including lower density planar arrays, and microarrays on nonplanar, nonunitary, distributed substrates.

For example, gene expression can be confirmed using hybridization to lower density arrays, such as'those constructed on membranes, such as nitrocellulose, nylon, and positively-charged derivatized nylon membranes.

Further, gene expression can also be confirmed using nonplanar, bead-based microarrays such as are described in Brenner et al., Proc. Natl. Acad. Sci. USA 97 (4) : 166501670 (2000) ; U. S. Patent No. 6, 057, 107 ; and U. S. Patent No.

5, 736, 330. In theory, a packed collection of such beads provides in aggregate a higher density of nucleic acid probe than can be achieved with spotting or lithography techniques on a single planar substrate.

Planar microarrays on solid substrates, however, provide certain useful advantages, including high

throughput and compatibility with existing readers. For example, each standard microscope slide can include at least 1000, typically at least 2000, preferably 5000 and upto 10, 000-50, 000 or more nucleic acid probes of discrete sequence. The number of sequences deposited will depend on their required application.

Each putative gene can be represented in the array by a single predicted ORF. Alternatively, genes can be represented by more than one predicted ORF. For purposes of measuring differential splicing, more than one predicted ORF will be provided for a putative gene. And as is well known in the art, each probe of defined sequence, representing a single predicted ORF, can be deposited in a plurality of locations on a single microarray to provide redundancy of signal.

The genome-derived single exon microarrays described above differ in several fundamental and advantageous ways from microarrays presently used in the gene expression art, including (1) those created by deposition of mRNA-derived nucleic acids, (2) those created by in situ synthesis of oligonucleotide probes, and (3) those constructed from yeast genomic DNA.

Most nucleic acid microarrays that are in use for study of eukaryotic gene expression have as immobilized probes nucleic acids that are derived-either directly or indirectly-from expressed message. As discussed above, it is common, for example, for such microarrays to be derived from cDNA/EST libraries, either from those previously described in the literature, see Lennon et al., or from the de novo construction of"problem specific" libraries targeted at a particular biological question, R. S. Thomas et al., Cancer Res. (in press). Such microarrays are herein collectively denominated"EST microarrays".

Such EST microarrays by definition can measure

expression only of those genes found in EST libraries, shown herein to represent only a fraction of expressed genes. Furthermore, such libraries-and thus microarrays based thereupon-are biased by the tissue or cell type of message origin, by the expression levels of the respective genes within the tissues, and by the ability of the message successfully to have been reverse-transcribed and cloned.

Thus, as further discussed in Example 1, the methods of the present invention enable sequences that do not appear in EST or other expression databases to be determined-subsequently arrayed for expression measurements could not, therefore, have been represented as probes on an EST microarray. And as further demonstrated in the examples, infra, the remaining population of genes identified from genomic sequence by the methods of the present invention-that is, the one third of sequences that had previously been accessioned in EST or other expression databases-are biased toward genes with higher expression levels.

Representation of a message in an EST and/or cDNA library depends upon the successful reverse transcription, optionally but typically with subsequent successful cloning, of the message. This introduces substantial. bias into the population of probes available for arraying in EST microarrays.

In contrast, neither reverse transcription nor cloning is required to produce the probes arrayed on the genome-derived single exon microarrays of the present invention. And although the ultimate deposition of a probe on the genome-derived single exon microarray of the present invention depends upon a successful amplification from genomic material, a priori knowledge of the sequence of the desired amplicon affords greater opportunity to recover any given probe sequence recalcitrant to amplification than is afforded by the requirement for successful reverse

transcription and cloning of unknown message in EST approaches.

Thus, the genome-derived single exon microarrays of the present invention present a far greater diversity of probes for measuring gene expression, with far less bias, than do EST microarrays presently used in the art.

As a further consequence of their ultimate origin from expressed message, the probes in EST microarrays often contain poly-A (or complementary poly-T) stretches derived from the poly-A tail of mature mRNA. These homopolymeric stretches contribute to cross-hybridization, that is, to a spurious signal occasioned by hybridization to the homopolymeric tail of a labeled cDNA that lacks sequence homology to the gene-specific portion of the probe.

In contrast, the probes arrayed in the genome- derived single exon microarrays of the present invention lack homopolymeric stretches derived from message polyadenylation, and thus can provide more specific signal.

Typically, at least about 50, 60 or 75% of the probes on the genome-derived single exon microarrays of the present invention lack homopolymeric regions consisting of A or T, where a homopolymeric region is defined for purposes herein as stretches of 25 or more, typically 30 or more, identical nucleotides.

A further distinction, which also affects the specificity of hybridization, is occasioned by the typical derivation of EST microarray probes from cloned material.

Because much of the probe material disposed as probes on EST microarrays is excised or amplified from plasmid, phage, or phagemid vectors, EST microarrays typically include a fair amount of vector sequence, more so when the probes are amplified, rather than excised, from the vector.

In contrast, the vast majority of probes in the genome-derived single exon microarrays of the present invention contain no prokaryotic or bacteriophage vector

sequence, having been amplified directly or indirectly from genomic DNA. Typically, therefore, at least about 50, 60, 70 or 80% or more of individual exon-including probes disposed on a genome-derived single exon microarray of the present invention lack vector sequence, and particularly lack sequences drawn from plasmids and bacteriophage.

Preferably, at least about 85, 90 or more than 90% of exon- including probes in the genome-derived single exon microarray of the present invention lack vector sequence.

With attention to removal of vector sequences through preprocessing 24, percentages of vector-free exon-including probes can be as high as 95-99%. The substantial absence of vector sequence from the genome-derived single exon microarrays of the present invention results in greater specificity during hybridization, since spurious cross- hybridization to a probe vector sequence is reduced.

As a further consequence of excision or amplification of probes from vectors in construction of EST microarrays, the probes arrayed thereon often contain artificial sequence, derived from vector polylinker multiple cloning sites, at both 5'and 3'ends. The probes disposed upon the genome-derived single exon microarrays need have no such artificial sequence appended thereto.

As mentioned above, however, the ORF-specific primers used to amplify putative ORFs can include artificial sequences, typically 5'to the ORF-specific primer sequence, useful for"universal" (that is, independent of ORF sequence) priming of subsequent amplification or sequencing reactions. When such "universal"5'and/or 3'priming sequences are appended to the amplification primers, the probes disposed upon the genome-derived single exon microarray will include artificial sequence similar to that found in EST microarrays. However, the genome-derived single exon microarray of the present invention can be made without

such sequences, and if so constructed, presents an even smaller amount of nonspecific sequence that would contribute to nonspecific hybridization.

Yet another consequence of typical use of cloned material as probes in EST microarrays is that such microarrays contain probes that result from cloning artifacts, such as chimeric molecules containing coding region of two separate genes. Derived from genomic material, typically not thereafter cloned, the probes of the genome-derived single exon microarrays of the present invention lack such cloning artifacts, and thus provide greater specificity of signal in gene expression measurements.

A further consequence of the cloned origin of probes on many EST microarrays is that the individual probes often have disparate sizes, which can cause the optimal hybridization stringency to vary among probes on a single microarray. In contrast, as discussed above, the probes arrayed on the genome-derived single exon microarrays of the present invention can readily be designed to have a narrow distribution in sizes, with the range of probe sizes no greater than about 10% of the average size, typically no greater than about 5% of the average probe size.

Because of their origin from fully-or partially- spliced message, probes disposed upon EST arrays will often include multiple exons. The percentage of such exon- spanning probes in an EST microarray can be calculated, on average, based upon the predicted number of exons/gene for the given species and the average length of the immobilized probes. For human genes, the near-complete sequence of human chromosome 22, Dunham et al., Nature 402 (6761) : 489-95 (1999), predicts that human genes average 5. 5 exons/gene.

Even with probes of 200-500 bp, the vast majority of human EST microarray probes include more than one exon.

In contrast, by virtue of their origin from algorithmically identified ORFs in genomic sequence, the probes in the genome-derived single exon microarrays of the present invention can consist of individual exons. Thus, in contrast to EST microarrays, at least about 50, 60, 70, 75, 80, 85, 95 or 99% of probes deposited in the genome- derived microarray of the present invention consist of, or include, no more than one predicted ORF.

This provides the ability, not readily achieved using EST microarrays, to use the genome-derived single exon microarrays of the present invention to measure tissue-specific expression of individual exons, which in turn allows differential splicing events to be detected and characterized, and in particular, allows the correlation of differential splicing to tissue-specific expression patterns.

Furthermore, the exons that are represented in EST microarrays are often biased toward the 3'or 5'end of their respective genes, since sequencing strategies used for EST identification are so biased. In contrast, no such 3'or 5'bias necessarily inheres in the selection of exons for disposition on the genome-derived single exon microarrays of the present invention.

Conversely, the probes provided on the genome- derived single exon microarrays of the present invention typically, but need not necessarily, include intronic and/or intergenic sequence that is absent from EST microarrays, which are derived from mature mRNA.

Typically, at least about 50, 60, 70, 80 or 90% of the exon-including probes on the genome-derived single exon microarrays of the present invention include sequence drawn from noncoding regions. As discussed above, the additional presence of noncoding region does not significantly interfere with measurement of gene expression, and provides the additional opportunity to assay prespliced RNA, and

thus measure such phenomena such as nuclear export control.

The genome-derived single exon microarrays of the present invention are also quite different from in situ synthesis microarrays, where probe size is severely constrained by inadequacies in the photolithographic synthesis process.

Typically, probes arrayed on in situ synthesis microarrays are limited to a maximum of about 25 bp. As a well known consequence, hybridization to such chips must be performed at low stringency. In order, therefore, to achieve unambiguous sequence-specific hybridization results, the in situ synthesis microarray requires substantial redundancy, with concomitant programmed arraying for each probe of probe analogues with altered (i. e., mismatched) sequence.

In contrast, the longer probe length of the genome-derived single exon microarrays of the present invention allows much higher stringency hybridization and wash. Typically, therefore, exon-including probes on the genome-derived single exon microarrays of the present invention average at least about 100, 200, 300, 400 or 500 bp in length. By obviating the need for substantial probe redundancy, this approach permits a higher density of probes for discrete exons or genes to be arrayed on the microarrays of the present invention than can be achieved for in situ synthesis microarrays.

A further distinction is that the probes in in situ synthesis microarrays typically are covalently linked to the substrate surface. In contrast, the probes disposed on the genome-derived microarray of the present invention typically are, but need not necessarily be, bound noncovalently to the substrate.

Furthermore, the short probe size on in situ microarrays causes large percentage differences in the melting temperature of probes hybridized to their

complementary target sequence, and thus causes large percentage differences in the theoretically optimum stringency across the array as a whole.

In contrast, the larger probe size in the microarrays of the present invention create lower percentage differences in melting temperature across the range of arrayed probes.

A further significant advantage of the microarrays of the present invention over in situ synthesized arrays is that the quality of each individual probe can be confirmed before deposition. In contrast, the quality of probes cannot be assessed on a probe-by-probe basis for the in situ synthesized microarrays presently being used.

The genome-derived single exon microarrays of the present invention are also distinguished over, and present substantial benefits over, the genome-derived microarrays from lower eukaryotes such as yeast. Lashkari et al., Proc. Natl. Acad. Sci. USA 94 : 13057-13062 (1997).

Only about 220-250 of the 6100 or so nuclear genes in Saccharomyces cerevisiae-that is, only about 4 -5%-have standard, spliceosomal, introns, Lopez et al., Nucl. Acids Res. 28 : 85-86 (2000) ; Spingola et al., RNA 5 (2) : 221-34 (1999). Furthermore, the entire yeast genome has already been sequenced. These two facts permit the ready amplification and disposition of single-ORF amplicons on such microarray without the requirement for antecedent use of gene prediction and/or comparative sequence analyses.

Thus, a significant aspect of the present invention is the ability to identify and to confirm expression of predicted coding regions in genomic sequence drawn from eukaryotic organisms that have a higher percentage of genes having introns than do yeast such as Saccharomyces cerevisiae, particularly in genomic sequence

drawn from eukaryotes in which at least about 10, 20 or 50% of protein-encoding genes have introns. In preferred embodiments, the methods and apparatus of the present invention are used to identify and confirm expression of novel genes from genomic sequence of eukaryotes in which the average number of introns per gene is at least about one, two or three or more.

After the physical substrate is prepared, experimental verification of predicted function is performed.

In a preferred embodiment of the present invention, where the function sought to be identified in genomic sequence is protein coding, experimental verification is performed by measuring expression of the putative ORFs, typically through nucleic acid hybridization experiments, and in particularly preferred embodiments, through hybridization to genome-derived single exon microarrays prepared as above-described.

Expression is conveniently measured and expressed for each probe in the microarray as a ratio of the expression measured concurrently in a plurality of mRNA sources, according to techniques well known in the microarray art, Reviewed in Schena et al., and as further described in Example 2, below. The mRNA source for the reference against which specific expression is measured can be drawn from a homogeneous mRNA source, such as a single cultured cell-type, or alternatively can be heterogeneous, as from a pool of mRNA derived from multiple tissues and/or cell types, as further described in Example 2, infra. mRNA can be prepared by standard techniques, see Ausubel et al. and Maniatis et al., or purchased commercially. The mRNA is then typically reverse- transcribed in the presence of labeled nucleotides : the index source (that in which expression is desired to be measured) is reverse transcribed in the presence of

nucleotides labeled with a first label, typically a fluorophore (fluorochrome ; fluor ; fluorescent dye) ; the reference source is reverse transcribed in the presence of a second label, typically a fluorophore, typically fluorometrically-distinguishable from the first label. As further described in Example 2, infra, Cy3 and Cy5 dyes prove particularly useful in these methods. After partial purification of the index and reference targets, hybridization to the probe array is conducted according to standard techniques, typically under a coverslip.

After wash, microarrays are conveniently scanned using a commercial microarray scanning device, such as a Gen3 Scanner (Molecular Dynamics, Sunnyvale, CA). Data on expression is then passed, with or without interim storage, to process 500, where the results for each probe are related to the original sequence.

Often, hybridization of target material to the genome-derived single exon microarray will identify certain of the probes thereon as of particular interest. Thus, it is often desirable that the user be able readily to obtain sufficient quantities of an individual probe, either for subsequent arrayed deposition upon an additional support substrate, often as part of a microarray having a plurality of probes so identified, or alternatively or additionally as a solitary solid-phase or solution-phase probe, for further use.

Thus, in another aspect, the present invention provides compositions and kits for the ready production of nucleic acids identical in sequence to, or substantially identical in sequence to, probes on the genome-derived single exon microarrays of the present invention.

In this aspect, a small quantity of each probe is disposed, typically without attachment to substrate, in a spatially-addressable ordered set, typically one per well of a microtiter dish. Although a 96 well microtiter plate

can be used, greater efficiency is obtained using, higher density arrays, such as are provided by microtiter plates having 384, 864, 1536, 3456, 6144, or 9600 wells, and although microtiter plates having physical depressions (wells) are conveniently used, any device that permits addressable withdrawal of reagent from fluidly- noncommunicating areas can be used.

In this aspect of the invention, therefore, a fluidly noncommunicating addressable ordered set of individual probes, corresponding to those on a genome- derived single exon microarray, is provided, with each probe in sufficient quantity to permit amplification, such as by PCR. As earlier mentioned, the ORF-specific 5'primers used for genomic amplification can have a first common sequence added thereto, and the ORF-specific 3' primers used for genomic amplification can have a second, different, common sequence added thereto, thus permitting, in this preferred embodiment, the use of a single set of 5' and 3'primers to amplify any one of the probes from the amplifiable ordered set.

Each discrete amplifiable probe can also be packaged with amplification primers, solutes, buffers, etc., and can be provided in dry (e. g., lyophilized) form or wet, in the latter case typically with addition of agents that retard evaporation.

In another aspect of the present invention, a genome-derived single-exon microarray is packaged together with such an ordered set of amplifiable probes corresponding to the probes, or one or more subsets of probes, thereon. In alternative embodiments, the ordered set of amplifiable probes is packaged separately from the genome-derived single exon microarray.

In some embodiments, the microarray and/or ordered probe set are further packaged with recordable media that provide probe identification and addressing

information, and that can additionally contain annotation information, such as gene expression data. Such recordable media can be packaged with the microarray, with the ordered probe set, or with both.

If the microarray is constructed on a substrate that incorporates recordable media, such as is described in international patent application no. WO 98/12559, then separate packaging of the genome-derived single exon microarray and the bioinformatic information is not required.

The amount of amplifiable probe material should be sufficient to permit at least one amplification sufficient for subsequent hybridization assay.

Although the use of high density genome-derived microarrays on solid planar substrates is presently a preferred approach for the physical confirmation and characterization of the expression of sequences predicted to encode protein, other types of microarrays (as herein defined) can also be used.

Furthermore, as earlier mentioned, experimental verification of the function predicted from genomic sequence in process 200 can be bioinformatic, rather than, or additional to, physical verification.

For example, where the function desired to be identified is protein coding, the predicted ORFs can be compared bioinformatically to sequences known or suspected of being expressed.

Thus, the sequences output from process 300 (or process 200), can be used to query expression databases, such as EST databases, SNP ("single nucleotide polymorphism") databases, known cDNA and mRNA sequences, SAGE ("serial analysis of gene expression") databases, and more generalized sequence databases that allow query for expressed sequences. Such query can be done by any sequence query algorithm, such as BLAST ("basic local

alignment search tool"). The results of such query- including information on identical sequences and information on nonidentical sequences that have diffuse or focal regions of sequence homology to the query sequence- can then be passed directly to process 500, or used to inform analyses subsequently undertaken in process 200, process 300, or process 400.

Experimental data, whether obtained by physical or bioinformatic assay in process 400, is passed to process 500 where it is usefully related to the sequence data itself, a process colloquially termed"annotation". Such annotation can be done using any technique that usefully relates the functional information to the sequence, as, for example, by incorporating the functional data into the record itself, by linking records in a hierarchical or relational database, by linking to external databases, or by a combination thereof. Such database techniques are well within the skill in the art.

The annotated sequence data can be stored locally, uploaded to genomic sequence database 100, and/or displayed 800.

The methods and apparatus of the present invention rapidly produce functional information from genomic sequence. Coupled with the escalating pace at which sequence now accumulates, the rapid pace of sequence annotation produces a need for methods of displaying the information in meaningful ways.

FIG. 3 shows visual display 80 presenting a single genomic sequence annotated according to the present invention. Because of its nominal resemblance to artistic works of Piet Mondrian, visual display 80 is alternatively described herein as a"Mondrian".

Each of the visual elements of display 80 is aligned with respect to the genomic sequence being annotated (hereinafter, the"annotated sequence"). Given

the number of nucleotides typically represented in an annotated sequence, representation of individual nucleotides would rarely be readable in hard copy output of display 80. Typically, therefore, the annotated sequence is schematized as rectangle 89, extending from the left border of display 80 to its right border. By convention herein, the left border of rectangle 89 represents the first nucleotide of the sequence and the right border of rectangle 89 represents the last nucleotide of the sequence.

As further discussed below, however, the Mondrian visual display of annotated sequence can serve as a convenient graphical user interface for computerized representation, analysis, and query of information stored electronically. For such use, the individual nucleotides can conveniently be linked to the X axis coordinate of rectangle 89. This permits the annotated sequence at any point within rectangle 89 readily to be viewed, either automatically-for example, by time-delayed appearance of a small overlaid window upon movement of a cursor or other pointer over rectangle 89-or through user intervention, as by clicking a mouse or other pointing device at a point in rectangle 89.

Visual display 80 is generated after user specification of the genomic sequence to be displayed.

Such specification can consist of or include an accession number for a single clone (e. g., a single BAC accessioned into GenBank), wherein the starting and stopping nucleotides are thus absolutely identified, or alternatively can consist of or include an anchor or fulcrum point about which a chosen range of sequence is anchored, thus providing relative endpoints for the sequence to be displayed. For example, the user can anchor such a range about a given chromosomal map location, gene name, or even a sequence returned by query for similarity

or identity to an input query sequence. When visual display 80 is used as a graphical user interface to computerized data, additional control over the first and last displayed nucleotide will typically be dynamically selectable, as by use of standard zooming and/or selection tools.

Field 81 of visual display 80 is used to present the output from process 200, that is, to present the bioinformatic prediction of those sequences having the desired function within the genomic sequence. Functional sequences are typically indicated by at least one rectangle 83 (83a, 83b, 83c), the left and right borders of which respectively indicate, by their X-axis coordinates, the starting and ending nucleotides of the region predicted to have function.

Where a single bioinformatic method or approach identifies a plurality of regions having the desired function, a plurality of rectangles 83 is disposed horizontally in field 81. Where multiple methods and/or approaches are used to identify function, each such method and/or approach can be represented by its own series of horizontally disposed rectangles 83, each such horizontally disposed series of rectangles offset vertically from those representing the results of the other methods and approaches.

Thus, rectangles 83a in FIG. 3 represent the functional predictions of a first method of a first approach for predicting function, rectangles 83b represent the functional predictions of a second method and/or second approach for predicting that function, and rectangles 83c represent the predictions of a third method and/or approach.

Where the function desired to be identified is protein coding, field 81 is used to present the bioinformatic prediction of sequences encoding protein.

For example, rectangles 83a can represent the results from GRAIL or GRAIL II, rectangles 83b can represent the results from GENEFINDER, and rectangles 83c can represent the results from DICTION.

Optionally, and preferably, rectangles 83 collectively representing predictions of a single method and/or approach are identically colored and/or textured, and are distinguishable from the color and/or texture used for a different method and/or approach.

Alternatively, or in addition, the color, hue, density, or texture of rectangles 83 can be used further to report a measure of the bioinformatic reliability of the prediction. For example, many gene prediction programs will report a measure of the reliability of prediction.

Thus, increasing degrees of such reliability can be indicated, e. g., by increasing density of shading. Where display 80 is used as a graphical user interface, such measures of reliability, and indeed all other results output by the program, can additionally or alternatively be made accessible through linkage from individual rectangles 83, as by time-delayed window ("tool tip"window), or by pointer (e. g., mouse)-activated link.

As earlier described, increased predictive reliability can be achieved by requiring consensus among methods and/or approaches to determining function. Thus, field 81 can include a horizontal series of rectangles 83 that indicate one or more degrees of consensus in predictions of function.

Although FIG. 3 shows three series of horizontally disposed rectangles in field 81, display 80 can include as few as one such series of rectangles and as many as can discriminably be displayed, depending upon the number of methods and/or approaches used to predict a given function.

Furthermore, field 81 can be used to show

predictions of a plurality of different functions.

However, the increased visual complexity occasioned by such display makes more useful the ability of the user to select a single function for display. When display 80 is used as a graphical user interface for computer query and analysis, such function can usefully be indicated and user- selectable, as by a series of graphical buttons or tabs (not shown in FIG. 3).

Rectangle 89 is shown in FIG. 3 as including interposed rectangle 84. Rectangle 84 represents the portion of annotated sequence for which predicted functional information has been assayed physically, with the starting and ending nucleotides of the assayed material indicated by the X axis coordinates of the left and right borders of rectangle 84. Rectangle 85, with optional inclusive circles 86 (86a, 86b, and 86c) displays the results of such physical assay.

Although a single rectangle 84 is shown in FIG.

3, physical assay is not limited to just one region of annotated genomic sequence. It is expected that an increasing percentage of regions predicted to have function by process 200 will be assayed physically, and that display 80 will accordingly, for any given genomic sequence, have an increasing number of rectangles 84 and 85, representing an increased density of sequence annotation.

Where the function desired to be identified is protein coding, rectangle 84 identifies the sequence of the probe used to measure expression. In embodiments of the present invention where expression is measured using genome-derived single exon microarrays, rectangle 84 identifies the sequence included within the probe immobilized on the support surface of the microarray. As noted supra, such probe will often include a small amount of additional, synthetic, material incorporated during amplification and designed to permit reamplification of the

probe, which sequence is typically not shown in display 80.

Rectangle 87 is used to present the results of bioinformatic assay of the genomic sequence. For example, where the function desired to be identified is protein coding, process 400 can include bioinformatic query of expression databases with the sequences predicted in process 200 to encode exons. And as earlier discussed, because bioinformatic assay presents fewer constraints than does physical assay, often the entire output of process 200 can be used for such assay, without further subsetting thereof by process 300. Therefore, rectangle 87 typically need not have separate indicators therein of regions submitted for bioinformatic assay ; that is, rectangle 87 typically need not have regions therein analogous to rectangles 84 within rectangle 89.

Rectangle 87 as shown in FIG. 3 includes smaller rectangles 880 and 88. Rectangles 880 indicate regions that returned a positive result in the bioinformatic assay, with rectangles 88 representing regions that did not return such positive results. Where the function desired to be predicted and displayed is protein coding, rectangles 880 indicate regions of the predicted exons that identify sequence with significant similarity in expression databases, such as EST, SNP, SAGE databases, with rectangles 88 indicating genes novel over those identified in existing expression data bases.

Rectangles 880 can further indicate, through color, shading, texture, or the like, additional information obtained from bioinformatic assay.

For example, where the function assayed and displayed is protein coding, the degree of shading of rectangles 880 can be used to represent the degree of sequence similarity found upon query of expression databases. The number of levels of discrimination can be as few as two (identity, and similarity, where similarity

has a user-selectable lower threshold). Alternatively, as many different levels of discrimination can be indicated as can visually be discriminated.

Where display 80 is used as a graphical user interface, rectangles 880 can additionally provide links directly to the sequences identified by the query of expression databases, and/or statistical summaries thereof.

As with each of the precedingly-discussed uses of display 80 as a graphical user interface, it should be understood that the information accessed via display 80 need not be resident on the computer presenting such display, which often will be serving as a client, with the linked information resident on one or more remotely located servers.

Rectangle 85 displays the results of physical assay of the sequence delimited by its left and right borders.

Rectangle 85 can consist of a single rectangle, thus indicating a single assay, or alternatively, and increasingly typically, will consist of a series of rectangles (85a, 85b, 85c) indicating separate physical assays of the same sequence.

Where the function assayed is gene expression, and where gene expression is assayed as herein described using simultaneous two-color fluorescent detection of hybridization to genome-derived single exon microarrays, individual rectangles 85 can be colored to indicate the degree of expression relative to control. Conveniently, shades of green can be used to depict expression in the sample over control values, and shades of red used to depict expression less than control, corresponding to the spectra of the Cy3 and Cy5 dyes conventionally used for respective labeling thereof. Additional functional information can be provided in the form of circles 86 (86a, 86b, 86c), where the diameter of the circle can be used to

indicate expression intensity. As discussed infra, such relative expression (expression ratios) and absolute expression (signal intensity) can be expressed using normalized values.

Where display 80 is used as a graphical user interface, rectangle 85 can be used as a link to further information about the assay. For example, where the assay is one for gene expression, each rectangle 85 can be used to link to information about the source of the hybridized mRNA, the identity of the control, raw or processed data from the microarray scan, or the like.

FIG. 4 is rendition of displey 80 representing gene prediction and gene expression for a hypothetical BAC, showing conventions used in the Examples presented infra.

BAC sequence ("Chip seq.") 89 is presented, with the physically assayed region thereof (corresponding to rectangle 84 in FIG. 3) shown in white. Algorithmic gene predictions are shown in field 81, with predictions by GRAIL shown, predictions by GENEFINDER, and predictions by DICTION shown. Within rectangle 87, regions of sequence that, when used to query expression databases, return identical or similar sequences ("EST hit") are shown as white rectangles (corresponding to rectangles 880 in FIG.

3), gray indicates low homology, and black indicates unknowns (where black and gray would correspond to rectangles 88 in FIG. 3).

Although FIGS. 3 and 4 show a single stretch of sequence, uninterrupted from left to right, longer sequences are usefully represented by vertical stacking of such individual Mondrians, as shown in FIGS. 9 and 10.

Single Exon Probes Useful For Measuring Gene Expression The methods and apparatus of the present invention rapidly produce functional information from

genomic sequence. Where the function to be identified is protein coding, the methods and apparatus of the present invention rapidly identify and confirm the expression of portions of genomic sequence that function to encode protein. As a direct result, the methods and apparatus of the present invention rapidly yield large numbers of single-exon nucleic acid probes, the majority from previously unknown genes, each of which is useful for measuring and/or surveying expression of a specific gene in one or more tissues or cell types.

It is, therefore, another aspect of the present invention to provide genome-derived single exon nucleic acid probes useful for gene expression analysis, and particularly for gene expression analysis by microarray.

Using the methods and genome-derived single-exon microarrays of the present invention, we have for example readily identified a large number of unique ORFs from human genomic sequence. Using single exon probes that encompass these ORFs, we have demonstrated, through microarray hybridization analysis, the expression of 13, 109 of these ORFs in adult liver.

As would immediately be appreciated by one of skill in the art, each single exon probe having demonstrable expression in adult liver is currently available for use in measuring the level of its ORF's expression in adult liver.

Diseases of the liver are a significant cause of human morbidity and mortality. Increasingly, genetic factors are being found that contribute to predisposition, onset, and/or aggressiveness of most, if not all, of these diseases ; although causative mutations in single genes have been identified for some, these disorders are believed for the most part to have polygenic etiologies.

For example, cirrhosis is a major public health problem. In the industrialized world, it is among the top

ten causes of death ; among patients aged 45 to 65, it is the third leading cause of death. The high prevalence is largely the result of alcohol abuse, but other major contributors include chronic hepatitis, biliary disease and iron overload. Approximately 10-15% are cryptogenic.

Cirrhosis is a broad description encompassing the common end stage of many forms of liver injury. Many patients with cirrhosis will remain asymptomatic for years, while others show generalized weakness, anorexia, malaise, and weight loss or, occasionally, more severe symptoms.

The progression from fibrosis, an early consequence of liver disease, to cirrhosis, and the specific histologic morphology that characterizes cirrhosis depend on the extent of injury, the presence of continuing damage, and the response of the liver to damage. The liver may be injured acutely and severely (e. g. necrosis with hepatitis), moderately over months or years (e. g. biliary tract obstruction and chronic active hepatitis), or modestly but continuously (e. g. alcohol abuse).

During the repair process, new vessels connecting the hepatic artery and portal vein to the hepatic venules form within the fibrous sheath that surrounds the surviving nodules of liver cells. These vessels restore the intrahepatic circulatory pathway, but provide relatively low-volume, high-pressure drainage that is less efficient than normal and results in increased portal vein pressure (portal hypertension). Thus, cirrhosis is not static and its features depend on the disease activity and stage.

As cirrhosis is the end stage of many forms of liver disease, many genes have been identified that can contribute to the development of cirrhosis. These include, e. g., the genes responsible for Wilson disease (Online Mendelian Inheritance of Man ("OMIM") 277900), type IV glycogen storage disease (OMIM 232500), galactosemia (OMIM

230400), and a deficiency of alpha-1-antitrypsin (OMIM 107400). There is substantial evidence, however, for as yet uncharacterized loci which cause cirrhosis.

For example, Iber and Maddrey, Prog. Liver Dis.

2 : 290-302 (1965), reviewed 13 previously reported families and 8 new to this study, each with 2 or more affected members. They pointed out that, with a single exception, the multiple cases were in the same generation. Within a given family, the age of onset, clinical course, and biopsy findings were very similar, but there were wide differences between families.

Kalra et al., Hum. Hered. 32 : 170-175 (1982) studied the families of 220 cases of Indian childhood cirrhosis and 70 families of age-matched controls. The hypotheses of autosomal recessive, partial sex-linkage, and doubly recessive inheritance were found untenable and the authors concluded that multifactorial inheritance was most plausible. Lefkowitch et al., New Eng. J. Med. 307 : 271-277 (1982) described 4 white American sibs who died between ages 4. 5 and 6 years of cirrhosis that closely resembled that of the childhood cirrhosis of Asiatic Indians.

Another example of uncharacterized loci which cause cirrhosis are those related to the risk of alcoholism.

Cloninger, Science 236 : 410-416 (1987), defined two separate types of alcoholism. According to these definitions, type 1 alcohol abuse has its usual onset after the age of 25 years and is characterized by severe psychological dependence and guilt. Type 1 occurs in both men and women and requires both genetic and environmental factors to become manifest. By contrast, type 2 alcohol abuse has its onset before the age of 25 ; persons with this type of alcoholism are characterized by their inability to abstain from alcohol and by frequent aggressive and antisocial behavior. Type 2 alcoholism is rarely found in

women and is much more heritable.

Despite considerable effort to identify genes related to the risk of alcoholism, relatively few genes have been identified. Some of this work has suggested a relationship between the metabolism of dopamine and alcoholism. Blum et al., J. A. M. A. 263 : 2055-2060 (1990) and Bolos et al., J. A. M. A. 264 : 3156-3160 (1990) investigated the relationship of the dopamine D2 receptor (DRD2 ; OMIM 126450) to alcoholism, but the sample size was small and their results were inconclusive. However, Tiihonen et al., Molec. Psychiat. 4, 286-289 (1999), found a markedly higher frequency in a population of type 1 alcoholics of the low activity allele of the enzyme catechol-0-methyltransferase (COMT, OMIM 116790), which has a crucial role in the metabolism of dopamine, suggesting a role for dopamine metabolism in increased risk of alcoholism. For a brief review of recent progress toward the identification of genes related to risk for alcoholism see Buck, Genome 9 : 927-928 (1998).

As another example, multiple genes have been shown to predispose to hyperlipoproteinemia or hyperlipidemia. Much attention has been focused on these disorders because there is a strong association of hyperlipidemia, especially hypercholesterolemia, with development of coronary artery disease. Coronary artery disease accounts for at least 25% of all deaths in the United States. Coronary artery disease results when the arteries supplying the heart muscle become occluded by plaques composed of lipids like cholesterol, blood clotting components and blood cells.

The major plasma lipids circulate bound to proteins as macromolecular complexes called lipoproteins.

Although closely interrelated, the major lipoprotein classes-chylomicron, very-low-density lipoprotein (VLDL), low-density lipoprotein (LDL), and high-density lipoprotein

(HDL)-are usually classified in terms of physicochemical properties (e. g., density after centrifugation).

Chylomicrons, the largest lipoproteins, carry exogenous triglyceride from the intestine via the thoracic duct to the venous system and into peripheral sites. VLDL carries endogenous triglyceride primarily from the liver to the same peripheral sites for storage or use. Lipases quickly degrade the triglyceride in VLDL to produce intermediate density lipoproteins (IDL) and within 2 to 6 h, IDL is degraded further to generate LDL, which has a plasma half- life of 2 to 3 days. While the overall fate of LDL is unclear, the liver is responsible for removing approximately 70% and active receptor sites have been found on the surfaces of hepatocytes.

Several monogenic conditions that lead to elevated levels of one or more serum lipoproteins have been defined and the responsible gene identified, including, e. g., hyperlipoproteinemia type I (OMIM 238600), familial hypercholesterolemia (OMIM 143890), and familial defective apolipoprotein B (OMIM 107730). However, in many cases the etiology is unknown and there is strong evidence for additional uncharacterized loci.

For example, Zuliani et al., Arterioscler.

Thromb. Vasc. Biol. 19 : 802-809 (1999) identified a Sardinian family with a recessive form of hypercholesterolemia with the clinical features of familial hypercholesterolemia (OMIM 603813), and found that previously identified genes were not responsible for this disorder. They proposed that in this new lipid disorder, a recessive defect causes a selective impairment of the LDL receptor function in the liver. Ciccarese et al., Am. J.

Hum. Genet. 66 : 453-460 (2000) recently mapped this novel disease locus.

Another example is designated familial combined hyperlipidemia (OMIM 144250) which affects approximately 1-

2% of the population in the Western world. This disorder can have its basis in mutation in several novel genes, two of which have been mapped to chromosome 1 (Pajukanta et al., Nature Genet. 18 : 369-373 (1998)) and chromosome 11 (Aouizerat et al., Am. J. Hum. Genet. 65, 397-412 (1999)).

The high frequency of this disorder suggests that most, if not all, hyperlipidemias are of multifactorial genetic etiology.

As yet a further example, primary schlerosing cholangitis (PSC) is a disorder characterized by a patchy obliterative inflammatory fibrosis of the large bile ducts.

Chronic inflammation leads to extensive bile duct strictures, cholestasis, and gradual progression to biliary cirrhosis. PSC occurs most often in young men and is commonly associated with inflammatory bowel disease, especially ulcerative colitis. The onset is usually insidious, with gradual, progressive fatigue, pruritus, and jaundice. There is no specific therapy for sclerosing cholangitis, and liver transplantation is the only apparent cure.

The etiology of PSC is not known, but both genetic and immunologic abnormalities have been implicated.

However, the frequency of HLA-B8 and HLA-DT2, which are associated with a number of autoimmune diseases, is higher in PSC than normal individuals. Prochazka et al., New Eng.

J. Med. 322 : 1842-1844 (1990) found that 100% of 29 patients with primary sclerosing cholangitis carried the HLA-DRw52a antigen, which is normally present in 35% of the population.

As a still further example, sarcoidosis is a disease of unknown cause characterized by non-caseating granulomas in one or more organ systems. These granulomas may resolve completely or proceed to fibrosis. The disorder is systemic, but the liver is affected in approximately 75% of cases. Sarcoidosis occurs mainly in persons aged 20 to

40 yr and is most common in Northern Europeans and American blacks. The lifetime risk of developing sarcoidosis is particularly high among Swedish men (1. 15%), Swedish women (1. 6%), and African Americans (2. 4%).

The much greater frequency in African Americans relative to the United States population overall suggests a genetic contribution to etiology. Early research studying familial aggregation indicated that the disease may have a nongenetic basis because the family pattern did not conform to a simple Mendelian mode of inheritance (Allison, Sth.

Med. J. 57 : 27-32 (1964)). However, Headings et al., Ann.

N. Y. Acad. Sci. 278 : 377-385 (1976) favored multifactorial genetic inheritance of susceptibility. Nowack et al., Arch. Intern. Med. 147 : 481-483 (1987), found an unusually high frequency of HLA-DR5 in a study of 440 patients with sarcoidosis in Marburg, Germany. They also concluded that the role of an environmental or infectious agent triggering sarcoidosis cannot be envisaged without considering genetically linked cofactors.

Other significant diseases of liver are also believed to have a genetic, typically polygenic, etiologic component. These diseases include, e. g., primary biliary cirrhosis, Zellweger syndrome, cholestasis-lymphedema syndrome, Alstrom syndrome, primary pulmonary hypertension, Berardinelli-Seip congenital lipodystrophy, iron overload in Africa, neonatal cholestatic hepatitis, autosomal recessive KID syndrome, familial hypotransferrinemia, type I congenital dyserythropoietic anemia, porphyria variegata, Finnish lactic acidosis with hepatic hemosiderosis, Rotor syndrome, essential hypertension, ARC syndrome, type II conjugated hyperbilirubinemia, Lambert syndrome, ichthyosis congenita with biliary atresia, Kabuki make-up syndrome, Meckel syndrome, cerebral aneurysm-cirrhosis syndrome, glycogen storage diseases, polycystic kidney and hepatic disease,

isolated Caroli disease, trisomy 18-like syndrome, Osler- Rendu-Weber syndrome 3, fatal intrahepatic cholestasis, Coach syndrome, type C Niemann-Pick disease, and hepatocellular cancer.

Altered responses to a variety of infectious agents that target the liver, especially acute viral hepatitis, have also been shown or are suspected to have genetic bases or contributions. In addition to differential susceptibility to primary infectious agents, these altered responses include predisposition to complicating conditions following contact with particular infectious agents. These include, e. g., development of hepatocellular carcinoma 2 correlated with Hepatitis B infection, and severe hepatic fibrosis following Schistosoma mansoni infection.

The central role of the liver in drug metabolism results in exposure of this organ to a large variety of potentially toxic chemical agents and metabolites. These include naturally occurring plant alkaloids and mycotoxins, industrial chemicals, and, additionally, pharmacologic agents used in treating disease. The range of manifestations of toxin-and drug-induced liver disease are virtually as broad as the range of acute and chronic disorders and have also been shown or suspected to have genetic bases or contributions.

Such interactions between drugs and genotype have been shown in the response, e. g., to the anticonvulsant phenytoin, which can cause severe hepatitis-like disease in individuals who are impaired in the ability to detoxify a metabolite of phenytoin in the liver, and in the response to the drug sodium valproate, which can produce severe hepatotoxicity in certain individuals. The abnormal responses'to both of these drugs are believed to be influenced by underlying genetic factors.

The human genome-derived single exon nucleic acid

probes and microarrays of the present invention are useful for predicting, diagnosing, grading, staging, monitoring and prognosing diseases of human liver, particularly those diseases with polygenic etiology. With each of the single exon probes described herein shown to be expressed at detectable levels in human liver, and with about 2/3 of the probes identifying novel genes, the single exon microarrays of the present invention provide exceptionally high informational content for such studies.

For example, diagnosis (including differential diagnosis among clinically indistinguishable disorders, such as cirrhosis), staging, and/or grading of a disease can be based upon the quantitative relatedness of a patient gene expression profile to one or more reference expression profiles known to be characteristic of a given liver disease, or to specific grades or stages thereof.

In one embodiment, the patient gene expression profile is generated by hybridizing nucleic acids obtained directly or indirectly from transcripts expressed in the patient's liver to the genome-derived single exon microarray of the present invention. Reference profiles are obtained similarly, using nucleic acids obtained directly or indirectly from transcripts expressed by liver of individuals with known liver disease. Methods for quantitatively relating gene expression profiles, without regard to the function of the protein encoded by the gene, are disclosed in WO 99/58720, incorporated herein by reference in its entirety.

In another approach, the genome-derived single exon probes and microarrays of the present invention can be used to interrogate genomic DNA, rather than pools of expressed message ; this latter approach permits predisposition to and/or prognosis of liver disease to be assessed through the massively parallel determination of altered copy number, deletion, or mutation in the patient's

genome of exons known to be expressed in human liver. The algorithms set forth in WO 99/58720 can be applied to such genomic profiles without regard to the function of the protein encoded by the interrogated gene.

The utility is specific to the probe ; at sufficiently high hybridization stringency, which stringencies are well known in the art-see Ausubel et al. and Maniatis et al.-each probe reports the level of expression of message specifically containing that ORF.

It should be appreciated, however, that the probes of the present invention, for which expression in the adult liver has been demonstrated are useful for both measurement in the adult liver and for survey of expression in other tissues.

Significant among such advantages is the presence of probes for novel genes.

As mentioned above and further detailed in Examples 1 and 2, the methods described enable ORFs which are not present in existing expression databases to be identified. And the fewer the number of tissues in which the ORF can be shown to be expressed, the more likely the ORF will prove to be part of a novel gene : as further discussed in Example 2, ORFs whose expression was measurable in only a single of the tested tissues were represented in existing expression databases at a rate of only 11%, whereas 36% of ORFs whose expression was measurable in 9 tissues were present in existing expression databases, and fully 45% of those ORFs expressed in all ten tested tissues were present in existing expressed sequence databases. I Either as tools for measuring gene expression or tools for surveying gene expression, the genome-derived single exon probes of the present invention have significant advantages over the cDNA or EST-based probes that are currently available for achieving these utilities.

The genome-derived single exon probes of the present invention are useful in constructing genome-derived single exon microarrays ; the genome-derived single exon microarrays, in turn, are useful devices for measuring and for surveying gene expression in the human.

Gene expression analysis using microarrays- conventionally using microarrays having probes derived from expressed message-is well-established as useful in the biological research arts (see Lockhart et al. Nature 405, 827-836).

Microarrays have been used to determine gene expression profiles in cells in response to drug treatment (see, for example, Kaminski et al.,"Global Analysis of Gene Expression in Pulmonary Fibrosis Reveals Distinct Programs Regulating Lung Inflammation and Fibrosis,"Proc.

Natl. Acad. Sci. USA 97 (4) : 1778-83 (2000) ; Bartosiewicz et al.,"Development of a Toxicological Gene Array and Quantitative Assessment of This Technology,"Arch. Biochem.

Biophys. 376 (1) : 66-73 (2000)), viral infection (see for example, Geiss et al.,"Large-scale Monitoring of Host Cell Gene Expression During HIV-1 Infection Using cDNA Microarrays,"Virology 266 (1) : 8-16 (2000)) and during cell processes such as differentiation, senescence and apoptosis (see, for example, Shelton et al.,"Microarray Analysis of Replicative Senescence,"Curr. Biol. 9 (17) : 939-45 (1999) ; Voehringer et al.,"Gene Microarray Identification of Redox and Mitochondrial Elements That Control Resistance or Sensitivity to Apoptosis,"Proc. Natl. Acad. Sci. USA 97 (6) : 2680-5 (2000)).

Microarrays have also been used to determine abnormal gene expression in diseased tissues (see, for example, Alon et al.,"Broad Patterns of Gene Expression Revealed by Clustering Analysis of Tumor and Normal Colon Tissues Probed by Oligonucleotide Arrays,"Proc. Matl.

Acad. Sci. USA 96 (12) : 6745-50 (1999) ; Perou et al.,

"Distinctive Gene Expression Patterns in Human Mammary Epithelial Cells and Breast Cancers, Proc. Natl. Acad. Sci.

USA 96 (16) : 9212-7 (1999) ; Wang et al.,"Identification of Genes Differentially Over-expressed in Lung Squamous Cell Carcinoma Using Combination of cDNA Subtraction and Microarray Analysis,"Oncogene 19 (12) : 1519-28 (2000) ; Whitney et al.,"Analysis of Gene Expression in Multiple Sclerosis Lesions Using cDNA Microarrays,"Ann. Neurol.

46 (3) : 425-8 (1999)), in drug discovery screens (see, for example, Scherf et al.,"A Gene Expression Database for the Molecular Pharmacology of Cancer,"Nat. Genet. 24 (3) : 236-44 (2000)) and in diagnosis to determine appropriate treatment strategies (see, for example, Sgroi et al.,"In vivo Gene Expression Profile Analysis of Human Breast Cancer Progression,"Cancer Res. 59 (22) : 5656-61 (1999)).

In microarray-based gene expression screens of pharmacological drug candidates upon cells, each probe provides specific useful data. In particular, it should be appreciated that even those probes that show no change in expression are as informative as those that do change, serving, in essence, as negative controls.

For example, where gene expression analysis is used to assess toxicity of chemical agents on cells, the failure of the agent to change a gene's expression level is evidence that the drug likely does not affect the pathway of which the gene's expressed protein is a part.

Analogously, where gene expression analysis is used to assess side effects of pharmacological agents-whether in lead compound discovery or in subsequent screening of lead compound derivatives-the inability of the agent to alter a gene's expression level is evidence that the drug does not affect the pathway of which the gene's expressed protein is a part.

WO 99/58720 provides methods for quantifying the relatedness of a first and second gene expression profile

and for ordering the relatedness of a plurality of gene expression profiles. The methods so described permit useful information to be extracted from a greater percentage of the individual gene expression measurements from a microarray than methods previously used in the art.

Other uses of microarrays are described in Gerhold et al., Trends Biochem. Sci. 24 (5) : 168-173 (1999) and Zweiger, Trends Biotechnol. 17 (11) : 429-436 (1999) ; Schena et al.

The invention particularly provides genome- derived single-exon probes known to be expressed in adult liver. The individual single exon probes can be provided in the form of substantially isolated and purified nucleic acid, typically, but not necessarily, in a quantity sufficient to perform a hybridization reaction.

Such nucleic acid can be in any form directly hybridizable to the message that contains the probe's ORF, such as double stranded DNA, single-stranded DNA complementary to the message, single-stranded RNA complementary to the message, or chimeric DNA/RNA molecules so hybridizable. The nucleic acid can alternatively or additionally include either nonnative nucleotides, alternative internucleotide linkages, or both, so long as complementary binding can be obtained. For example, probes can include phosphorothioates, methylphosphonates, morpholino analogs, and peptide nucleic acids (PNA), as are described, for example, in U. S. Patent Nos. 5, 142, 047 ; 5, 235, 033 ; 5, 166, 315 ; 5, 217, 866 ; 5, 184, 444 ; 5, 861, 250.

Usefully, however, such probes are provided in a form and quantity suitable for amplification, where the amplified product is thereafter to be used in the hybridization reactions that probe gene expression.

Typically, such probes are provided in a form and quantity suitable for amplification by PCR or by other well known amplification technique. One such technique additional to

PCR is rolling circle amplification, as is described, inter alia, in U. S. Patent Nos. 5, 854, 033 and 5, 714, 320 and international patent publications WO 97/19193 and WO 00/15779. As is well understood, where the probes are to be provided in a form suitable for amplification, the range of nucleic acid analogues and/or internucleotide linkages will be constrained by the requirements and nature of the amplification enzyme.

Where the probe is to be provided in form suitable for amplification, the quantity need not be sufficient for direct hybridization for gene expression analysis, and need be sufficient only to function as an amplification template, typically at least about 1, 10 or 100 pg or more.

Each discrete amplifiable probe can also be packaged with amplification primers, either in a single composition that comprises probe template and primers, or in a kit that comprises such primers separately packaged therefrom. As earlier mentioned, the ORF-specific 5'primers used for genomic amplification can have a first common sequence added thereto, and the ORF-specific 3' primers used for genomic amplification can have a second, different, common sequence added thereto, thus permitting, in this embodiment, the use of a single set of 5'and 3' primers to amplify any one of the probes. The probe composition and/or kit can also include buffers, enzyme, etc., required to effect amplification.

As mentioned earlier, when intended for use on a genome-derived single exon microarray of the present invention, the genome-derived single exon probes of the present invention will typically average at least about 100, 200, 300, 400 or 500 bp in length, including (and typically, but not necessarily centered about) the ORF.

Furthermore, when intended for use on a genome-derived single exon microarray of the present invention, the

genome-derived single exon probes of the present invention will typically not contain a detectable label.

When intended for use in solution phase hybridization, however-that is, for use in a hybridization reaction in which the probe is not first bound to a support substrate (although the target may indeed be so bound)-length constraints that are imposed in microarray-based hybridization approaches will be relaxed, and such probes will typically be labeled.

In such case, the only functional constraint that dictates the minimum size of such probe is that each such probe must be capable of specifically identifying in a hybridization reaction the exon from which it is drawn. In theory, a probe of as little as 17 nucleotides is capable of uniquely identifying its cognate sequence in the human genome. For hybridization to expressed message-a subset of target sequence that is much reduced in complexity as compared to genomic sequence-even fewer nucleotides are required for specificity.

Therefore, the probes of the present invention can include as few as 20, 25 or 50 bp or ORF, or more. In particular embodiments, the ORF sequences are given in SEQ ID NOS. 13, 110-25, 995, respectively, for probe SEQ ID NOS. 1-13, 109. The minimum amount of ORF required. to be included in the probe of the present invention in order to provide specific signal in either solution phase or microarray-based hybridizations can readily be determined for each of ORF SEQ ID NOS. 13, 110-25, 995 individually by routine experimentation using standard high stringency conditions.

Such high stringency conditions are described, inter alia, in Ausubel et al. and Maniatis et al. For microarray-based hybridization, standard high stringency conditions can usefully be 50% formamide, 5X SSC, 0. 2 ug/ul poly (dA), 0. 2 ug/ul human Coti DNA, and 0. 5 % SDS, in a

humid oven at 42°C overnight, followed by successive washes of the microarray in 1X SSC, 0. 2% SDS at 55°C for 5 minutes, and then 0. 1X SSC, 0. 2% SDS, at 55°C for 20 minutes. For solution phase hybridization, standard high stringency conditions can usefully be aqueous hybridization at 65°C in 6X SSC. Lower stringency conditions, suitable for cross-hybridization to mRNA encoding structurally-and functionally-related proteins, can usefully be the same as the high stringency conditions but with reduction in temperature for hybridization and washing to room temperature (approximately 25°C).

When intended for use in solution phase hybridization, the maximum size of the single exon probes of the present invention is dictated by the proximity of . other expressed exons in genomic DNA : although each single exon probe can include intergenic and/or intronic material contiguous to the ORF in the human genome, each probe of the present invention will include portions of only one expressed exon.

Thus, each single exon probe will include no more than about 25 kb of contiguous genomic sequence, more typically no more than about 20 kb of contiguous genomic sequence, more usually no more than about 15 kb, even more usually no more than about 10 kb. Usually, probes that are maximally about 5 kb will be used, more typically no more than about 3 kb.

It will be appreciated that the Sequence Listing appended hereto presents, by convention, only that strand of the probe and ORF sequence that can be directly translated reading from 5'to 3'end. As would be well understood by one of skill in the art, single stranded probes must be complementary in sequence to the ORF as present in an mRNA ; it is well within the skill in the art to determine such complementary sequence. It will further be understood that double stranded probes can be used in

both solution-phase hybridization and microarray-based hybridization if suitably denatured.

Thus, it is an aspect of the present invention to provide single-stranded nucleic acid probes that have sequence complementary to those described herein above and below, and double-stranded probes one strand of which has sequence complementary to the probes described herein.

The probes can, but need not, contain intergenic and/or intronic material that flanks the ORF, on one or both sides, in the same linear relationship to the ORF that the intergenic and/or intronic material bears to the ORF in genomic DNA. The probes do not, however, contain nucleic acid derived from more than one expressed ORF.

And when intended for use in solution hybridization, the probes of the present invention can usefully have detectable labels. Nucleic acid labels are well known in the art, and include, inter alia, radioactive labels, such as'H, P, P, S, 1,"1 ; fluorescent labels, such as Cy3, Cy5, Cy5. 5, Cy7, SYBR" Green, and other labels described in Haugland, Handbook of Fluorescent Probes and Research Chemicals, 7th ed., Molecular Probes Inc., Eugene, OR (2000), or r fluorescence resonance energy transfer tandem conjugates thereof ; labels suitable for chemiluminescent and/or enhanced chemiluminescent detection ; labels suitable for ESR and NMR detection ; and-labels that include one member of a specific binding pair, such as biotin, digoxigenin, or the like.

The probes, either in quantity sufficient for hybridization or sufficient for amplification, can be provided in individual vials or containers.

Alternatively, such probes can usefully be packaged as a plurality of such individual genome-derived single exon probes.

When provided as a collection of plural

individual probes, the probes are typically made available in amplifiable form in a spatially-addressable ordered set, typically one per well of a microtiter dish. Although a 96 well microtiter plate can be used, greater efficiency is obtained using higher density arrays.

If, as earlier mentioned, the ORF-specific 5'primers used for genomic amplification had a first common sequence added thereto, and the ORF-specific 3' primers used for genomic amplification had a second, different, common sequence added thereto, a single set of 5'and 3'primers can be used to amplify all of the probes from the amplifiable ordered set.

Such collections of genome-derived single exon probes can usefully include a plurality of probes chosen for the common attribute of expression in the human adult liver.

In such defined subsets, typically at least 50, 60, 75, 80, 85, 90 or 95% or more of the probes will be chosen by their expression in the defined tissue or cell type.

The single exon probes of the present invention, as well as fragments of the single exon probes comprising selectively hybridizable portions of the probe ORF, can be used to obtain the full length cDNA that includes the ORF by (i) screening of cDNA libraries ; (ii) rapid amplification of cDNA ends ("RACE") ; or (iii) other conventional means, as are described, inter alia, in Ausubel et al. and Maniatis et al.

It is another aspect of the present invention to provide genome-derived single exon nucleic acid microarrays useful for gene expression analysis, where the term "microarray"has the meaning given in the definitional section of this description, supra.

The invention particularly provides genome- derived single-exon nucleic acid microarrays comprising a

plurality of probes known to be expressed in human adult liver. In preferred embodiments, the present invention provides human genome-derived single exon microarrays comprising a plurality of probes drawn from the group consisting of SEQ ID NOS. : 1-13, 109.

When used for gene expression analysis, the genome-derived single exon microarrays provide greater physical informational density than do the genome-derived single exon microarrays that have lower percentages of probes known to be expressed commonly in the tested tissue.

At a fixed probe density, for example, a given microarray surface area of the defined subset genome-derived single exon microarray can yield a greater number of expression measurements. Alternatively, at a given probe density, the same number of expression measurements can be obtained from a smaller substrate surface area. Alternatively, at a fixed probe density and fixed surface area, probes can be provided redundantly, providing greater reliability in signal measurement for any given probe. Furthermore, with a higher percentage of probes known to be expressed in the assayed tissue, the dynamic range of the detection means can be adjusted to reveal finer levels discrimination among the levels of expression.

Although particularly described with respect to their utility as probes of gene expression, particularly as probes to be included on a genome-derived single exon microarray, each of the nucleic acids having SEQ ID NOS. : 1 -13, 109contains an open-reading frame, set forth respectively in SEQ ID NOS. : 13, 110-25, 995, that encodes a protein domain. Thus, each of SEQ ID NOS. 1-13, 109can be used, or that portion thereof in SEQ ID NOS. 13, 110- 25, 995 used, to express a protein domain by standard in vitro recombinant techniques. See Ausubel et al. and Maniatis et al.

Additionally, kits are available commercially

that readily permit such nucleic acids to be expressed as protein in bacterial cells, insect cells, or mammalian cells, as desired (e. g., HAT Protein Expression & Purification System, ClonTech Laboratories, Palo Alto, CA ; Adeno-X Expression System, ClonTech Laboratories, Palo Alto, CA ; Protein Fusion & Purification (pMALt^) System, New England Biolabs, Beverley, MA) Furthermore, shorter peptides can be chemically synthesized using commercial peptide synthesizing equipment and well known techniques. Procedures are described, inter alia, in Chan et al. (eds.), Fmoc Solid Phase Peptide Synthesis : A Practical Approach (Practical Approach Series, (Paper)), Oxford Univ. Press (March 2000) (ISBN : 0199637245) ; Jones, Amino Acid and Peptide Synthesis (Oxford Chemistry Primers, No 7), Oxford Univ. Press (August 1992) (ISBN : 0198556683) ; and Bodanszky, Principles of Peptide Synthesis (Springer Laboratory), Springer Verlag (December 1993) (ISBN : 0387564314).

It is, therefore, another aspect of the invention to provide peptides comprising an amino acid sequence translated from SEQ ID NOS. : 13, 110-25, 995. Such amino acid sequences are set out in SEQ ID NOS : 25, 996-38, 578.

Any such recombinantly-expressed or synthesized peptide of at least 8, and preferably at least about 15, amino acids, can be conjugated to a carrier protein and used to generate antibody that recognizes the peptide. Thus, it is a further aspect of the invention to provide peptides that have at least 8, preferably at least 15, consecutive amino acids.

The following examples are offered by way of illustration and not by way of limitation.

EXAMPLE 1 Preparation of Single Exon Microarrays from ORFs Predicted

in Human Genomic Sequence Bioinformatics Results All human BAC sequences in fewer than 10 pieces that had been accessioned in a five month period immediately preceding this study were downloaded from GenBank. This corresponds to-2200 clones, totaling-350 MB of sequence, or approximately 10% of the human genome.

After masking repetitive elements using the program CROSS MATCH, the sequence was analyzed for open reading frames using three separate gene finding programs.

The three programs predict genes using independent algorithmic methods developed on independent training sets : GRAIL uses a neural network, GENEFINDER uses a hidden Markoff model, and DICTION, a program proprietary to Genetics Institute, operates according to a different heuristic. The results of all three programs were used to create a prediction matrix across the segment of genomic DNA.

The three gene finding programs yielded a range of results. GRAIL identified the greatest percentage of genomic sequence as putative coding region, 2% of the data analyzed. GENEFINDER was second, calling 1%, and DICTION yielded the least putative coding region, with 0. 8% of genomic sequence called as coding region.

The consensus data were as follows. GRAIL and GENEFINDER agreed on 0. 7% of genomic sequence, GRAIL and DICTION agreed on 0. 5% of genomic sequence, and the. three programs together agreed on 0. 25% of the data analyzed.

That is, 0. 25% of the genomic sequence was identified by all three of the programs as containing putative coding region.

ORFs predicted by any two of the three programs ("consensus ORFs") were assorted into"gene bins"using two criteria : (1) any 7 consecutive exons within a 25 kb window

were placed together in a bin as likely contributing to a single gene, and (2) all ORFs within a 25 kb window were placed together in a bin as likely contributing to a single gene if fewer than 7 exons were found within the 25 kb window.

PCR The largest ORF from each gene bin that did not span repetitive sequence was then chosen for amplification, as were all consensus ORFs longer than 500 bp. This method approximated one exon per gene ; however, a number of genes were found to be represented by multiple elements.

Previously, we had determined that DNA fragments fewer than 250 bp in length do not bind well to the amino- modified glass surface of the slides used as support substrate for construction of microarrays ; therefore, amplicons were designed in the present experiments to approximate 500 bp in length.

Accordingly, after selecting the largest ORF per gene bin, a 500 bp fragment of sequence centered on the ORF was passed to the primer picking software, PRIMER3 (available online for use at http ://www-genome. wi. mit. edu/cgi-bin/primer/). A first additional sequence was commonly added to each ORF-unique 5'primer, and a second, different, additional sequence was commonly added to each ORF-unique 3'primer, to permit subsequent reamplification of the amplicon using a single set of"universal"5'and 3'primers, thus immortalizing the amplicon. The addition of universal priming sequences also facilitates sequence verification, and can be used to add a cloning site should some ORFs be found to warrant further study.

The ORFs were then PCR amplified from genomic DNA, verified on agarose gels, and sequenced using the universal primers to validate the identity of the amplicon

to be spotted in the microarray.

Primers were supplied by Operon Technologies (Alameda, CA). PCR amplification was performed by standard techniques using human genomic DNA (Clontech, Palo Alto, CA) as template. Each PCR product was verified by SOBRE green (Molecular Probes, Inc., Eugene, OR) staining of agarose gels, with subsequent imaging by Fluorimager (Molecular Dynamics, Inc., Sunnyvale, CA). PCR amplification was classified as successful if a single band appeared.

The success rate for amplifying ORFs of interest directly from genomic DNA using PCR was approximately 75%.

FIG. 5 graphs the distribution of predicted ORF (exon) length and distribution of amplified PCR products, with ORF length shown in red and PCR product length shown in blue (which may appear black in the figure). Although the range of ORF sizes is readily seen to extend to beyond 900 bp, the mean predicted exon size was only 229 bp, with a median size of 150 bp (n=9498). With an average amplicon size of 475 25 bp, approximately 50% of the average PCR amplification product contained predicted coding region, with the remaining 50% of the amplicon containing either intron, intergenic sequence, or both.

Using a strategy predicated on amplifying about 500 bp, it was found that long exons had a higher PCR failure rate. To address this, the bioinformatics process was adjusted to amplify 1000, 1500 or 2000 bp fragments from exons larger than 500 bp. This improved the rate of successful amplification of exons exceeding 500 bp, constituting about 9. 2% of the exons predicted by the gene finding algorithms.

Approximately 75% of the probes disposed on the array (90% of those that successfully PCR amplified) were sequence-verified by sequencing in both the forward and reverse direction using MegaBACE sequencer (Molecular

Dynamics, Inc., Sunnyvale, CA), universal primers, and standard protocols.

Some genomic clones (BACs) yielded very poor PCR and sequencing results. The reasons for this are unclear, but may be related to the quality of early draft sequence or the inclusion of vector and host contamination in some submitted sequence data.

Although the intronic and intergenic material flanking coding regions could theoretically interfere with hybridization during microarray experiments, subsequent empirical results demonstrated that differential expression ratios were not significantly affected by the presence of noncoding sequence. The variation in exon size was similarly found not to affect differential expression ratios significantly ; however, variation in exon size was observed to affect the absolute signal intensity (data not shown).

The 350 MB of genomic DNA was, by the above- described process, reduced to 9750 discrete probes, which were spotted in duplicate onto glass slides using commercially available instrumentation (MicroArray GenII Spotter and/or MicroArray GenIII Spotter, Molecular Dynamics, Inc., Sunnyvale, CA). Each slide additionally included either 16 or 32 E. coli genes, the average hybridization signal of which was used as a measure of background biological noise.

Each of the probe sequences was BLASTed against the human EST data set, the NR data set, and SwissProt GenBank (May 7, 1999 release 2. 0. 9).

One third of the probe sequences (as amplified) produced an exact match (BLAST Expect ("E") values less than 1 e-100) to either an EST (20% of sequences) or a known mRNA (13% of sequences). A further 22% of the probe sequences showed some homology to a known EST or mRNA (BLAST E values from 1 e-5 to 1 e-99). The remaining 45% of

the probe sequences showed no significant sequence homology to any expressed, or potentially expressed, sequences present in public databases.

All of the probe sequences (as amplified) were then analyzed for protein similarities with the SwissProt database using BLASTX, Gish et al., Nature Genet. 3 : 266 (1993). The predicted functional breakdowns of the 2/3 of probes identical or homologous to known sequences are presented in Table 1.

Table 1 Function of Predicted ORFs As Deduced From Comparative Sequence Analysis Total V6 chip V7 chip Function Predicted from Comparative Sequence Analysis 211 96 115 Receptor 120 43 77 Zinc Finger 30 11 19 Homeobox 25 9 16 Transcription Factor 17 11 Transcription 118 57 61 Structural 95 39 56 Kinase 36 18 18 Phosphatase 83 31 52 Ribosomal 45 19 26 Transport 21 17 14 Growth Factor 17 12 5 Cytochrome 50 33 17 Channel

As can be seen, the two most common types of genes were transcription factors and receptors, making up 2. 2% and 1. 8% of the arrayed elements, respectively.

EXAMPLE 2 Gene Expression Measurements From Genome-Derived Single Exon Microarrays The two genome-derived single exon microarrays prepared according to Example 1 were hybridized in a series of simultaneous two-color fluorescence experiments to (1) Cy3-labeled cDNA synthesized from message drawn individually from each of brain, heart, liver, fetal liver, placenta, lung, bone marrow, HeLa, BT 474, or HBL 100 cells, and (2) Cy5-labeled cDNA prepared from message pooled from all ten tissues and cell types, as a control in each of the measurements. Hybridization and scanning were carried out using standard protocols and Molecular Dynamics equipment.

Briefly, mRNA samples were bought from commercial sources (Clontech, Palo Alto, CA and Amersham Pharmacia Biotech (APB)). Cy3-dCTP and Cy5-dCTP (both from APB) were incorporated during separate reverse transcriptions of 1 ug of polyp mRNA performed using 1 ug oligo (dT) 12-18 primer and 2 ug random 9mer primers as follows. After heating to 70°C, the RNA : primer mixture was snap cooled on ice. After snap cooling on ice, added to the RNA to the stated final concentration was : 1X Superscript II buffer, 0. 01 M DTT, 100jaM dATP, 100 uM dGTP, 100 uM dTTP, 50 uM dCTP, 50 uM Cy3-dCTP or Cy5-dCTP 50 uM, and 200 U Superscript II enzyme. The reaction was incubated for 2 hours at 42°C.

After 2 hours, the first strand cDNA was isolated by adding 1 U Ribonuclease H, and incubating for 30 minutes at 37°C.

The reaction was then purified using a Qiagen PCR cleanup column, increasing the number of ethanol washes to 5.

Probe was eluted using 10 mM Tris pH 8. 5.

Using a spectrophotometer, probes were measured for dye incorporation. Volumes of both Cy3 and Cy5 cDNA corresponding to 50 pmoles of each dye were then dried in a Speedvac, resuspended in 30 pi hybridization solution containing 50% formamide, 5X SSC, 0. 2 ug/ul poly (dA), 0. 2 ug/ul human Coti DNA, and 0. 5 % SDS.

Hybridizations were carried out under a coverslip, with the array placed in a humid oven at 42°C overnight. Before scanning, slides were washed in 1X SSC, 0. 2% SDS at 55°C for 5 minutes, followed by 0. 1X SSC, 0. 2% SDS, at 55°C for 20 minutes. Slides were briefly dipped in water and dried thoroughly under a gentle stream of nitrogen.

Slides were scanned using a Molecular Dynamics Gen3 scanner, as described. Schena (ed.), Microarray Biochip : Tools and Technology, Eaton Publishing Company/BioTechniques Books Division (2000) (ISBN : 1881299376).

Although the use of pooled cDNA as a reference permitted the survey of a large number of tissues, it attenuates the measurement of relative gene expression, since every highly expressed gene in the tissue/cell type- specific fluorescence channel will be present to a level of at least 10% in the control channel. Because of this fact, both signal and expression ratios (the latter hereinafter, "expression"or"relative expression") for each probe were normalized using the average ratio or average signal, respectively, as measured across the whole slide.

Data were accepted for further analysis only when signal was at least three times greater than biological noise, the latter defined by the average signal produced by the E. coli control genes.

The relative expression signal for these probes was then plotted as function of tissue or cell type, and is presented in FIG. 6.

FIG. 6 shows the distribution of expression across a panel of ten tissues. The graph shows the number of sequence-verified products that were-either not expressed ("0"), expressed in one or more but not all tested tissues ("1"-"9"), and expressed in all tissues tested ("10").

Of 9999 arrayed elements on the two microarrays (including positive and negative controls and"failed" products), 2353 (51%) were expressed in at least one tissue or cell type. Of the gene elements showing significant signal-where expression was scored as"significant"if the normalized Cy3 signal was greater than 1, representing signal 5-fold over biological noise (0. 2)-39% (991) were expressed in all 10 tissues. The next most common class (15%) consisted of gene elements expressed in only a single tissue.

The genes expressed in a single tissue were further analyzed, and the results of the analyses are compiled in FIG. 7.

FIG. 7A is a matrix presenting the expression of all verified sequences that showed expression greater than 3 in at least one tissue. Each clone is represented by a column in the matrix. Each of the 10 tissues assayed is represented by a separate row in the matrix, and relative expression of a clone in that tissue is indicated at the respective node by intensity of green shading, with the intensity legend shown in panel B. The top row of the matrix ("EST Hit") contains"bioinformatic"rather than "physical"expression data-that is, presents the results returned by query of EST, NR and SwissProt databases using the probe sequence. The legend for"bioinformatic expression" (i. e., degree of homology returned) is presented in panel C. Briefly, white is known, black is novel, with gray depicting nonidentical with significant homology (white : E values < le-100 ; gray : E values from le-

05 to le-99 ; black : E values > le-05).

As FIG. 7 readily shows, heart and brain were demonstrated to have the greatest numbers of genes that were shown to be uniquely expressed in the respective tissue. In brain, 200 uniquely expressed genes were identified ; in heart, 150. The remaining tissues gave the following figures for uniquely expressed genes : liver, 100 ; lung, 70 ; fetal liver, 150 ; bone marrow, 75 ; placenta, 100 ; HeLa, 50 ; HBL, 100 ; and BT474, 50.

It was further observed that there were many more "novel"genes among those that were up-regulated in only one tissue, as compared with those that were down-regulated in only one tissue. In fact, it was found that ORFs whose expression was measurable in only a single of the tested tissues were represented in sequencing databases at a rate of only 11%, whereas 36% of the ORFs whose expression was measurable in 9 of the tissues were present in public databases. As for those ORFs expressed in all ten tissues, fully 45% were present in existing expressed sequence databases. These results are not unexpected, since genes expressed in a greater number of tissues have a higher likelihood of being, and thus of having been, discovered by EST approaches.

Comparison of Signal from Known and Unknown Genes The normalized signal of the genes found to have high homology to genes present in the GenBank human EST database were compared to the normalized signal of those genes not found in the GenBank human EST database. The data are shown in FIG. 8.

FIG. 8 shows the normalized Cy3 signal intensity for all sequence-verified products with a BLAST Expect ("E") value of greater than le-30 (designated"unknown") upon query of existing EST, NR and SwissProt databases, and shows in blue the normalized Cy3 signal intensity for all

sequence-verified products with a BLAST Expect value of less than le-30 ("known"). Note that biological background noise has an averaged normalized Cy3 signal intensity of 0. 2.

As expected, the most highly expressed of the ORFs were"known"genes. This is not surprising, since very high signal intensity correlates with very commonly- expressed genes, which have a higher likelihood of being found by EST sequence.

However, a significant point is that a large number of even the high expressers were"unknown". Since the genomic approach used to identify genes and to confirm their expression does not bias exons toward either the 3' or 5'end of a gene, many of these high expression genes will not have been detected in an end-sequenced cDNA library.

The significant point is that presence of the gene in an EST database is not a prerequisite for incorporation into a genome-derived microarray, and further, that arraying such"unknown"exons can help to assign function to as-yet undiscovered genes.

Verification of Gene Expression To ascertain the validity of the approach described above to identify genes from raw genomic sequence, expression of two of the probes was assayed using reverse transcriptase polymerase chain reaction (RT PCR) and northern blot analysis.

Two microarray probes were selected on the basis of exon size, prior sequencing success, and tissue-specific gene expression patterns as measured by the microarray experiments. The primers originally used to amplify the two respective ORFs from genomic DNA were used in RT PCR against a panel of tissue-specific cDNAs (Rapid-Scan gene expression panel 24 human cDNAs) (OriGene Technologies,

Inc., Rockville, MD).

Sequence AL079300-1 was shown by microarray hybridization to be present in cardiac tissue, and sequence AL031734_1 was shown by microarray experiment to be present in placental tissue (data not shown). RT-PCR on these two sequences confirmed the tissue-specific gene expression as measured by microarrays, as ascertained by the presence of a correctly sized PCR product from the respective tissue type cDNAs.

Clearly, all microarray results cannot, and indeed should not, be confirmed by independent assay methods, or the high throughput, highly parallel advantages of microarray hybridization assays will be lost. However, in addition to the two RT-PCR results presented above, the observation that 1/3 of the arrayed genes exist in expression databases provides powerful confirmation of the power of our methodology-which combines bioinformatic prediction with expression confirmation using genome- derived single exon microarrays-to identify novel genes from raw genomic data.

To verify that the approach further provides correct characterization of the expression patterns of the identified genes, a detailed analysis was performed of the microarrayed sequences that showed high signal in brain.

For this latter analysis, sequences that showed high (normalized) signal in brain, but which showed very low (normalized) signal (less than 0. 5, determined to be biological noise) in all other tissues, were further studied. There were 82 sequences that fit these criteria, approximately 2% of the arrayed elements. The 10 sequences showing the highest signal in brain in microarray hybridizations are detailed in Table 2, along with assigned function, if known or reasonably predicted.

Table 2 Function of the Most Highly Expressed Genes Expressed Only in Brain Microarray Normal Expressi Homology Gene Function Sequence ized on Ratio to EST as described by Name Signal present GenBank in GenBank AP000217-1 5. 2 +7. 7 High S-100 protein, b-chain, Ca2+ binding protein expressed in central nervous system AP000047-1 2. 3 High Unknown Function AC006548-9 1. 7 High Similar to mouse membrane glyco-protein M6, expressed in central nervous system AC007245-5 1. 5 High Similar to amphiphysin, a synaptic vesicle- associated protein. Ref 21 L44140-4 1. 2 +2. 0 High Endothelial actin-binding protein found in nonmuscle filamin AC004689-9 1. 2 +3. 5 High Protein Phosphatase PP2A, neuronal/ downregulates activated protein kinases AL031657-1 1. 2 +3. 0 High Unknown function/ Contains the anhyrin motif, a common protein sequence motif AC009266-2 1. 1 +3. 7 Low Low homology to the Synaptotagmin I protein in rat/present at low levels throughout rat brain AP000086-1 1. 0 +2. 7 Low Unknown, very poor homology to collagen AC004689-3 1. 0 High Protein Phosphatase PP2A, neuronal/ downregulates activated protein kinases

Of the ten sequences studied by these latter confirmatory approaches, eight were previously known. Of these eight, six had previously been reported to be important in the central nervous system or brain. The exon

giving the highest signal (AP00217-1) was found to be the gene encoding an S100B Ca2+ binding protein, reported in the literature to be highly and uniquely expressed in the central nervous system. Heizmann, Neurochem. Res. 9 : 1097 (1997).

A number of the brain-specific probe sequences (including AC006548-9, AC009266-2) did not have homology to any known human cDNAs in GenBank but did show homology to rat and mouse cDNAs. Sequences AC004689-9 and AC004689-3 were both found to be phosphatases present in neurons (Millward et al., Trends Biochem. Sci. 24 (5) : 186-191 (1999)). Two microarray sequences, AP000047-1 and AP000086-1 have unknown function, with AP000086-1 being absent from GenBank. Functionality can now be narrowed down to a role in the central nervous system for both of these genes, showing the power of designing microarrays in this fashion.

Next, the function of the chip sequences with the highest (normalized) signal intensity in brain, regardless of expression in other tissues, was assessed. In this latter analysis, we found expression of many more common genes, since the sequences were not limited to those expressed only in brain. For example, looking at the 20 highest signal intensity spots in brain, 4 were similar to tubulin (AC00807905 ; AF146191-2 ; AC007664-4 ; AF14191-2), 2 were similar to actin (AL035701-2 ; AL034402-1), and 6 were found to be homologous to glyceraldehyde-3-phosphate dehydrogenase (GAPDH) (AL035604-1 ; Z86090-1 ; AC006064-L, AC006064-K ; AC035604-3 ; AC006064-L). These genes are often used as controls or housekeeping genes in microarray experiments of all types.

Other interesting genes highly expressed in brain were a ferritin heavy chain protein, which is reported in the literature to be found in brain and liver (Joshi et al., J. Neurol. Sci. 134 (Suppl) : 52-56 (1995)), a result

duplicated with the array. Other highly expressed chip sequences included a translation elongation factor 1E (AC007564-4), a DEAD-box homolog (AL023804-4), and a Y- chromosome RNA-binding motif (Chai et al., Genomics 49 (2) : 283-89 (1998)) (AC007320-3). A low homology analog (AP00123-1/2) to a gene, DSCR1, thought to be involved in trisomy 21 (Down's syndrome), showed high expression in both brain and heart, in agreement with the literature (Fuentes et al., Mol. Genet. 4 (10) : 1935-44 (1995)).

As a further validation of the approach, we selected the BAC AC006064 to be included on the array.

This BAC was known to contain the GAPDH gene, and thus could be used as a control for the ORF selection process.

The gene finding and exon selection algorithms resulted in choosing 25 exons from BAC AC006064 for spotting onto the array, of which four were drawn from the GAPDH gene. Table 3 shows the comparison of the average expression ratio for the 4 exons from BAC006064 compared with the average expression ratio for 5 different dilutions of a commercially available GAPDH cDNA (Clontech).

Table 3 Comparison of Expression Ratio, for each tissue, of GAPDH AC006064 (n = 4) Control (n = 5) Bone Marrow-1. 81 0. 11-1. 85 0. 08 Brain-1. 41 0. 11-1. 17 0. 05 BT474 1. 85 + 0. 09 1. 66 0. 12 Fetal Liver-1. 62 0. 07-1. 41 0. 05 HBL100 1. 32 0. 05 2. 64 + 0. 12 Heart 1. 16 + 0.. 09 1. 56 0. 10 HeLa 1. 11 0. 06 1. 30 0. 15 Liver-1. 62 + 0. 22-2. 07 Lung-4. 95 0. 93-3. 75 0. 21 | Placenta-3. 56 0. 25-3. 52 0. 43

Each tissue shows excellent agreement between the experimentally chosen exons and the control, again demonstrating the validity of the present exon mining approach. In addition, the data also show the variability of expression of GAPDH within tissues, calling into question its classification as a housekeeping gene and utility as a housekeeping control in microarray experiments.

EXAMPLE 3 Representation of Sequence and Expression Data as a "Mondrian" For each genomic clone processed for microarray as above-described, a plethora of information was accumulated, including full clone sequence, probe sequence within the clone, results of each of the three gene finding programs, EST information associated with the probe sequences, and microarray signal and expression for multiple tissues, challenging our ability to display the information.

Accordingly, we devised a new tool for visual display of the sequence with its attendant annotation which, in deference to its visual similarity to the paintings of Piet Mondrian, is hereinafter termed a "Mondrian". FIGS. 3 and 4 present the key to the information presented on a Mondrian.

FIG. 9 presents a Mondrian of BAC AC008172 (bases 25, 000 to 130, 000 shown), containing the carbamyl phosphate synthetase gene (AF154830. 1). Purple background within the region shown as field 81 in FIG. 3 indicates all 37 known

exons for this gene.

As can be seen, GRAIL II successfully identified 27 of the known exons (73%), GENEFINDER successfully identified 37 of the known exons (100%), while DICTION identified 7 of the known exons (19%).

Seven of the predicted exons were selected for physical assay, of which 5 successfully amplified by PCR and were sequenced. These five exons were all found to be from the same gene, the carbamyl phosphate synthetase gene (AF154830. 1).

The five exons were arrayed, and gene expression measured across 10 tissues. As is readily seen in the Mondrian, the five chip sequences on the array show identical expression patterns, elegantly demonstrating the reproducibility of the system.

FIG. 10 is a Mondrian of BAG AL049839. We selected 12 exons from this BAC, of which 10 successfully sequenced, which were found to form between 5 and 6 genes.

Interestingly, 4 of the genes on this BAC are protease inhibitors. Again, these data elegantly show that exons selected from the same gene show the same expression patterns, depicted below the red line. From this figure, it is clear that our ability to find known genes is very good. A novel gene is also found from 86. 6 kb to 88. 6 kb, upon which all the exon finding programs agree. We are confident we have two exons from a single gene since they show the same expression patterns and the exons are proximal to each other. Backgrounds in the following colors indicate a known gene (top to bottom) : red = kallistatin protease inhibitor (P29622) ; purple = plasma serine protease inhibitor (P05154) ; turquoise = a1 anti-chymotrypsin (P01011) ; mauve = 40S ribosomal protein (P08865). Note that chip sequence 8 and 12 did not sequence verify.

EXAMPLE 4 Genome-Derived Single Exon Probes Useful For Measuring Human Gene Expression The protocols set forth in Examples 1 and 2, supra, were applied to additional human genomic sequence as it became newly available in GenBank to identify unique exons in the human genome that could be shown to be expressed at significant levels in liver tissue.

These unique exons are within longer probe sequences. Each probe was completely sequenced on both strands prior to its use on a genome-derived single exon microarray ; sequencing confirms the exact chemical structure of each probe. An added benefit of sequencing is that it placed us in possession of a set of single base- incremented fragments of the sequenced nucleic acid, starting from the sequencing primer 3'OH. (Since the single exon probes were first obtained by PCR amplification from genomic DNA, we were of course additionally in possession of an even larger set of single base incremented fragments of each of the 13, 109 single exon probes, each fragment corresponding to an extension product from one of the two amplification primers.) The structures of the 13, 109 unique single exon probes are clearly presented in the Sequence Listing as SEQ ID Nos. : 1-13, 109. The 16 nt 5'primer sequence and 16 nt 3'primer sequence present on the amplicon are not included in the sequence listing. The sequences of the exons present within each of these probes is presented in the Sequence Listing as SEQ ID Nos. : 13, 110-25, 995, respectively. It will be noted that some amplicons have more than one exon, some exons are contained in more than one amplicon.

As detailed in Example 2, expression was

demonstrated by disposing the amplicons as single exon probes on nucleic acid microarrays and then performing two- color fluorescent hybridization analysis ; significant expression is based on a statistical confidence that the signal is significantly greater than negative biological control spots. The negative biological control is formed from spotted DNA sequences from a different species. Here, 32 sequences from E. Coli were spotted in duplicate to give a total of 64 spots.

For each hybridisation (each slide, each colour) the median value of the signal from all of the spots is determined. The normalised signal value is the arithmetic mean of the signal from duplicate spots divided by the population median.

Control spots are eliminated if there is more that a five-fold difference between each one of the duplicate spots raw signals.

The median of the signal from the remaining control spots is calculated and all subsequent calculations are done with normalised signals.

Control spots having a'signal of greater than median + 2. 4 (the value 2. 4 is roughly 12 times the observed standard deviation of control spot populations) are eliminated. Spots with such high signals are considered to be"outliers".

The mean and standard deviation of the modified control spot populations are calculated.

The mean + 3x the standard deviation (mean + (3*SD)) is used as the signal threshold qualifier for that particular hybridisation. Thus, individual thresholds are determined for each channel and each hybridisation.

This means that, assuming that the data is distributed normally, there is a 99% confidence that any signal exceeding the threshold is significant.

The probes and their expression data are

presented in Table 4, set forth respectively in Example 5.

Example 5 presents the subset of probes that is significantly expressed in the human adult liver and thus presents the subset of probes that was recognized to be useful for measuring expression of their cognate genes in human adult liver tissue.

The sequence of each of the exon probes identified by SEQ ID NOS. : 13, 110-25, 995 was individually used as a BLAST (or, for SWISSPROT, BLASTX) query to identify the most similar sequence in each of dbEST, SwissProt (BLASTX), and NR divisions of GenBank. Because the query sequences are themselves derived from genomic sequence in GenBank, only nongenomic hits from NR were scored.

The smallest in value of the BLAST (or BLASTX) expect ("E") scores for each query sequence across the three database divisions was used as a measure of the "expression novelty"of the probe's ORF. Table 4 is sorted in descending order based on this measure, reported as "Most Similar (top) Hit BLAST E Value". Those sequences for which no"Hit E Value"is listed are those exons which were found to have no similar sequences.

As sorted, Table 4 thus lists its respective probes (by"AMPLICON SEQ ID NO. :" and additionally by the SEQ ID NO :. of the exon contained within the probe :"EXON SEQ ID NO. :") from least similar to sequences known to be expressed (i. e., highest BLAST E value), at the beginning of the table, to most similar to sequences known to be expressed (i. e., lowest BLAST E value), at the bottom of the table.

Table 4 further provides, for each listed probe, the accession number of the database sequence that yielded the"Most Similar (top) Hit BLAST E Value", along with the name of the database in which the database sequence is found ("Top Hit Database Source").

Table 4 further provides SEQ ID NOS. corresponding to the predicted amino acid sequences where they have been determined for the probe and exon nucleotide sequences. These are set out as PEPTIDE SEQ ID NOS. :. The peptide sequences for a given exon are predicted as follows : Since each chip exon is a consensus sequence drawn from predictions from various exon finding programs (i. e.

Grail, GeneFinder and GenScan), the multiple initial ORFs are first determined in a uniform way according to each prediction. In particular, the reading frame for predicting the first amino acid in the peptide sequence always starts with the first base of any codon and ends with the last base of non-termination codon. Next, for each strand of the exon, initial ORFs are merged into one or more final ORFs in an exhaustive process based on the following criteria : 1) the merging ORFs must be overlapping, and 2) the merging ORFs must be in the same frame.

The Sequence Listing, which is a superset of all of the data presented in Table 4, further includes, for each probe, the most similar hit, with accession number and BLAST E value, from the each of the three queried databases.

Table 4 further lists, for each probe, a portion of the descriptor for the top hit ("Top Hit Descriptor") as provided in the sequence database. For those ORFs that are similar in sequence, but nonidentical to known sequences (e. g., those with BLAST E values between about le-05 and le-100), the descriptor reveals the likely function of the protein encoded by the probe's ORF.

Using BLAST E value cutoffs of le-05 (i. e., 1 x 10-5) and le-100 (i. e., 1 x 10-100) as evidence of similarity to sequences known to be expressed is of course arbitrary : in Example 2, supra, a BLAST E value of le-30 was used as the boundary when only two classes were to be defined for analysis (unknown, >le-30 ; known <le-30) (see also FIG. 8).

Furthermore, even when the"Most Similar (Top) Hit BLAST E Value"is low, e. g., less than about le-100-which is probative evidence that the query sequence has previously been shown to be expressed-the top hit is highly unlikely exactly to match the probe sequence.

First, such expression entries typically will not have the intronic and/or intergenic sequence present within the single exon probes listed in the Table. Second, even the ORF itself is unlikely in such cases to be present identically in the databases, since most of the EST and mRNA clones in existing databases include multiple exons, without any indication of the location of exon boundaries.

As noted, the data presented in Table 4 represent a proper subset of the data present within the attached sequence listing. For each amplicon probe (SEQ ID NOs. : 1 -13, 109) and probe exon (SEQ ID NOs. : 13, 110-25, 995, respectively), the sequence listing further provides, through iterated annotation fields <220> and <223> : (a) the accession number of the BAC from which the sequence was derived ("MAP TO"), thus providing a link to the chromosomal map location and other information about the genomic milieu of the probe sequence ; (b) the most similar sequence provided by BLAST query of the EST database, with accession number and BLAST E value for the"hit" ; (c) the most similar sequence provided by BLAST query of the GenBank NR database, with accession number and BLAST E value for the"hit" ; and (d) the most similar sequence provided by BLASTX query of the SWISSPROT database, with accession number and BLAST E value for the"hit".

EXAMPLE 5 Genome-Derived Single Exon Probes Useful For Measuring

Expression of Genes in Human Adult liver Table 4 (545 pages) presents expression, homology, and functional information for the genome-derived single exon probes that are expressed significantly in human adult liver.

Page 1 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similer Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Databhase Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 72 13543 26465 4.79 914 13966 26913 10.74 1071 14115 2.15 1328 14362 2731 10.84 1519 14550 27511 1.03 1519 14550 27512 1.03 1637 14667 27630 1.56 1662 14692 27652 3.77 1755 14782 27752 1.72 1781 14807 27776 7.27 1909 14930 27907 1.05 1994 15012 28002 2.13 2178 15190 28196 2.41 2298 15306 28312 2.27 2608 15606 28599 1.49 2608 15606 28600 1.49 3229 16277 29178 2.44 3510 16548 29448 1.58 3676 16812 29516 8.4 3620 16656 0.8 3725 1675729645 1.21 4025 17052 0.99 4293 17307 30176 1.88 4361 17375 30238 11.97 4446 17457 1.55 4500 17510 30376 0.65 4950 17949 30807 1.16 4986 17985 0.72 5174 18166 31011 6.61 5158 18180 31025 1.15 5438 18520 31245 2.5 5438 18520 31246 2.5 5607 18683 3.94 5791 18863 8.49 Page 2 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Dascriptor ID NO: Signal BLAST E No. Source Value 5876 18683 3.56 5937 19004 32123 1.15 5943 19010 32129 3.4 6255 25645 32471 1.64 6284 19335 32501 1.77 6683 19719 1.31 6829 19862 33074 1.26 6829 19862 33075 1.26 7485 20425 33705 1.39 7485 20426 33706 1.39 7811 20740 34043 1.28 7811 20740 34044 1.28 8330 21235 0.47 8639 21570 34909 1.51 9055 21984 35339 1.14 9419 22347 35711 0.84 9419 22347 35712 0.84 10063 22979 36370 5.03 10286 23176 36588 0.58 10394 23283 36703 1.42 10526 23412 36825 1.15 10801 23687 37116 0.74 10801 23687 37117 0.74 10911 23796 37224 0.57 10911 23796 37225 0.57 11126 24056 3.49 11407 24380 1.49 11532 24442 37902 1.43 11798 24720 38213 2.14 11934 24778 2.59 6287 19338 32505 15.42 9.9E+00 AJ239028.1 NT Homo sapiens LSS gene, partial, exons 15, 16, 17 and 18 8585 21516 34860 1.8 9.8E+00 U32716.1 NT Heemophilus influenzae Rd Section 31 of 163 of the complete genome 10263 23153 36562 0.51 9.8E+00 Y18930.1 NT Suifolobus solfataricus 281 kb genomic DNA fragment, strain P2 10263 23153 36563 0.51 9.8E+00 Y18930.1 NT Sulfolobus solfataricus 281 kb genomic DNA fragment, strain P2 Page 3 of 545<BR> Table 4<BR> Single Exon Probes expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SE Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Top Hit Descriptor ID NO: Signal BLASTE No. NO: NO: Source Value 7342 20338 33604 0.88 9.6E+00 AF065630.1 NT Gallus gallus ornithine transcarbamylase (OTC) gene, exon 1 7342 20338 33605 0.88 9.8E+00 AF065630.1 NT Gallus gallus ornithine transcarbamylase (OTC) gene, exon 1 Mus musculus Naip3 gene, exon 1; neuronal apoptosis inhibitory protein 1 (Naip1) and general transcription 10904 2378 32717 1.06 9.6E+00 AF242432.1 NT factor IIH polypetide 2 (Gtf2h2) genes, complete ode Mus musculus Naip3 gene, exon 1; neuronal apoptosis inhlbitory protein 1 (Naip1) and general transcription 10904 23789 37218 1.06 9.6E+00 AF242432.1 NT factor IIH polypeptide 2 (Gtf2h2) genes, complete cds 2715 15709 28704 1 9.4E+00 L11433.1 NT Dengue virus type 3 membrane protein (prM/M)/envelope glycoprotei (E) polyprotein mRNA, partial cds 2715 15709 28705 1 9.4E+00 L11433.1 NT Dengue virus type 3 membrane protein (prM/MY)/envelope glycoprotein (E) polyprotein mRNA, partial cds 2966 16016 28915 4 9.4E+00 AB043785.1 NT Mus musculus AT3 gene for antithrombin, complete cds 6580 19621 32805 0.51 9.4E+00 P75130 SWISSPROT HYPOTHETICAL PROTEIN MG447 HOMOLOG 8677 21608 34950 1.22 9.3E+00 AF130990.1 NT Homo sapiens ectodysplasin-A receplor protein (EDAR) gene, exons 2, 3, and 4 9555 22482 35842 3.44 9.3E+00 P11210 SWISSPROT IMMEDIATE-EARLY PROTEIN 1 (IE1) (IMMEDIATE-EARLY PHOSPHOPROTEIN PP89) 3 BETA-HYDROXYSTEROID DEHYDROGENASE TYPE IV (3BETA-HSD IV) (3-BETA-HYDROXY- DELTA(5)-STEROID DEHYDROGENASE)(3-BETA-HYDROXY-5-ENE STEROID DEHYDROGENASE) 7874 20801 34104 0.44 9.2E+00 Q61767 SWISSPROT (PROGESTERONE REDUCTASE) Leuciscus cephalus orientalis cytochrome b (cyt b) gene, partial cds; mitochondrial gene for mitochondrial 5479 18560 31403 2.54 9.1E+00 AF095609.1 NT product Leuciscus cephalus orientalis cytochrome b (cyt b) gene, partial cds; mitochondrial gene for mitochondrial 5479 18560 31404 2.54 9.1E+00 AF095609.1 NT product 9964 22869 1.21 9.0E+00 P90241 SWISSPROT RHODOPSIN 6269 19320 32484 5.18 8.9E+00 BE971806.1 EST_HUMAN 601651038R1 NIH_MGC_81 Homo spaiens cDNA clone IMAGE:3934592 3' 6641 19680 32870 2.11 8.7E+00 AB019788.1 NT Cynops pyrrhogaster CP Tbx3 premalure mRNA, partial cds 6641 19680 32871 2.11 8.7E+00 AB019788.1 NT Cynops pyrrhogester CpTbx3 premature mRNA, partial cds 463 13535 26455 1.63 8.4E+00 5031804 NT Homo sapiens Insulin receptor substrate 1 (IRS1) mRNA 9987 21347 34680 4.11 8.1E+00 AJ131719.1 NT Zea mays mRNA for legumain-like protease (see2a) 11611 24519 1.73 8.0E+00 P41820 SWISSPROT BREFELDIN A RESISTANCE PROTEIN 8730 21650 1.07 7.6E+00 Z21489.1 NT African Swine fever virus NP1450L gene encoding RNA polymerase langest subunit 7733 20666 1.9 7.5E+00 AL445065.1 NT Thermoplasma acidophilum complete genome; segment 3/5 8933 21863 35219 1.58 7.5E+00 P36441 SWISSPROT THROMBOSPONDIN 1 PRECURSOR 8933 21863 35220 1.58 7.5E+00 P35441 SWISSPROT THROMBOSPONDIN 1 PRECURSOR 6011 19074 32200 3.41 7.4E+00 BF700517.1 EST_HUMAN 602128876F1 NIH_MGC_56 Homo sapiens cDNA clone IMAGE:4285506 5' 9313 22241 35602 3.81 7.4E+00 P04929 SWISSPROT HISTIDINE-RICH GLYCOPROTEIN PRECURSOR Page 4 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similer Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 9313 22241 35603 3.81 7.4E+00 P04929 SWISSPROT HISTIDINE-RICH GLYCOPROTEIN PRECURSOR 3018 16070 28971 3.82 7.2E+00 L12051.1 NT Lycopersicon esculentum Mill. GTPase (SAR2) mRNA, complete cds 3018 16070 28972 3.82 7.2E+00 L12051.1 NT Lycopersicon esculentum Mill. GTPase (SAR2) mRNA, complete cds 7380 20374 33643 0.52 7.2E+00 BE179090.1 EST_HUMAN RC0-HT0613-200300-031-a07 HT0613 Homo sapiens cDNA 7509 20448 33731 1.3 7.1E+00 P28166 SWISSPROT ZINC-FINGER PROTEIN 1 (ZINC-FINGER HOMEODOMAIN PROTEIN 1) 7509 20448 33732 1.3 7.1E+00 P28166 SWISSPROT ZINC-FINGER PROTEIN 1 (ZINC-FINGER HOMEODOMAIN PROTEIN 1) 10125 23016 10.66 7.1E+00 AL161595.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 91 11823 24743 38234 2.63 7.1E+00 P05850 SWISSPROT HYPOTHETICAL 173 KDA PROTEIN IN MRDA-PHPB INTERGENIC REGION 10488 23376 36791 2.64 7.0E+00 P48610 SWISSPROT ARGININE KINASE (AK) 11698 24598 38076 1.82 7.0E+00 O22469 SWISSPROT WD-40 REPEAT PROTEIN MSI3 8860 21790 35141 2.11 6.9E+00 P35679 SWISSPROT 60S RIBOSOMAL PROTEIN L4 (L2) 10838 23724 37147 1.37 6.9E+00 P44834 SWISSPROT DNA MISMATCH REPAIR PROTEIN MUTS 10856 23742 37165 0.54 6.9E+00 P34226 SWISSPROT SKT5 PROTEIN 8487 21418 34754 1.6 6.8E+00 W03412.1 EST_HUMAN za07c11.r1 Soares melanocyte 2NbHM Homo sapiens cDNA clone IMAGE:291860 5' 8487 21418 34755 1.6 6.8E+00 W03412.1 EST_HUMAN za07c11.r1 Soares melanocyte 2NbHM Homo sapiens cDNA clone IMAGE:291860 5' OUTER CAPSID PROTEIN VP4 (HEMAGGLUTININ) (OUTER LAYER PROTEIN VP4) [CONTAINS: 9677 22603 1.5 6.8E+00 P36307 SWISSPROT OUTER CAPSID PROTEINS VP5 AND VP8] 10705 23691 37018 3.32 6.8E+00 Q03670 SWISSPROT HYPOTHETICAL 157.0 KDA PROTEIN C38C10.5 IN CHROMOSOME III 5466 18547 0.78 6.6E+00 Q99028 SWISSPROT CATECHOL-O-METHYLTRANSFERASE, SOLUBLE FORM (S-COMT) 6824 19857 33069 0.71 6.6E+00 BF672121.1 EST_HUMAN 602152573F1 NIH_MGC_81 Homo sapiens cDNA clone IMAGE:4293427 5' 9585 26991 0.57 6.6E+00 P51825 SWISSPROT AF-4 PFOTEIN (FEL PROTEIN) 10576 23462 36884 2.64 6.6E+00 Q9ZE07 SWISSPROT URIDYLATE KINASE (UK) (URIDINE MONOPHOSPHATE KINASE) (UMP KINASE) 10576 23462 36885 2.64 6.6E+00 Q9ZE07 SWISSPROT URIDYLATE KINASE (UK) (URIDINE MONOPHOSPHATE KINASE) (UMP KINASE) 11568 24477 1.92 6.6E+00 Q10109 SWISSPROT PROBABLE CATIONTRANSPORTING ATPASE C6C3.05C 9723 22648 36030 8.08 6.5E+00 P03374 SWISSPROT ENV POLYPROTEIN [CONTAINS: COAT PROTEIN GP52: COAT PROTEIN GP36] 10794 23680 37110 0.5 6.5E+00 BE866001.1 EST_HUMAN 601678435F1 NIH_MGC_53 Homo sapiens cDNA clone IMAGE:3960969 5' 10262 23152 36561 1.31 6.2E+00 AY010901.1 NT Schizophylium commune unknown mRNA 7387 20380 33649 1.36 6.0E+00 BE780163.1 EST_HUMAN 601468031F1 NIH_MGC_67 Homo sapiens cDNA clone IMAGE:3871303 5' 10993 23877 37306 0.65 6.0E+00 AE001862.1 NT Deinococcus radiodurans R1 section 1 of 2 of the complete chromosome 2 10993 23877 37307 0.65 6.0E+00 AE001862.1 NT Deinococcus radiodurans R1 section 1 of 2 of the complete chromosome 2 Mus musculus mixed lineage kinase 3 (Mik3) and two pore domain K+ channel subunit (Kcnk6) genes, 6799 19832 33043 6.98 5.9E+00 AF155142.1 NT complete cds 12060 24901 1.4 5.9E+00 BE958630.1 EST_HUMAN 60165279F1 NIH_MGC_56 Homo sapiens cDNA clone IMAGE:3930451 5' 3585 16622 0.92 5.8E+00 7661557 NT Homo apiens DESC1 protein (DESC1), mRNA Page 5 of 545<BR> Table 4<BR> Single Exon probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 7523 20462 33749 0.79 5.7E+00 AF302046.1 NT Mus musculus immunoglobulin scavenger receptor IgSR mRNA, complete cds 7523 20462 33750 0.79 5.7E+00 AF302046.1 NT Mus musculus immunoglobulin scavenger receptor IgSR mRNA, complete cds 8002 20920 1.3 5.6E+00 P75080 SWISSPROT DNA POLYMERASE III, ALPHA CHAIN POLC-TYPE (POLIII) 11908 24008 37450 2.46 5.0E+00 Q55276 SWISSPROT LYCOPENE BETA CYCLASE 6500 19544 32720 0.81 5.5E+00 P47447 SWISSPROT HEAT-INDUCIBLE TRANSCRIPTION REPRESSOR HRCA 11218 24144 1.51 5.5E+00 AF175425.1 NT Mus musculus DNA methyltransferase (Dnmt1) gene, exons 30, 31, and 32 11906 24006 37447 5.09 5.5E+00 P11990 SWISSPROT PNEUMOLYSIN (THIOL-ACTIVATED CYTOLYSIN) 12153 24992 1.63 5.5E+00 AL161571.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 67 -7259 20168 33407 1.2 5.4E+00 X02212.1 NT Chicken alpha-cardiac actin gene 7259 20168 33408 1.2 5.4E+00 X02212.1 NT Chicken alpha-cardiac actin gene 7715 20647 0.82 5.4E+00 Q99435 SWISSPROT NEL PROTEIN PRECURSOR (NEL-RELATED PROTEIN 2) 8373 21277 34609 0.48 5.4E+00 P50391 SWISSPROT NEUROPEPTIDE Y RECEPTOR TYPE 4 (NPY4-R) (PANCREATIC POLYPEPTIDE RECEPTOR 1) (PP1) VITELLOGENIN PRECURSOR (VTG) [CONTAINS: LIPOVITELLINLV-1N; LIPOVITELLINLV-1C; 8451 1.58 6.4E+00 Q91062 SWISSPROT LIPOVITELLIN LV-2] 9357 22285 35647 1 5.4E+00 P40379 SWISSPROT REP1 PROTEIN 9357 22285 35648 1 5.4E+00 P40379 SWISSPROT REP1 PROTEIN 10539 23425 36842 1.43 5.4E+00 Q17094 SWISSPROT RHODOPSIN 10539 23425 36843 1.43 5.4E+00 Q17094 SWISSPROT RHODOPSIN 4897 17896 30761 1.38 5.3E+00 L43126.1 NT Bovine immunodeficiency-like virus surface envelope gene, 5' end of cds 6763 19797 0.55 5.3E+00 P41779 SWISSPROT HOMEOBOX PROTEIN CEH-20 8657 21588 3.77 5.3E+00 P54098 SWISSSPROT DNA POLYMERASE GMMA (MITOCHONDRIAL DNA POLYMERASE CATALYTIC SUBUNIT) 9535 22462 0.6 5.3E+00 AB034990.1 NT Homo sapiens HEPRUD1 gene for stress protein Herp, complete cs 12054 24895 38399 3.68 5.3E+00 Q27905 SWISSPROT PROBABLE ANTIBACTERIAL PEPTIDE POLYPROTEIN PRECURSOR 5650 18724 1.18 5.2E+00 BE184840.1 EST_HUMAN QV4-HT0691-270400-188-f0g HT0691 Homo sapiens cDNA 10860 23746 0.89 5.2E+00 AF248070.1 NT Drosophila orientacea R1B retrotransposable element reverse transcriptase gene, partial cds 11640 24546 2.11 5.2E+00 Q10136 SWISSPROT HYPOTHETICAL 61.1 KD PROTEIN C23E2.03C IN CHROMOSOME I 9515 22442 35806 0.81 5.1E+00 O16005 SWISSPROT RHODOPSIN 10340 23229 36646 1.56 5.1E+00 P09182 SWISSPROT COLICIN IMMUNITY PROTEIN (MICROCIN N IMMUNITY PROTEIN) 6539 19582 32766 0.82 5.0E+00 BF310443.1 EST_HUMAN 601894910F1 NIH_MGC_19 Homo sapiens cDNA clone IMAGE:4124114 5' 9597 22523 35887 0.52 5.0E_00 AL163303.2 NT Homo sopione chromosome 21 cegmontHS21C103 10691 23577 0.81 5.0E+00 BF303561.1 EST_HUMAN G01890420F1 NIH_MGC_17 Homo sapiens cDNA clone IMAGE:4131509 5' 10912 23797 37226 3.92 5.0E+00 AF162445.2 NT Ganis familiaris skeletal muscie chloride channel CIC-1 (CLCN1) mRNA, complete cds 11735 24637 38118 8.47 5.0E+00 Z83860.1 NT Mycobacterium tuberculosis H37Rv complete genome; segment 103/162 Page 6 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLASTE No. NO: NO: Source Value Human hereditary haemochromatosis region, histone 2A-like protein gene, hereditary haemochromatosis 10727 23613 0.78 4.9E+00 U91328.1 NT (HLA-H) gene, RoRet gene, and sodium phosphate transporter (NPT3) gene, complete cds 4147 17166 13.45 4.8E+00 AF185255.1 NT Eunice australis histone H3 (H3) gene, partial cds 9105 22033 5.51 4.8E+00 AW750067.1 EST_HUMAN PM0-BT0547-310100-002-b04 BT0547 Homo sapiens cDNA 309 13402 26319 3.7 4.7E+00 BF240552.1 EST_HUMAN 601875654F1 NIH_MGC_55 Homo sapiens cDNA clone IMAGE:4099716 5' 310 13402 26319 3.33 4.7E+00 BF240552.1 EST_HUMAN 601875654F1 NIH_MGC_55 Homo saplens cDNA clone IMAGE:4099716 5' 3318 16365 29265 1 4.7E+00 AL163280.2 NT Homo saplens chromosome 21 segmant HS21C080 8257 21162 34495 0.58 4.6E+00 U67569.1 NT Methanococcus jannaschii section 111 of 150 of the complete genome 7e86g10.x1 NCI_CGAP_CLL1 Homo sepiens cDNA clone IMAGE:3292098 3' similar to TR:O75140 O75140 9738 22662 36046 1.04 4.6E+00 BE646437.1 EST_HUMAN KIAA0645 PROTEIN. ;conlains element PTR5 repetitive element ; 7e86g10.x1 NCI_CGAP_CLL1 Homo saplens cDNA clone IMAGE:3292098 3' similar to TR:O75140 O75140 9738 22662 36047 1.04 4.6E+00 BE646437.1 EST_HUMAN KIAA0645 PROTEIN. ;contains element PTR5 repetitive element ; Homo sapiens glutathione S-transferase theta 2 (GSTT2) and glutathione S-transferase thela 1 (GSTT1) 10877 23763 0.73 4.6E+00 AF240786.1 NT genes, complete cds 8239 21144 0.54 4.5E+00 AF126177.1 NT Issatchenkla orientalls Inositolphosphorylceramide synthase (IPC1) gene, complete cds 12034 24876 38381 2.37 4.5E+00 AE001044.1 NT Archaeoglobus fulgidus section 63 of 172 of the complete genome 12175 25011 38515 1.86 4.5E+00 BF668841.1 EST_HUMAN 602123238F1 NIH_MGC_56 Homo seplens cDNA clone IMAGE:4280216 5' 13107 25777 4.27 4.5E+00 BE069317.1 EST_HUMAN QV3-BT0381-170100-060-c12 BT0381 Homo saplens cDNA 3087 16138 29035 1.02 4.4E+00 BF530893.1 EST_HUMAN 602072585F1 NCI_CGAP-Bm67 Homo sapiens cDNA clone IMAGE:4215284 5' 3087 16138 29036 1.02 4.4E+00 BF530693.1 EST_HUMAN 602072585F1 NCI_CGAP_Bm67 Homo sapiens cDNA clone IMAGE:4215284 5' 6443 19489 1.76 4.4E+00 X13414.1 NT Murine I gene for MHC class II(la) associated invariant chain 6515 19559 32741 0.61 4.4E+00 AF156696.1 NT Nicotiana tabacum inorganic phosphate transporter (PT1) mRNA, complete cds 6357 19406 0.7 4.3E+00 AF059679.1 NT Homo sapiens neutrophil collegenase (CLGNA) gene, promoter region end 5'UTR 7842 20769 34072 2.49 4.3E+00 Y13402.1 NT Plasmodium falciparum R29R+var1 gene, exon 1 8060 20973 34289 0.8 4.3E+00 AE001222.1 NT Treponema pallidum section 38 of 87 of the complete genome Homo sapiens glutathione S-transferase thete 2 (GSTT2) and glutathione S-transferase thele 1 (GSTT1) genes, complete cds 11371 24288 1.59 4.3E+00 11526311 NT Homo sapiens DiGeorge syndrome critical region gene 2 (DGCR2). mRNA MICROSOMAL DIPEPTIDASE PRECURSOR (MDP) (DEHYDROPEPTIDASE-I) (RENAL DIPEPTIDASE) 5707 18780 3.07 4.2E+00 P16444 SWISSPROT (RDP) 5788 18860 31968 1.09 4.2E+00 P51826 SWISSPROT LAF-4 PROTEIN (LYMPHOID NUCLEAR PROTEIN) 5968 19035 0.52 4.2E+00 O27830 SWISSPROT PUTATIVE ATP-DEPENDENT HELICASE MTH1802 7079 20285 33542 1.63 4.2E+00 P13983 SWISSPROT EXTENSIN PRECURSOR 9CELL WALL HYDROXYPROLINE-RICH GLYCOPROTEIN) Page 7 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLASTE No. NO: NO: Source Value 7079 20285 33543 1.63 4.2E+00 P13983 SWISSPROT EXTENSIN PRECURSOR (CELL WALL HYDROXYPROLINE-RICH GLYCOPROTEIN) 9513 22440 35805 6.13 4.2E+00 A1809013.1 EST_HUMAN wf67g03.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2360692 3' 10429 23318 36736 1.42 4.2E+00 P31368 SWISSPROT NUBBIN PROTEIN (TWAIN PROTEIN)(POU DOMAIN PROTEIN 1)(PDM-1)(DPOU-19)(DOCT1) 6161 25642 32360 0.55 4.1E+00 O09185 SWISSPROT CELLULAR TUMOR ANTIGEN P53 6161 25642 32361 0.55 4.1E+00 O09185 SWISSPROT CELLULAR TUMOR ANTIGEN P53 7471 20411 33689 0.74 4.1E+00 BE253668.1 EST_HUMAN 601110727F1 NIH_MGC_16 Homo saplens cDNA clone IMAGE:3351534 5' 7579 20515 33803 0.44 4.1E+00 BF247939.1 EST_HUMAN 601859030F1 NIH_MGC_58 Homo sapiens cDNA clone IMAGE:4069758 5' 8111 21023 34349 7.96 4.1E+00 O23810 SWISSPROT YY1PROTEIN PRECURSOR 8255 21160 0.58 4.1E+00 AB041523.1 NT Patinopecten yessoensis mRNA for calcineurin A, complete cds 8258 21163 34496 4.78 4.1E+00 P28964 SWISSPROT GENE 68 PROTEIN 8258 21163 34497 4.78 4.1E+00 P28964 SWISSPROT GENE 68 PROTEIN 8495 21426 34767 1.14 4.1E+00 U57503.1 NT Pan troglodyles novel repetitive solo LTR element in the RNU2 locus 10069 22985 36378 0.53 4.1E+00 P11253 SWISSPROT 50S RIBOSOMAL PROTEIN L4 10197 23088 36489 1.6 4.1E+00 BF692425.1 EST_HUMAN 602247938F1 NIH_MGC_62 Homo sapiens cDNA clone IMAGE:4333209 5' 10663 23549 0.65 4.1E+00 AJ235273.1 NT Rickettsia prowazekii strain Madrid E, complete genome; segment 4/4 CYCLIN-DEPENDENT KINASE INHIBITOR 1B 9CYCLIN-DEPENDENT KINASE INHIBITOR P27) 10796 23682 0.54 4.1E+00 P46414 SWISSPROT (P27KIP1) 11322 24241 3.68 4.1E+00 P09716 SWISSPROT HYPOTHETICAL PROTEIN HVLF1 11409 24325 14.72 4.1E+00 BE885880.1 EST_HUMAN 601507510F1 NIH_MGC_71 Homo sapiens cDNA clone IMAGE:3909051 5' 3604 16641 0.72 4.0E+00 P38229 SWISSPROT GLC7-INTERACTING PROTEIN 1 5644 20176 33417 0.96 4.0E+00 O62653 SWISSPROT SUCRASE-ISOMALTASE, INTESTINAL [CONTAINS: SUCRASE ; ISOMALTASE] 5644 20176 33418 0.96 4.0E+00 O62653 SWISSPROT SUCRASE-ISOMALTASE, INTESTINAL [CONTAINS: SUCRASE ; ISOMALTASE] 7267 20176 33417 0.88 4.0E+00 O62653 SWISSPROT SUCRASE-ISOMALTASE, INTESTINAL [CONTAINS: SUCRASE ; ISOMALTASE] 7267 20176 33418 0.88 4.0E+00 O62653 SWISSPROT SUCRASE-ISOMALTASE, INTESTINAL [CONTAINS: SUCRASE ; ISOMALTASE] 7553 20490 33779 1.15 4.0E+00 O33010 SWISSPROT CELL DIVISION PROTEIN FTSY HOMOLOG 9431 22359 35722 0.61 4.0E+00 Q14157 SWISSPROT HYPOTHETICAL PROTEIN KIAA0144 10452 23341 36758 0.54 4.0E+00 O61309 SWISSPROT NITRIC-OXIDE SYNTHASE (NOS, TYPE I)(NEURONAL NOS)(N-NOS)(NNOS) 10661 23547 36981 0.67 4.0E+00 AE002132.1 NT Ureaplasma urealyticum section 33 of 59 of the complete genome 11905 24005 37446 1.77 4.0E+00 P14546 SWISSPROT CYTOCHROME C OXIDASE POLYPEPTIDE III GENOME POLYPROTEIN [CONTAINS: CAPSID PROTEIN C (CORE PROTEIN); MATRIX PROTEIN (ENVELOPE GLYCOPROTEIN M); MAJOR ENVELOPE PROTEIN E; NONSTRUCTURAL PROTEINS 11981 24824 38319 2.61 4.0+00 P07564 SWISSPROT NS1, NS2A, NS2B, NS4A AND NS4B; HELICASE (NS3); RNA-DIRECTED RNA POLYMERASE (NS5)] Page 8 of 545<BR> Table 4<BR> Single Exon Probles Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLASTE No. NO: NO: Source Value GENOME POLYPROTEIN [CONTAINS: CAPSID PROTEIN C (CORE PROTEIN); MATRIX PROTEIN (ENVELOPE GLYCOPROTEIN M); MAJOR ENVELOPE PROTEIN E; NONSTRUCTURAL PROTEINS 11981 24824 38320 2.61 4.0E+00 P07564 SWISSPROT NS1, NS2A, NS2B, NS4A AND NS4B; HELICASE (NS3); RNA-DIRECTED RNA POLYMERASE (NS5)] 3560 16597 29501 5.4 3.9E+00 X64518.1 NT N.tabacum chitinase gene 50 for class I chitinase C 4427 17438 0.79 3.9E+00 AF055466.1 NT Mus musculus seminal vasicle secretory protein 99 (MSVSP99) gene, promoter region 5855 18926 32042 2.69 3.9E+00 BE814357.1 EST_HUMAN MR0-BN0070-300500-028-h05 BN0070 Homo sapiens cDNA 5855 18926 32043 2.69 3.9E+00 BE814357.1 EST_HUMAN MR0-BN0070-300500-028-h05 BN0070 Homo sapiens cDNA Dictyostelium discoideum non-LTR retrotransposon TRE5-B, polyprotein (gag) and group-specfic antigen 6926 19955 33175 0.71 3.9E+00 AF298209.1 NT (pol) genes, complete cds Human hereditary haemochromatosis region, histone 2A-like protein gene, hereditary haemochromatosis 6987 20014 33245 0.92 3.9E+00 U91328.1 NT (HLA-H) gene, RoRet gene, and sodium phosphats transporter (NPT3) gene, complete cds 7199 20199 33445 3.78 3.9E+00 P39299 SWISSPROT HYPOTHETICAL TRANSCRIPTIONAL REGULATOR IN AIDB-RPSF INTERGENIC REGION 7754 20684 33983 4.35 3.9E+00 M23907.1 NT Human MHC class II lymphocyte antigen 9DPw4-beta-1) gene, exon 2 8892 21822 35174 2.65 3.9E+00 X65865.1 NT X.laevis mRNA for M4 muscarinic receptor 11829 23964 37399 4.12 3.9E+00 Y18000.1 NT Homo sapiens NF2 gene 2676 15672 1.55 3.8E+00 AE001562.1 NT Helicobacter pylori, strain J99 section 123 of 132 of the complete genome 6654 19693 32887 0.93 3.8E+00 Q57830 SWISSPROT HYPOTHETICAL PROTEIN MJ0385 7078 20284 33541 0.52 3.8E+00 A1493849.1 EST_HUMAN qz51f07.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2030437 3' 9001 21930 35286 1.16 3.8E+00 D44725.1 EST_HUMAN HUMSUPY135 Human brain cDNA Homo sapiens cDNA clone 148 10311 23200 0.69 3.8E+00 AJ390961.1 NT Streptococcus oralis partial xpt gene for xanthine phosphoribosyltransfarase, strain NCTC7864 4106 17130 30004 11.53 3.7E+00 AL181539.2 NT Arabidopsis thaliana DNA chromosome 4, contig frament No. 39 7529 20468 0.91 3.7E+00 AL445065.1 NT Thermoplasma acidophilum complete genome; segment 3/5 9720 22645 36027 0.68 3.7E+00 U43541.1 NT Mus musculus laminin bata 2 gene, exons 17-33, and complete cds 11863 24753 38247 2.33 3.7E+00 BF669279.1 EST_HUMAN 602120551F1 NIH_MGC-56 Homo sapiens cDNA clone IMAGE:4277748 5' 11863 24753 38248 2.33 3.7E+00 BF669279.1 EST_HUMAN 602120551F1 NIH_MGC_56 Homo sapiens cDNA clone IMAGE:4277748 5' 12339 25134 1.81 3.7E+00 AB013746.3 NT Gallus galius mRNA for hypoxia-inducible factor-1 alpha, complete cds 614 13679 26581 1.95 3.6E+00 AV761055.1 EST_HUMAN AV761055 MDS Homo sapiens cDNA clone MDSBUE10 5' 5436 18518 31243 0.56 3.6E+00 BF316316.1 EST_HUMAN 601901866F1 NIH_MGC_19 Homo sapiens cDNA clone IMAGE:413016 5' 9205 22133 35489 4.38 3.6E+00 AE004447.1 NT Fseudomonas aeruginosa PA01, section 8 of 529 of the complete genome 9205 22133 35490 4.38 3.6E+00 AE004447.1 NT Fseudomonas aeruginosa PA01, section 8 of 529 of the complete genome 10188 23079 36480 0.53 3.6E+00 U72775.1 NT Clconia episcopus cylochrome b gene, mitochondrial gene encoding mitochondrial protein, partial cds Page 9 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLASTE No. NO: NO: Source Value 10188 23079 36481 0.53 3.6E+00 U72775.1 NT Ciconia episcopus cylochrome b gene, mitochondrial gene encoding mitochondrial protein, partial cds Escherichia coli glycerophosphate dehydrogenase (glpD) gene, partial cds; and the translation start site has been verified (glpE), the translation start site has been verified (glpG), and repressor protein (glpR) genes, 11266 24209 3.15 3.6E+00 M96795.1 NT complete cds 3292 16339 29241 1.3 3.5E+00 AF221538.1 NT Cryptosporidium felis heat shock protein 70 (HSP70) gene, partial cds 6232 19286 0.83 3.5E+00 L42898.1 NT Borrelia burgdorferi (strain 25015) outer surface protein (ospC) gene, partial cds 6456 19501 32676 1.12 3.5E+00 R19745.1 EST-HUMAN yg40c08.r1 Soares infant brain 1NIB Homo saplens cDNA clone IMAGE:34940 5' CT37F10.S1 sCERES_TESTIS_NHT Homo saplens cDNA clone IMAGE:1618987 3' similar to gb:J04213 8301 21205 34540 0.52 3.5E+00 AA992102.1 EST_HUMAN CELLULAR RETINALDEHYDE-BINDING PROTEIN (HUMAN); 8343 21248 34583 0.51 3.5E+00 4505264 NT Homo sapiens macrophage stimulating 1 receptor (c-met-related tyrosine kinase)(MST1R)mRNA 9054 21983 0.7 3.5E+00 P24557 SWISSPROT THROMBOXANE-A SYNTHASE (TXA SYNTHASE)(TXS) zp86b04.s1 Stratagene HeLa cell s3 937216 Homo sapiens cDNA clone IMAGE:627055 3' similar to 9583 22510 35872 0.97 3.5E+00 AA190998.1 EST_HUMAN contains Alu repetitive element;comtains element MSR1 repetitive element ; zp86b04.s1 Stratagene HeLa cell s3 937216 Homo sapiens cDNA clone IMAGE:627055 3' similar to 9583 22510 35873 0.97 3.5E+00 AA190998.1 EST_HUMAN contains Alu rapetitive element;contains element MSR1 repetitive element ; 10026 22926 36315 1.2 3.5E+00 AL161553.2 NT Arabidopsis thaliana DNA chrcmosome 4, contig fragment NO. 53 11000 23884 37316 0.55 3.5E+00 AJ133723.1 NT Bos taurus mRNA for Ran-binding protein 2, partial 1533 14563 27523 3.15 3.4E+00 AF254577.1 NT Brassica napus RPB5d mRNA, complete cds 2614 15612 28607 0.95 3.4E+00 AL163278.2 NT Homo sapiens chromosome 21 segment HS21C078 7033 20059 33292 0.42 3.4E+00 U77617.1 NT Chlorante-Aster yellows phytoplasma acetate kinase gene, complete cds 7753 20683 33982 2.63 3.4E+00 P04052 SWISSPROT DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT 8157 21064 34394 0.8 3.4E+00 P04052 SWISSPROT DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT Human allernetively spliced potassium ohannels ROM-K1, ROM-K2, ROM-K2, ROM-K4, ROM-K5, and ROM-K6 (KCNJ1) gene, complete cds 9656 22582 35953 0.59 3.4E+00 AJ250567.1 NT Homo saplens partial TM4SF2 gene for tetraspanin protein, exon 6 10757 23643 37076 2.96 3.4E+00 AF013107.1 NT Saccharomyces cerevisiae MSS1 gene, complete cds 11963 24806 38304 1.98 3.4E+00 L77570.1 NT Homo sapiens DIGeorge syndrome critical region, centromeric end 6303 19354 32524 0.84 3.3E+00 Q09669 SWISSPROT PUTATIVE IRON ALCOHOL DEHYDROGENASE 6303 19354 32525 0.84 3.3E+00 Q09669 SWISSPROT PUTATIVE IRON ALCOHOL DEHYDROGENASE 8473 21404 34742 1.06 3.3E+00 AF111168.2 NT Homo sapiens serine palmitoyl transferase, subunit II gene, complete cds; end unknown genes 10942 23827 37253 1.39 3.3E+00 AP001511.1 NT Bacillus halodurans genomic DNA, section 5/14 10942 23827 37254 1.39 3.3E+00 AP001511.1 NT Bacillus halodurans genomic DNA, section 5/14 523 13593 26505 1.59 3.2E+00 x96422.1 NT D.rerio zp-50 POU gene Page 10 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLASTE No. NO: NO: Source Value 4110 13593 26505 0.84 3.2E+00 X96422.1 NT D.rerio zp-50 POU gene Homo sapiens carcincembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein)(CEACAM1), 4841 17842 30711 1.49 3.2E+00 4602404 NT mRNA 5760 18833 31934 1.43 3.2E+00 P54924 SWISSPROT SQUALENE-HOPENE CYCLASE 5760 18833 31935 1.43 3.2E+00 P54924 SWISSPROT SQUALENE-HOPENE CYCLASE 5796 18868 31976 2.58 3.2E+00 P12783 SWISSPROT PHOSPHOGLYCERATE KINASE, CYTOSOLIC 5796 18868 31977 2.58 3.2E+00 P12783 SWISSPROT PHOSPHOGLYCERATE KINASE, CYTOSOLIC 6561 19602 32787 1.89 3.2E+00 P18931 SWISSPROT NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 4 6561 19602 32788 1.89 3.2E+00 P18931 SWISSPROT NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 4 8049 20962 34278 0.73 3.2E+00 P04275 SWISSPROT VON WILLEBRAND FACTOR PRECURSOR (VWF) 8245 21150 34484 2.35 3.2E+00 Y13655.1 NT Chlamydomonas reinhardtill chloroplast DNA for rps9, ycf4, ycf3, rps18 genes 8245 21150 34485 2.35 3.2E+00 Y13665.1 NT Chlamydomonas reinhardtill chloroplast DNA for rps9, ycf4, ycf3, rps18 genes 9581 22508 6.46 3.2E+00 P13061 SWISSPROT PERIPLASMIC [NIFE] HYDROGENASE SMALL SUBUNIT (NIFE HYDROGENLYASE SMALL CHAIN) 10060 22976 36368 1.21 3.2E+00 M36383.1 NT S.cerevisiae threonine deeminase (ILV1) gene, complete cds 10640 23526 36961 2.39 3.2E+00 AB016081.2 Oryzias latipes OIGC6 gene for guanylyl cyclase C, complete cds 12303 25111 4.71 3.2E+00 L33836.1 NT Sus scrofa choline acetyltransferase gene, promoter region 6090 19151 32287 1.91 3.1E+00 Q10135 SWISSPROT HYPOTHETICAL 142.5 KD PROTEIN G23E2.02 IN CHROMOSOME I 7785 20714 34016 0.88 3.1E+00 P52178 SWISSPROT TRIOSE PHOSPHATE/PHOSPHATE TRANSLOCATOR, NON-GREEN PLASTID PRECURSOR (CTPT) 8190 21097 1.09 3.1E+00 AF303225.1 NT Becillus alcalophilus pectate lyase (pelE) gene, complete cds 8666 21597 34937 0.56 3.1E+00 P40985 SWISSPROT PROBABLE UBIQUITIN--PROTEIN LIGASE HUL4 9164 22092 35449 5.22 3.1E+00 P49894 SWISSPROT TYPE # #ODOTHYRONINE DEIODINASE (TYPE-I 5' DEIODINASE)(DIOI)(TYPE 1 DI)(5DI) 9164 22092 35450 5.22 3.1E+00 P49894 SWISSPROT TYPE # #ODOTHYRONINE DEIODINASE (TYPE-I 5' DEIODINASE)(DIOI)(TYPE 1 DI)(5DI) GLUTAMATE [NMDA]RECEPTOR SUBUNIT EPSILON 3 PRECURSOR (N-METHYL D-ASPARTATE 9801 22765 1.47 3.1E+00 Q14957 SWISSPROT RECEPTOR SUBTYPE 2C)(NR2C)(NMDAR2C) 9865 22780 36169 0.54 3.1E+00 Q01149 SWISSPROT COLLAGEN ALPHA 2(I) CHAIN PRECURSOR 10408 23297 36717 0.68 3.1E+00 7524759 NT Chlorelle vulgaris chloroplast, complete genome 10494 23382 0.62 3.4E+00 Q10125 SWISSPROT HYPOTHETICAL 56.3 KD PROTEIN F52C9.5 IN CHROMOSOME III 10824 23710 37137 5.36 3.1E+00 P49365 SWISSPROT DEOXYHYPUSINE SYNTHASE (DHS) GENOME POLYPROTEIN[CONTAINS: CAPSID PROTEIN C (CORE PROTEIN);MATRIX PROTEIN (ENVELOPE PROTEIN M); MAJOR ENVELOPE PROTEIN E; NONSTRUCTURAL PROTEINS NS1, 11895 23995 2.49 3.1E+00 P33515 SWISSPROT NS2A, NS2B, NS4A AND NS4B; HELICASE (NS3); RNA-DIRECTED RNA POLYMERASE (NS5)] refindic acid nuclear receptor isoform beta 2 [mice, embryonal carcinoma cell line, PCC7-MZ1, mRNA, 2971 11913 24760 4.16 3.1E+00 S56660.1 NT nt] 5522 18601 31450 1.42 3.0E+00 X53096.1 NT S.aureus genes encoding Sau961 DNA methyltransferase and Sau961 restriction endonuclease Page 11 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 6837 19869 33083 0.68 3.0E+00 X56037.1 NT Corynebacterium glutamicum thrC gene for threonine synthase (EC 4.2.99.2) 6837 19869 33084 0.68 3.0E+00 X56037.1 NT Corynebacterium glutamicum thrC gene for threonine synthase (EC 4.2.99.2) 7517 20456 10.11 3.0E+00 P18406 SWISSPROT CYR61 PROTEIN PRECURSOR (3CH61) 7560 20497 0.75 3.0E+00 Q13201 SWISSPROT ENDOTHELIAL cELL MULTIMERIN PRECURSOR 9464 22392 1.65 3.0E+00 X67838.1 NT B.napus DNA for myrosinase S-ADENOSYLMETHIONINE SYNTHETASE (METHIONINE ADENOSYLTRANSFERASE) (ADOMET 10783 23669 37098 0.66 3.0E+00 Q58605 SWISSPROT SYNTHETASE) 11092 24023 37465 1.39 3.0E+00 Q16181 SWISSPROT CDC10 PROTEIN HOMOLOG RETINAL GUANYLYL CYCLASE 2 PRECURSOR (GUANYLATE CYCLASE 2F, RETINAL)(RETGC-2) (ROD OUTER SEGMENT MEMBRANE GUANYLATE CYCLASE 2)(ROS-GC2)(GUANYLATE CYCLASE 11447 24363 37811 5.92 3.0E+00 P51842 SWISSPROT F)(GC-F) RETINAL GUANYLYL CYCLASE 2 PRECURSOR (GUANYLATE CYCLASE 2F, RETINAL)(RETGC-2) (ROD OUTER SEGMENT MEMBRANE GUANYLATE CYCLASE 2)(ROS-GC2)(GUANYLATE CYCLASE 11447 24363 37812 5.92 3.PE+00 P51842 SWISSPROT F)(GC-F) 12016 24858 38358 1.56 3.0E+00 P34194 SWISSPROT NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 4 2024 15042 28036 2.11 2.9E+00 AE002225.2 NT Chlamydophila pneumoniae AR39, section 53 of 94 94 of the complete genome 6309 19359 0.56 2.9E+00 AB026033.1 NT Bonapartia pedaliota mitochondrial DNA for 16S ribosomal RNA 7237 20146 33386 10.73 2.9E+00 Z36879.1 NT F.pringlei gdcsPA gene for P-protein of the glycine cleavaçe system 7577 20513 33799 4.82 2.9E+00 O14514 SWISSPROT BRAIN-SPECIFIC ANGIOGENESIS INHIBITOR 1 PRECURSOR 7577 20513 33700 4.82 2.9E+00 O14514 SWISSPROT BRAIN-SPECIFIC ANGIOGENESIS INHIBITOR 1 PRECURSOR 7860 20787 34090 5.2 2.9E+00 P46589 SWISSPROT ADHERENCE FACTOR (ADHESION AND AGGREGATION MEDIATING SURFACE ANTIGEN) STRUCTURAL POLYPROTEIN [CONTAINS; MAJOR STRUCTURAL PROTEIN VP2; 8449 21381 34722 0.61 2.9E+00 P05844 SWISSPROT NONSTRUCTURAL PROTEIN VP4; MINOR STRUCTURAL PROTEIN VP3] STRUCTURAL POLYPROTEIN [CONTAINS: MAJOR STRUCTURAL PROTEIN VP2; 8449 21381 34723 0.61 2.9E+00 P05844 WWISSPROT NONSTRUCTURAL PROTEIN VP4; MINOR STRUCTURAL PROTEIN VP3] 8676 21607 34949 0.88 2.9E+00 BF344171.1 EST_HUMAN 602017413F1 NCI_CGAP_Bm64 Homo sapiens cDNA clone IMAGE:4153059 5' 9779 22703 0.66 2.9E+00 AJ002153.2 NT Saguinus oedipus gene for seminal vesicle secreted protein samenogelin I 1476 14507 27468 3.83 2.8E+00 AF186398.1 NT BuxL1s harlandil maturase K (matK) gene, partial cds; chloroplast gene for chloroplast product 1657 14687 2.32 2.8E+00 AL161552.2 NT Arabidopsis thaliana DNA chromosome 4, config fragment No. 52 7691 20623 33923 5.61 2.8E+00 8393724 NT Mus musculus endomucin (LOC53423), mRNA 10140 23031 0.71 2.8E+00 BE565182.1 EST_HUMAN 601342758F1 NIH_MGC_53 Homo sapiens cDNA clone IMAGE: 3684807 5' 11131 20623 33923 1.57 2.8E+00 8393724 NT Mus musculus endomucin (LOC53423), mRNA 249 13347 26259 9.41 2.7E+00 6679306 NT Mus musculus per-hexamer repeat gene 3 (Phxr3), mRNA 249 13347 26260 9.41 2.7E+00 6679306 NT Mus musculus per-hexamer repeat gene 3 (Phxr3), mRNA Page 12 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 5743 18816 31912 1.43 2.7E+00 L14005.1 NT Homo sapiens apoA polymorphism Kringle IV gene, exons 1 and 2 8724 21654 0.7 2.7E+00 U15947.1 NT Ipomoea purpurea chalcone synthase (CHSB) gene including complete 5'UTR and complete cds 9520 22447 2.43 2.7E+00 AL116459.1 NT Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation xc88e12.x1 NCI_CGAP_Bm35 Homo sapiens cDNA clone iMAGE: 2591374 3' similar to gb:M17733 9966 21324 34657 0.64 2.7E+00 AW088191.1 EST_HUMAN THYMOSIN BETA-4 (HUMAN); 10978 23862 1.7 2.7E+00 BE063527.1 EST_HUMAN CM0-BT0281-031199-087-h04 BT0281 Homo sapiens cDNA 4786 17791 30658 5.9 2.6E+00 AF068749.1 NT Mus musculus sphingasine kinase (SPHK1b) mRNA, complete cds 5739 18812 31907 1.75 2.5E+00 6755601 NT Mus muscuius SRY-box containing gene 13 (Sox13), mRNA 5739 18812 31908 1.75 2.6E+00 6755601 NT Mus muscuius SRY-box containing gene 13 (Sox13), mRNA 6038 19100 1.55 2.6E+00 Y17062.1 NT Mycobacterium fortuitum furA 11 gene 7986 25984 0.79 2.6E+00 AJ224639.1 NT Homo sapiens Surf-5 and Surf-6 genes 8156 21063 8.96 2.6E+00 AF235502.1 NT Mus musculus SH2-containing inositol 5-phosphatase (Ship) gene, exons 16 through 27, and complete cds 8637 21568 34905 1.33 2.6E+00 AJ132180.1 NT faba been necrotic yellows virus C2-Eg gene, isolate Egyptien EV1-93 8637 21568 34906 1.33 2.6E+00 AJ132180.1 NT faba been necrotic yellows virus C2-Eg gene, isolate Egyptian EV1-93 10182 23073 36473 2.87 2.6E+00 AL161540.2 NT Arabidopsis thaliana DNA chromosome 4, conti fragment No. 40 10841 23727 1.97 2.6E+00 9055193 NT Mus musculus cleavage and polyadenylation specificity factor 3 (Cpsf3), mRNA 11468 24381 37828 1.48 2.6E+00 AF143675.1 NT Hantavirus Z10 segment M G1/G2 glycoprotein (Z10) gene, complete cds 12889 25859 2.17 2.6E+00 11419220 Nt Homo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), mRNA 1483 14514 27474 2.58 2.5E+00 AJ271844.1 NT Aspergillus nidulans recQ gene for DNA helicase, exons 1-4 1483 14514 27475 2.58 2.5E+00 AJ271844.1 NT Aspergillus nidulans recQ gene for DNA helicase, exons 1-4 6024 19086 32210 1.99 2.5E+00 P13485 SWISSPROT TEICHOIC ACID BIOSYNTHESIS PROTEIN F 6024 19086 32211 1.99 2.5E+00 P13485 SWISSPROT TEICHOIC ACID BIOSYNTHESIS PROTEIN F 6730 19086 32210 1.54 2.5E+00 P13485 SWISSPROT TEICHOIC ACID BIOSYNTHESIS PROTEIN F 6730 19086 32211 1.54 2.5E+00 P13485 SWISSPROT TEICHOIC ACID BIOSYNTHESIS PROTEIN F 7032 20058 33291 0.68 2.5E+00 D30052.1 NT Vibrio cholerae cbxA gene and ctxB gene for chofera toxins, complete cds 8227 21132 34462 1.05 2.5E+00 AW949158.1 EST_HUMAN QV4-FT0005-110500-205-g07 FT0005 Homo sapiens cDNA 8302 21206 34541 0.49 2.5E+00 4502902 NT Homo sapiens clathrin, heavy pclypeptide-like 1 (CLTCL1) mRNA 9648 22574 35945 1.64 2.5E+00 D50307.1 NT Rice DNA for aldolase C-1, complete cds 10366 23255 36675 0.85 2.5E+00 BE297758.1 EST_HUMAN 601175779F1 NIH_MGC_17 Homo sapiens cDNA clone IMAGE:3531090 5' 11971 24814 2.02 2.5E+00 P40170 SWISSPROT DNAJPROTEIN 12300 25109 2.91 2.5E+00 AF289665.1 NT Mus musculus EIF4H gene, partial cds; LIMK1 gene, complete cds; and ELN gene, partial cds 3057 16109 29015 1.1 2.4E+00 M24282.1 NT Chicken alpha-3 collagen type VI mRNA, 3' end 5015 18013 30872 5.08 2.4E+00 4503352 NT Homo sapiens double C2-like domains, alpha(DOC2A) mRNA Page 13 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Aduit Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 6243 19297 32455 4.27 2.4E+00 P02843 SWISSPROT VITELLOGENIN I PRECURSOR (YOLK PROTEIN 1) 7773 20703 34002 0.63 2.4E+00 bf667502.1 EST_HUMAN 602120856F1 NIH_MGC_56 Homo sapiens cDNA clone IMAGE:4278012 5' 7773 20703 34003 0.63 2.4E+00 bf667502.1 EST_HUMAN 602120856F1 NIH_MGC_56 Homo sapiens cDNA clone IMAGE:4278012 5' 7789 20718 34021 0.43 2.4E+00 P20126 SWISSPROT RNA REPLICASE POLYPROTEIN 7789 20718 34022 0.43 2.4E+00 P20126 SWISSPROT RNA REPLICASE POLYPROTEIN 8718 21649 34994 2.25 2.4E+00 P26842 SWISSPROT CD27L RECEPTOR PRECURSOR (T-CELL AGTIVATION NATIGEN CD27)(T14) 8718 21649 34995 2.25 2.4E+00 P26842 SWISSPROT CD27L RECEPTOR PRECURSOR (T-CELL AGTIVATION NATIGEN CD27)(T14) 8790 21720 3.32 2.4E+00 AE001486.1 NT Helicobacter pylori, strain J99 section 47 of 132 of the complete genome 9210 22138 1.82 2.4E+00 AW875126.1 EST_HUMAN RC2-PT0004-031299-011-d05 PT0004 Homo sapiens cDNA 9387 22315 35677 8.12 2.4E+00 P24091 SWISSPROT ENDOCHITINASE B PRECURSOR (CHN-B) 10541 23427 36846 2.58 2.4E+00 P13673 SWISSPROT SKIN GRANULE PROTEIN PRECURSOR 10541 23427 36847 2.58 2.4E+00 P13673 SWISSPROT SKIN GRANULE PROTEIN PRECURSOR 10608 23494 36924 2.52 2.4E+00 X92511.1 NT H.sapiens CTGF gene and promoter region 10737 23623 7.42 2.4E+00 P09099 SWISSPROT XYLULOSE KINASE (XYLULOKINASE) 10811 23697 37123 1.96 2.4E+00 BE326702.1 EST_HUMAN hr63f06.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:3133187 3' 10811 23697 37124 1.96 2.4E+00 BE326702.1 EST_HUMAN hr63f06.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:3133187 3' 11063 23947 37385 1.4 2.4E+00 Q51481 SWISSPROT DENITRIFICATION REGULATORY PROTEIN NIRQ 11797 24719 38212 2.5 2.4E+00 AF158652.2 NT Fragaria x ananassa cytosolic accorbate peroxidase (ApxSC) gene, ApxSC-c allele, complete cds 1281 14314 27263 9.93 2.3E+00 Z46724.1 NT G.domesticus artificial single chain antibody gene (L3) 4217 17233 1.68 2.3E+00 AJ401081.1 NT Bos taurus partial cylb gene for cytochrome b J7340F Human fetal heart, Lambda ZAP Express Homo sapiens cDNA clone J7340 5' similar to 6048 19110 0.94 2.3E+00 N86245.1 EST_HUMAN PROLYLCARBOXYPEPTIDASE 7858 20785 34088 2.43 2.3E+00 6978554 NT Rattus norvegicus ATPase, Ca++ transporting, ubiquitous (Atp2a3), mRNA 8038 25985 3.15 2.3E+00 P07199 SWISSPROT MAJOR CENTROMERE AUTOANTIGEN B (CENTROMERE PROTEIN B)(CENP-B) 8253 21158 34491 1.5 2.3E+00 X60265.1 NT M.mazei dnaK and dnaJ genes homologues coding for DnaK and DnaJ 9654 22580 35952 0.56 2.3E+00 5835317 NT Polypterus ornatipinnis mitoohondrion, complete genome ALPHA-(1,3)-FUCOSYLTRANSFERASE(GALACTOSIDE 3-L-FUCOSYLTRANSFERASE) 9712 22637 36018 1.73 2.3E+00 Q11127 SWISSPROT (FUCOSYL TRANSFERASE 4)(FUCT-IV) 11241 24167 37613 3.36 2.3E+00 Q07076 SWISSPROT ANNEXIN VII (SYNEXIN) 11714 24616 38092 1.58 2.3E+00 P29059 SWISSPROT ENDOCHITINASE 3 PRECURSOR 12190 25026 38526 2.66 2.3E+00 BF541987.1 EST_HUMAN 602069121F1 NIH_MGC_58 Homo sapiens cDNA clone IMAGE:4068173 5' 12190 25026 38527 2.66 2.3E+00 BF541987.1 EST_HUMAN 602069121F1 NIH_MGC_58 Homo sapiens cDNA clone IMAGE:4068173 5' 12499 25238 31862 5.44 2.3E+00 BE541987.1 EST_HUMAN 601433673F1 NIH_MGC_72 Homo sapiens cDNA clone IMAGE:3918643 5' Page 14 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Aduit Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 4103 17128 30003 0.91 2.2E+00 AF020528.1 NT Magnaporthe grisea Class N chitin synthase (chs4) gene, complete cds 4418 17429 30291 5.4 2.2E+00 D67071.1 NT Rat gene for regucalcin, exon1 (non-coding exon) 4418 17429 30292 5.4 2.2E+00 D67071.1 NT Rat gene for regucalcin, exon1 (non-coding exon) SORTILIN-RELATED RECEPTOR PRECURSOR (SORTING PROTEIN-RELATED RECEPTOR CONTAINING LDLP CLASS A REPEATS)(MSORLA)(SORLA-1)(LOW-DENSITY LIPOPROTEIN RECEPTOR RELATIVE WITH 11 LIGAND-BINDING REPEATS)(LDLR RELATIVE WITH 11 LIGAND- 5526 18605 31453 11.77 2.2E+00 088307 SWISSPROT BINDING REPEATS)(LR11)(> SORTILIN-RELATED RECEPTOR PRECURSOR (SORTING PROTEIN-RELATED RECEPTOR CONTAINING LDLP CLASS A REPEATS)(MSORLA)(SORLA-1)(LOW-DENSITY LIPOPROTEIN RECEPTOR BELATIVE WITH 11 LIGAND-BINDING REPEATS)(LDLR RELATIVE WITH 11 LIGAND- 5526 18605 31453 11.77 2.2E+00 088307 SWISSPROT BINDING REPEATS)(LR11)(> 6067 19128 32259 1.04 2.2E+00 BE927220.1 EST_HUMAN RC3-CT0254-300800-022-e06 CT0254 Homo sapiens cDNA 6067 19128 32260 1.04 2.2E+00 BE927220.1 EST_HUMAN RC3-CT0254-300800-022-e06 CT0254 Homo sapiens cDNA 6297 19348 32516 7.46 2.2E+00 BE250383.1 EST_HUMAN 600943401T1 NIH_MGC_17 Homo sapiens cDNA clone INAGe:2959777 3' 6612 19653 32837 3.09 2.2E+00 Q00335 SWISSPROT MINOR VIRION STRUCTURAL PROTEIN MU-2 6882 19912 33128 2.79 2.2E+00 P51459 SWISSPROT INSULIN-LIKE GROWTH FACTOR II PRECURSOR (IGF-II) (SOMATOMEDIN A) 7293 18462 3.6 2.2E+00 AA594574.1 EST_HUMAN nl95602.s1 NCI_CGAP_Co10 Homo sapiens cDNA clone IMAGE:1058379 3' 7701 20633 33930 0.87 2.2E+00 AA137027.1 EST_HUMAN zn97f04.r1 Stratagene fetal retina 937202 Homo sapiens cDNA clone IMAGE:566143 5' 8051 20964 34280 20.17 2.2E+00 AA449012.1 EST_HUMAN zx05g10.r1 Soares_total_fetus_Nb2HF8_9w Homo sapiens cDNA clone IMAGE:785634 5' 8142 21051 34383 0.55 2.2E+00 P54918 SWISSPROT ALANINE RACEMASE 8414 21316 34648 0.41 2.2E+00 O67099 SWISSPROT THYMIDYLATEKINASE (DTMP KINASE) bb17h12.x1 NIH_MGC_21 Homo sapiens cDNA clone IMAGE:2963207 3' similar to gb:D45836 Mouse 8681 21612 34953 0.71 2.2E+00 BE301560.1 EST_HUMAN mRNA for nuclear pore-targeting-complex component of (MOUSE); bb17h12.x1 NIH_MGC_21 Homo sapiens cDNA clone IMAGE:2963207 3' similar to gb:D45836 Mouse 8681 21612 34953 0.71 2.2E+00 BE301560.1 EST_HUMAN mRNA for nuclear pore-targeting-complex component of (MOUSE); 9880 22795 13.66 2.2E+00 BE741678.1 EST_HUMAN 601594733F1 NHI_MGC_9 Homo sapiens cDNA clone IMAGE:3948561 5' 10097 25691 2.64 2.2E+00 Q04706 SWISSPROT TRANSPOSON TY1 PROTEIN A qm69b03.x1 Soares_placenta_Sto9weeks_2NbHP8to9W Homo sapiens cDNA clone IMAGE: 1893965 3' 10556 23442 36862 1.93 2.2E+00 AI290373.1 EST_HUMAN similar to gb:Y00433 GLUTATHIONE PEROXIDASE (HUMAN); qm69b03.x1 Soares_placenta_Sto9weeks_2NbHP8to9@ Homo sapiens cDNA clone IMAGE: 1893965 3' 10556 23442 36862 1.93 2.2E+00 AI290373.1 EST_HUMAN similar to gb:Y00433 GLUTATHIONE PEROXIDASE (HUMAN); 10598 23484 36913 2.2 2.2E+00 BF246782.1 EST_HUMAN 601855591f1 NIH_MGC_57 Homo sapiens cDNA clone IMAGE:4075391 5' 10935 23820 37247 2.49 2.2E+00 AF183416.1 NT Homo sapiens ovarian granulosa cell 13.0 kDa protein hGR74 homolog mRNA, complete cds Page 15 of 545<BR> Table 4<BR> Singe Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value ALPHA-2A ADRENERGIC RECEPTOR (ALPHA-2A ADRENOCEPTOR)(ALPHA-2AAR)(CA2-47) 11039 23923 37366 0.51 2.2E+00 P22909 SWISSPROT (ALPHA-2D ADRENERGIC RECEPTOR) 11874 23974 37411 3.47 2.2E+00 P07911 SWISSPROT UROMODULIN PRECURSOR (TAMM-HORSFALL URINARY GLYCOPROTEIN)(THP) 12041 24883 38389 5.96 2.2E+00 P10407 SWISSPROT EARLYE1A 28 KD PROTEIN 591 15878 26562 6.8 2.1E+00 AF132612.2 NT Mus musculus pre-T cell receptor alpha gene, enhancer reglon and upstream region 3649 16685 0.85 2.1E+00 AW4493661. EST_HUMAN UI-H-BI3-aki-e-08-0-UI.s1 NCI_CGAP_Sub5 Homo sapiens cDNA clone IMAGE:2734550 3' 6372 19421 0.92 2.1E+00 P75357 SWISSPROT HYPOTHETICAL PROTEIN MG302 HOMOLOG 7119 20323 33587 3.56 2.1E+00 O70159 SWISSPROT ALPHA-2-HS-GLYCOPROTEIN PRECURSOR (FETUIN-A) Homo sapiens dysferlin, limb girdle muscular dystrophy 2B (autosomal recessive)(DYSF) mRNA, and 7375 20369 33638 0.67 2.1E+00 4503430 NT translated producls yy08a10.s1 Soares melanocyte 2NbHM Homo sapiens cDNA clone IMAGE:270618 3' similar to gb:M55654 7397 20096 33330 5.66 2.1E+00 N29575.1 EST_HUMAN TRANSCRIPTION INITIATION FACTOR TFIID (HUMAN); 9064 21993 2.3 2.1E+00 AU123630.1 EST_HUMAN AU123630 NTWRM2 Homo sapiens cDNA clone NT2RM2000671 5' 1224 14261 27203 1.1 2.0E+00 AF180527.1 NT Homo sapiens p22Dokdel (DOKDEL) mRNA, complete cds 1224 14261 27204 1.1 2.0E+00 AF180527.1 NT Homo sapiens p22Dokdel (DOKDEL) mRNA, complete cds 1363 14394 27349 1.08 2.0E+00 AF204927.1 NT Oryctolagus cuniculus Na+,K+-ATPase beta 1 subunit mrNA, complete cds 1597 14628 3.72 2.0E+00 P25582 SWISSPROT PUTATIVE RRNA METHYLTRANSFERASE SPB1 2163 15135 28180 2.67 2.0E+00 278279.1 NT R.norvegicus mRNA for collagen alpha1 type l 2163 15135 28181 2.67 2.0E+00 278279.1 NT R.norvegicus mRNA for collagen alpha1 type l hi13c05.x1 NCI_CGAP_GU1 Homo sapiens cDNA clone IMAGE:2972168 3' similar to gb:X01677 4191 17211 3007 1.63 2.0E+00 AW664496.1 EST_HUMAN GLYCERALDEHYDE 3 PHOSPHATE DEHYDROGENASE, LIVER (HUMAN); HI13C05.x1 NCI_CGAP_GU1 hOMO SAPIENS Cdna CLONE IMAGE:2972168 3' similar to gb:X01677 4191 17211 3008 1.63 2.0E+00 AW664496 1 EST_HUMAN GLYCERALDEHYDE 3 PHOSPHATE DEHYDROGENASE, LIVER (HUMAN); STRUCTURAL POLYPROTEIN [CONTAINS: NUCLEOCAPSID PROTEIN C; MEMBRANE 7981 20902 0.84 2.0E+00 P07566 SWISSPROT GLYCOPROTEINS E1 AND 32] 8602 21533 34874 4.37 2.0E+00 AB008676.1 NT Escherichia coli 0157 DNA, map position at 46 min., complete cds 8602 21533 34875 4.37 2.0E+00 AB008676.1 NT Escherichia coli 0157 DNA, map position at 46 min., complete cds 8602 21533 34876 4.37 2.0E+00 AB008676.1 NT Escherichia coli 0157 DNA, map position at 46 min., complete cds 9478 22406 35766 3.1 2.0E+00 F31500.1 EST_HUMAN HSPD22703 HM3 Homo sapiens cDNA clone s4000117B08 12808 25823 31483 6.51 2.0E+00 5834843 NT Gallus gallue mitochondrion, complete genome 5792 18864 31971 4.67 1.9E+00 6754389 NT Mus musculus inositol 1,4,5-triphosphate receptor 1 (ltpr1), mRNA 5792 18864 31972 4.67 1.9E+00 6754389 NT Mus musculus inositol 1,4,5-triphosphate receptor 1 (ltpr1), mRNA 6337 19387 32556 1.21 1.9E+00 BE969695.1 EST_HUMAN 601679636F1 NIH_MGC_78 Homo sapiens cDNA clone IMAGE:3949881 5' 6947 19976 0.87 1.9E+00 aw845689.1 EST_HUMAN MR0-CT0063-0710099-002-g02 CT0063 Homo sapiens cDNA Page 16 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 7053 20079 1.89 1.9E+00 Q63627 SWISSPROT CTD-BINDING SR-LIKE PROTEIN RA4 9027 21956 35314 243 1.9E+00 P02467 SWISSPROT COLLAGEN ALPHA 2(I) CHAIN PRECURSOR 9027 21956 35315 243 1.9E+00 P02467 SWISSPROT COLLAGEN ALPHA 2(I) CHAIN PRECURSOR 9217 22145 297 1.9E+00 BF360206.1 EST_HUMAN CM3-MT0114-010900-323-h12 MT0114 Homo sapiens cDNA 9451 22379 245 1.9E+00 O51781 SWISSPROT ARGININE DEIMINASE (ADI) ARGININE DIHYDROLASE (AD) abg4a04.s1 Stratagene lung (#937210) Homo sapiens cDNA clone IMAGE:854574 3' similar to contains Alu 10156 23047 36446 0.7 1.9E+00 AA669125.1 EST_HUMAN repetitive elementcontains element L1 L1 repetitive element; 11038 23922 37365 0.64 1.9E+00 AF248269.1 NT Homo sapiens geg-pro-pol precursor protein gene, partial cds 3141 16191 29084 204 1.8E+00 P21004 SWISSPROT PROTEIN B8 PRECURSOR Synechococcus sp. PCC7942 copper transporting P-ATPase (ctaA) and ATP synthase epsilon subunit 3165 16215 29104 1.09 1.8E+00 U04356.1 NT (atpE) genes, complete cds Synechococcus sp. PCc7942 copper transporting P-ATPase (ctaA) and ATP synthase epsilon subunit 3165 16215 29105 1.09 1.8E+00 U04356.1 NT (atpE) genes, complete cds 6082 19143 1.69 1.8E+00 P18502 SWISSPROT HEDGEHOG RECEPTOR (PATCHED PROTEIN) 6342 19392 32561 1.89 1.8E+00 BF311999.1 EST_HUMAN 601897854F1 NIH_MGC_19 Homo sapiens cDNA clone IMAGE:4127364 5' 6663 19701 3.59 1.8E+00 BF683327.1 EST_HUMAN 602139470F1 NIH_MGC_46 Homo sapiens cDNA clone IMAGE:4298272 5' 7044 20070 33304 1.26 1.8E+00 BF305652.1 EST_HUMAN 601893489F1 NIH_MGC_17 Homo sapiens cDNA clone IMAGE:4139038 5' 7412 20111 33345 0.93 1.8E+00 P21249 SWISSPROT MAJOR ANTIGEN LIPOPOLYSACCHARIDE 1,6-GALACTOSYL TRANSFERASE (UDP-D-GALACTOSE_ 7635 20570 0.74 1.8E+00 P27127 SWISSPROT (GLUCOSYL)LIPOPOLYSACCHARIDE-ALPHA-1,3-D-GALACTOSYLTRANSFERA SE) RETROVIRUS-RELATED POL POLYPROTEIN [CONTAINS: REVERSE TRANSCRIPTASE; 8694 21625 34968 0.95 1.8E+00 P11369 SWISSPROT ENDONUCLEASE] RETROVIRUS-RELATED POL POLYPROTEIN [CONTAINS: REVERSE TRANSCRIPTASE; 8694 21625 34969 0.95 1.8E+00 P11369 SWISSPROT ENDONUCLEASE] 9038 21967 35326 0.55 1.8E+00 P48634 SWISSPROT LARGE PROLINE-RICH PROTEIN BAT2 (HLA-B-ASSOCIATED TRANSCRIPT 2) 9038 21967 35327 0.55 1.8E+00 P48634 SWISSPROT LARGE PROLINE-RICH PROTEIN BAT2 (HLA-B-ASSOCIATED TRANSCRIPT 2) 9038 21967 35328 0.55 1.8E+00 P48634 SWISSPROT LARGE PROLINE-RICH PROTEIN BAT2 (HLA-B-ASSOCIATED TRANSCRIPT 2) 9413 22341 35706 2.66 1.8E+00 O43281 SWISSPROT EMBRYONAL FYN-ASSOCIATED SUBSTRATE (HEFS) 9717 22642 36023 0.81 1.8E+00 R31042.1 EST_HUMAN yh72c08.r1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE:135278 5' 9804 22710 36092 1.06 1.8E+00 AW880004.1 EST_HUMAN QV0-OT0030-070300-148-a03 OT0030 Homo sapiens cDNA 10363 23252 36672 0.77 1.8E+00 P27050 SWISSPROT CHITINASE D PRECURSOR 10775 23661 3.37 1.8E+00 AF111849.1 NT Homo sapiens PRO0530 mRNA, complete cds 11031 23915 0.92 1.8E+00 P44325 SWISSPROT CYTIDINE DEAMINASE (CYTIDINE AMINOHYDROLASE)(CDA) Page 17 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 12615 25797 6.13 1.8E+00 AF314254.1 NT Chlamydomonas reinhardtil alternative oxidase 1 (AOX1) gene, huclear gene encoding mitochondrial protein 12692 25349 4.6 1.8E+00 9506404 NT Rattus norvegicus Aclin-related protein complex 1b (Arpc1b), mRNA LEVANSUCRASE (BETA-D-FRUCTOFURANOSYL TRANSFERASE)(SUCROSE 6 FRUCTOSYL 1135 14177 27114 2.24 1.7E+00 Q6014 SWISSPROT TRANSFERASE) 2290 15298 28305 4.2 1.7E+00 AL163280.2 NT Homo sapiens chromosome 21 segment HS21C080 2396 15401 28405 2.03 1.7E+00 AI141067.1 EST_HUMAN oz43h05.x1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:1678137 3' LEVANSUCRASE (BETA-D-FRUCTOFURANOSYL TRANSFERASE)(SUCROSE 6 FRUCTOSYL 4570 17578 30440 1.92 1.7E+00 Q6014 SWISSPROT TRANSFERASE) 5807 18879 31985 1.95 1.7E+00 be063546.1 EST_HUMAN CM0-BT0282-127-e05 BT0282 Homo sapiens cDNA 5807 18879 31986 1.95 1.7E+00 be063546.1 EST_HUMAN CM0-BT0282-127-e05 BT0282 Homo sapiens cDNA 6069 19130 32263 0.49 1.7E+00 R58748.1 EST_HUMAN G4846 Fetal heart Homo sapiens cDNA clone G4846 5' end. 6250 19303 32464 3.4 1.7E+00 Q9TTR8 SWiSSPROT COUP TRANSCRIPTION FACTOR 1 (COUP-TF1)(COUP-TF I) [PYRUVATE DEHYDROGENASE (LIPOAMIDE)]-PHOSPHATASE, MTOCHONDRIAL PRECURSOR 6832 19864 33078 0.53 1.7E+00 Q35816 SWISSPROT (PDP)(PYRUVATE DEHYDROGENASE PHOSPHATASE, CATALYTIC SUBUNIT)(PDPC) 7587 20523 33811 1.19 1.7e+00 Q03703 SWISSPROT HYPOTHETICAL 38.0 KD PROTEIN IN CAT2-AMD1 INTERGENIC REGION 7587 20523 33812 1.19 1.7e+00 Q03703 SWISSPROT HYPOTHETICAL 38.0 KD PROTEIN IN CAT2-AMD1 INTERGENIC REGION 8318 21223 0.44 1.7E+00 P06180 SWISSPROT HSTONE-BINDING PROTEIN N1/N2 8437 21369 34710 1.19 1.7E+00 AF021335.1 NT Mus musculus T cell receptor gamma locus, TCR gamma 2 and gamma 4 gene clusters 8611 21542 34884 1.31 1.7E+00 6755715 NT Mus musculus T-cell actute lymphocytic leukemia 1 (Tal1), mRNA 8640 21571 34910 0.64 1.7E+00 BF530630.1 EST_HUMAN 602071917F1 NCI_CGAP_Brn67 Homo sapiens cDNA clone IMAGE:4214669 5' 9106 22034 35386 0.56 1.7E+00 AF245513.1 NT Hippoglossus hippoglossus interfercn inducible Mx protein (Mx) mRNA, complete cds 9187 22115 1.5 1.7E+00 BF308000.1 EST_HUMAN 601894255F1 NIH_MGC_17 Homo sapiens cDNA clone IMAGE:4140084 5' 9262 22190 35547 0.65 1.7E+00 X69063.1 NT M.muscultus Ank-1 mRNA for erythrold ankyrin 9262 22190 35548 0.65 1.7E+00 X69063.1 NT M.muscultus Ank-1 mRNA for erythrold ankyrin 9373 22301 35662 0.52 1.7E+00 U19832.1 NT Rattus norvegicus SA gene, partial cds 9692 25690 35993 1.76 1.7E+00 O60479 SWISSPROT HOMEOBOXPROTEIN DLX-3 9692 25690 35994 1.76 1.7E+00 O60479 SWISSPROT HOMEOBOXPROTEIN DLX-3 10133 23024 1.26 1.7E+00 AF 161380.1 Nt hOMO SAPIENS HSPC262 mRNA, partial cds 10668 23554 0.63 1.7E+00 AW953681.1 HST_HUMAN EST365751 MAGE rasequences, MAGC Homo sapiens cDNA 12026 24868 38370 1.83 1.7E+00 W22424.1 HST_HUMAN 67B7 Human retina cDNA Tsp5091-cleaved sublibrary Homo sapiens cDNA not directional 2047 15064 28065 10.72 1.6E+00 AF199339.1 NT Homo sapiens lens opithelium-derived growth factor gene, alternalively spliced, complete cds 2057 15074 28074 3.51 1.6E+00 AF077374.1 NT Homo sapiens small prollne rich protein (SPRR3) gene, exons 1, 2, and 3 and complete cds 2063 15079 28079 1.14 1.6E+00 Y11344.1 NT Mus musculus ST6GaINAclll gene, exon 2 Page 18 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession Top Hit Descriptor SEQ ID SEQ ID Dafabase ID NO: Signal BLAST E No. NO: NO: Source Value 2303 15311 1.26 1.6E+00 X98373.1 NT B.napus gene encoding endo-polygalacturonase zd25f01.r1 Soares_fetal_heart_HbHH19W Homo sapiens cDNA clone IMAGE:341689 5' similar to 3002 16054 28958 1.25 1.6E+00 W58426.1 EST_HUMAN gb:D29805 N-ACETYLLACTOSAMME SYNTHASE (HUMAN); Homo sapiens DNA, DLEC1 to DRCTL4 gene region, section 1/2 (DLEC1, ORCTL3, ORCTL4 genes, 3825 16855 1.09 1.6E+00 AB026898.1 NT complete eds) 4115 17138 6.97 1.6E+00 BF540077.1 EST_HUMAN 602186095T1 N1H_MGC_45 Homo sapiens cDNA clone IMAGE:4310951 3' 4462 17473 30329 0.97 1.6E+00 AF155827.1 NT Homo sapiens proliferation-associated SNF2-like protein (SMARCA6) mRNA, complete cds 4462 17473 30330 0.97 1.6E+00 AF155827.1 NT Homo sapiens proliferation-associated SNF2-like protein (SMARCA6) mRNA, complete cds 5207 18198 31041 10.6 1.6E+00 AF127897.1 NT Saimiri boliviensis olfactory recptor (SBO27) gene, partial cds 5218 18208 31053 3.06 1.6E+00 Y11344.1 NT Mus musculus ST6GalNAcIII gene, exon 2 5218 18208 31054 3.06 1.6E+00 Y11344.1 NT Mus musculus ST6GalNAcIII gene, exon 2 6039 19101 32228 2.33 1.6E+00 L04808.1 NT Brachydanio rerio MHC class II DA-beta-2*01 gene, 3' end 6135 19194 32331 0.86 1.6E+00 AF005631.1 NT Homo sapiens transglutaminase type I (Tgasel) gene, promoter region 6198 19254 32399 0.48 1.6E+00 BE971873.1 EST_HUMAN 601651111R1 NIH_MGC_81 Homo sapiens cDNA clone IMAGE:3934443 3' 6198 19254 32400 0.48 1.6E+00 BE971873.1 EST_HUMAN 601651111R1 NIH_MGC_81 Homo sapiens cDNA clone IMAGE:3934443 3' 6743 19777 32990 0.85 1.6E+00 BF380703.1 EST_HUMAN IL2-UT0073-060900-145-E02 UT0073 Homo sapiens cDNA 7007 20034 33267 1.16 1.6E+00 AW294881.1 EST_HUMAN UI-H-BI2-ahr-b-04-0-UI.s1 NCI_CGAP_Sub4 Homo sapiens cDNA clone IMAGE:27275113@ 7615 20550 33842 2.24 1.6E+00 BE697267.1 EST_HUMAN RC0-CT0416-200700-032-c10 CT0415 Homo sapiens cDNA 8608 21539 1.82 1.6E+00 Q46378 SWISSPROT VIRULENCE FACTOR MVIN HOMOLOG 8950 21880 35240 3.13 1.6E+00 AJ297131.1 NT Mus musculus SIL, MAP_17, CYP_a, SCL & CYP_b genes 9457 22385 35747 1.05 1.6E+00 11437222 NT Homo sapiens hypothetical protein PRO0971 (PRO0971), mRNA 9457 22385 35748 1.05 1.6E+00 11437222 NT Homo sapiens hypothetical protein PRO0971 (PRO0971), mRNA 9992 25688 34684 1.44 1.6E+00 X52046.1 NT M.musculus COL3A1 gene for collagen alpha-I 9992 25688 34685 1.44 1.6E+00 X52046.1 NT M.musculus COL3A1 gene for collagen alpha-I 10115 23006 0.67 1.6E+00 AF043466.1 NT Thermoanaerobacter ethanolicus D-xyloce-binding protein (xylF) gene, complete cds 10254 23144 36553 1.6 1.6E+00 T41290.1 EST_HUMAN ph6b6_19/1TV Outward Alu-primed hncDNA library Homo sapiens cDNA clone ph6b6_19/1TV Drosophila melanogaster signal transducting adaptor protain (STAM), serine threonine kinase @al(IAL), and 10645 23531 36963 0.64 1.6E+00 AF121361.1 NT zinc finger protein (DNZ1) genes, complete cds 10682 23568 36997 1.08 1.6E+00 AW835644.1 EST_HUMAN QV4-LT0016-090200-100-D07 LT0016 Homo sapiens cDNA 10682 23568 36998 1.08 1.6E+00 AW835644.1 EST_HUMAN QV4-LT0016-090200-100-D07 LT0016 Homo sapiens cDNA 11209 24135 37584 2.3 1.6E+00 P54817 SWISSPROT CAPSID PROTEIN P40 [CONTAINS: ASSEMBLIN (PROTEASE) ; CAPSID ASSEMBLY PROTEIN] 11246 24170 37617 2.47 1.6E+00 P54817 SWISSPROT CAPSID PROTEIN P40 [CONTAINS: ASSEMBLIN (PROTEASE) ; CAPSID ASSEMBLY PROTEIN] nc16b02.s1 NCI_CGAP_Pr1 Homo sapiens cDNA clone IMAGE:1008267 similar to contains element MER4 11265 24188 37637 1.52 1.6E+00 AA216387.1 EST_HUMAN repetitive element; Page 19 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 11281 19194 32331 5.56 1.6E+00 AF005631.1 NT Homo sapiens transglutaminase type I (Tgasel) gene, promoter region 12129 24970 38474 3.45 1.6E+00 AF104313.1 NT Homo sapiens unknown mRNA 13064 25590 1.66 1.6E+00 AV764043.1 EST_HUMAN AV764043 MDS Homo sapiens cDNA clone MDSDAH08 5' 34 13150 26039 4.94 1.5E+00 U53449.1 NT Rattus norvegicus jun dimerization protein 2 (jdp-2) mRNA, complete cds 250 13348 26261 1.52 1.5E+00 AE002201.2 NT Chlamydophila pneumoniae AR39, section 32 of 94 of the complete genome 644 13705 1.65 1.5E+00 6752961 NT Mus musculus a disintegrin and metalloprofeinase domain (ADAM) 15 (metargidin) (Adam15), mRNA 2434 15438 28438 2.19 1.5E+00 AJ131402.1 NT Potato virus A RNA complete genome, isolate U 2541 15541 28540 2.39 1.5E+00 6678350 NT Mus musculus T-cell lymphoma invasion and metastasis 1 (Tiam1), mRNA 3183 15438 28438 1.89 1.5E+00 AJ131402.1 NT Potato virus A RNA complete genome, isolate U 3433 16474 29381 0.74 1.5E+00 AE001945.1 NT Deinococcus radiodurans R1 section 82 of 229 of the complete chromosome 1 tt12f10.x1 NCI_CGAP_GC6 Homo sapiens cDNA clone IMAGE:2240587 3' similar to TR:O00237 O00237 5930 18997 32116 1.1 1.5E+00 AI655301.1 EST_HUMAN HKF-1.; tt12f10.x1 NCI_CGAP_GC6 Homo sapiens cDNA clone IMAGE:2240587 3' similar to TR:O00237 O00237 5930 18997 32117 1.1 1.5E+00 AI655301.1 EST_HUMAN HKF-1.; 6577 19618 0.99 1.5E+00 AL163202.2 NT Homo sapiens chromosome 21 segment HS21C002 6671 19708 32903 2.34 1.5E+00 R17879.1 EST_HUMAN yg10e02r1 Soares infant brain 1N@B Homo sapiens cDNA clone IMAGE:31693 5' 7190 20190 33434 0.54 1.5E+00 BE907771.1 EST_HUMAN 601478745F1 NIH_MGC_68 Homo sapiens cDNA clone IMAGE:3881555 5' 7488 20428 1.4 1.5E+00 BE785356.1 EST_HUMAN 601478745F1 NIH_MGC_68 Homo sapiens cDNA clone IMAGE:3881555 5' 7522 20461 33747 20.78 1.5E+00 P47179 SWISSPROT HYPOTHETICAL 118.4 KD PROTEIN IN BAT2-DAL5 INTERGENIC REGION PRECURSOR 7522 20461 33748 20.78 1.5E+00 047179 SWISSPROT HYPOTHETICAL 118.4 KD PROTEIN IN BAT2-DAL5 INTERGENIC REGION PRECURSOR 7731 20663 33961 0.67 1.5E+00 AA889259.1 EST_HUMAN ak26f10.s1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1407115 3' an07b11.s1 Stratagene schizo brain S11 Homo sapiens cDNA clone IMAGE:1684893 3' similar to 8035 20950 34265 0.62 1.5E+00 AI003254.1 EST_HUMAN gb:S95936 SEROTRANSFERRIN PRECURSOR (HUMAN); 8375 21279 0.66 1.5E+00 AB039887.1 NT Homo sapiens WDR4 gene for WD repeat protein, complete cds 8699 21630 34975 1.03 1.5E+00 BE887446.1 EST_HUMAN 601509586F1 NIH_MGC_71 Homo sapiens cDNA clone IMAGE:3911181 5' 8762 21682 35025 0.54 1.5E+00 AB040887.1 NT Homo sapiens mRNA for KIAA1454 protein, partial cds 9204 22132 35488 1.11 1.5E+00 K02136.1 NT Mouse germline IgM chain gene, mu-delta region 10016 22916 36305 0.63 1.5E+00 R81928.1 EST_HUMAN yj03h01.r1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE:147697 5' 10161 23062 36453 1.33 1.5E+00 AW376697.1 EST_HUMAN QV3-CT0192-261099-008-d09 CT0192 Homo sapiens cDNA 10374 23263 36685 7.79 1.5E+00 BF375754.1 EST_HUMAN RC0-TN0078-150900-034-g05 TN0078 Homo sapiens cDNA 10555 23441 1.41 1.5E+00 BF337944.1 EST_HUMAN 602035771F1 NCI_CGAP_Bm64 Homo sapiens cDNA clone IMAGE:4183865 5' 10692 23578 37007 4.46 1.5E+00 AA017689.1 EST_HUMAN ze38g06.r1 Soares retina N2b4HR Homo sapiens cDNA clone IMAGE:361306 5' 10692 23578 37008 4.46 1.5E+00 AA017689.1 EST_HUMAN ze38g06.r1 Soares retina N2b4HR Homo sapiens cDNA clone IMAGE:361306 5' Page 20 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 11226 24152 37603 1.63 1.5E+00 U79186.1 NT Coprinus cinereus sec17-like protein (lse17) and hyphal tip 1 (hyt1) genes, complete cds 11836 24687 38176 4.39 1.5E+00 AL134197.1 EST_HUMAN EKFZp547P243_s1 547 (synonym: hfbr1) Homo sapiens cDNA clone DKFZp547P243 3' 11973 24816 4.68 1.5E+00 X07380.1 NT Meize mitochondrial Trna-Ser gene and tRNA-Phe pseudogene 12055 24896 38400 1.43 1.5E+00 AI400798.1 EST_HUMAN tg94d09.x1 NCI_CGAP_CLL1 Homo sapiens cDNA clone IMAGE:2116433 3' 12055 24896 38401 1.43 1.5E+00 AI400798.1 EST_HUMAN tg94d09.x1 NCI_CGAP_CLL1 Homo sapiens cDNA clone IMAGE:2116433 3' 12427 25189 2 1.5E+00 6763287 NT Mus musculus caspase 8 essociated protein 2 (Casp8ap2), mRNA 12776 25405 4.5 1.5E+00 AL445065.1 NT Thermoplasma acldophilum complete genome; segment 3/5 31 13147 26035 1.69 1.4E+00 7661685 NT Homo sapiens DKZP586M0122 protein (DKFZP586M0122), mRNA 31 13147 26036 1.69 1.4E+00 7661685 NT Homo sapiens DKZP586M0122 protein (DKFZP586M0122), mRNA 2296 15304 1.03 1.4E+00 AF053357.1 NT Helicobacter pylori glutamine synthetase (glnA) gene, complete cds 2356 15363 10.16 1.4E+00 U67922.1 NT Ovis aries prion protein gene, complete cds 2718 15711 28709 1.85 1.4E+00 X74463.1 NT Human papillomavirus type 7 genomic DNA Fugu rubripes neurofibromatosis type 1 (NF1), A-kinase anchor protein (AKAP84), BAW protein (BAW), and 2823 15812 28808 2.74 1.4E+00 AF064564.2 NT WSB1 protein (WSB1) genes, complete cds Fugu rubripes neurofibromatosis type 1 (NF1), A-kinase anchor protein (AKAP84), BAW protein (BAW), and 2823 15612 28809 2.74 1.4e+00 AF064564.2 NT WSB1 protein (WSB1) genes, complete cds 4354 17368 30231 1.54 1.4E+00 AW900455.1 EST_HUMAN CM0-NN1005-140300-286-h06 NN1005 Homo sapiens cDNA 4354 17368 30232 1.54 1.4E+00 AW900455.1 EST_HUMAN CM0-NN1005-140300-286-h06 NN1005 Homo sapiens cDNA 4699 17704 2.33 1.4E+00 BF681547.1 EST_HUMAN 602156687F1 NIH_MGC_83 Homo sapiens cDNA clone IMAGE:4297556 5' 5557 18635 31515 1.64 1.4E+00 AW054976.1 EST_HUMAN wi45g07.x1 NCI_CGAP_Pan1 Homo sapiens cDNA clone IMAGE:2510460 3' 5718 18791 4.98 1.4E+00 AB032983.1 NT Homo sapiens mRNA for KIAA1157 protein, partial cds 6531 19575 32757 2.62 1.4E+00 Q13472 SWISSPROT DNA TOPOISOMERASE III ALPHA 6648 25978 3.91 1.4E+00 AB020712.1 NT Homo sapiens mRNA for KIAA0905 protein, complete cds 6679 19716 32913 2.89 1.4E+00 Q92777 SWISSPROT SYNAPSIN II 6679 19716 32914 2.89 1.4E+00 Q92777 SWISSPROT SYNAPSIN II 6726 19762 32969 0.51 1.4E+00 11096333 NT Mus musculus WW domain binding protein 11 (Wbp11-pending), mRNA 6916 19946 33165 0.51 1.4E+00 BE007870.1 EST_HUMAN QV0-BN0148-050500-215-b11 BN0148 Homo sapiens cDNA 6916 19946 33166 0.51 1.4E+00 BE007870.1 EST_HUMAN QV0-BN0148-050500-215-b11 BN0148 Homo sapiens cDNA 7135 20243 33494 0.81 1.4E+00 AW893067.1 EST_HUMAN CM3-NN0006-300300-132-b12 NN0006 Homo sapiens cDNA Homo sapiens caveolin-1/-2 locus, Conlig1, D7S522, genes CAV2 (exons 1, 2a, and 2b), CAV1 (exons 1 and 7665 20599 33895 2.38 1.4E+00 AJ33269.1 NT 2) he23f05.x1 NCI_CGAP_CML1 Homo sapiens cDNA clone IMAGE:2919873 3' similar to contains Alu 7683 20617 33917 1.19 1.4E+00 AW467760.1 EST_HUMAN repetitive ELEMENT; 7749 20680 33979 0.65 1.4E+00 P55266 SWISSPROT LAMNIN BETA-2 CHAIN PRECURSOR (S-LAMININ) Page 21 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Dalabase Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 7749 20680 33980 0.65 1.4E+00 P55268 SWISSPROT LAMININ BETA-2 CHAIN PRECURSOR (S-LAMININ) 7778 20707 34010 0.59 1.4E+00 Q80905 SWISSPROT MINOR CAPSID PROTEIN L2 GLUCOAMYLASE PRECURSOR (GLUCAN 1,4-ALPHA-GLUCOSIDASE)(1,4-ALPHA-D-GLUCAN 8910 21840 0.81 1.4E+00 P07663 SWISSPROT GLUCOHYDROLASE) 9352 22280 5.77 1.4E+00 AJ271735.1 NT Homo sapiens Xq pseudoautosomal region; segment 1/2 9639 22565 35934 1.63 1.4E+00 R20459.1 EST_HUMAN yg33f12.r1 Soares infant brain 1NIB Homo sapiens cDNA clone IMAGE:34345 6' 9739 22663 36048 3.08 1.4E+00 BE064667.1 EST_HUMAN RC1-BT0313-301299-012-f05 BT0313 Homo sapiens cDNA 9773 22697 36083 0.7 1.4E+00 AF134844.1 NT Sceloporus undulatus ornithine transcarbamylase (OTC) mRNA, complete cds 10704 23590 37017 1.05 1.4E+00 BF575545.1 EST_HUMAN 602133135F1 NIH_MGC_81 Homo sapiens cDNA clone IMAGE:4288137 5' 10745 23631 37063 0.91 1.4E+00 BE145374.1 EST_HUMAN IL5-HT0198-291099-008-C04 HT0198 Homo sapiens cDNA 10745 23631 37064 0.91 1.4E+00 BE145374.1 EST_HUMAN IL5-HT0198-291099-008-C04 HT0198 Homo sapiens cDNA 11005 23889 37323 0.81 1.4E+00 D63441.1 NT Pandorina colemaniae chloroplast rbcL gene for ribulose bisphosphate cariboxylase, partial cds 11005 23889 37324 0.81 1.4E+00 D63441.1 NT Pandorina colemaniae chloroplast rbcL gene for ribulose bisphosphate cariboxylase, partial cds zr36e09.r1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:665512 5' similar to contains element 11506 24416 37870 1.47 1.4E+00 AA195528.1 EST_HUMAN MER22 repatitive element ; 11674 24578 38054 6.73 1.4E+00 AB006682.1 NT Homo sapiens APECED mRNA for AIRE-1, complete cds 11842 24693 38182 5.4 1.4E+00 BE962107.2 EST_HUMAN 60165514R1 MIH_MGC_65 Homo sapiens cDNA clone IMAGE:3845805 3' 11842 24693 38183 5.4 1.4E+00 BE962107.2 EST_HUMAN 60165514R1 MIH_MGC_65 Homo sapiens cDNA clone IMAGE:3845805 3' 11859 24749 38241 2.89 1.4E+00 U30790.1 NT Pneumocystis carinii f. sp. ratti guanine nucleotide binding protein alpha subunit (pcg1) gene, complete cds 11859 24749 38242 2.89 1.4E+00 U30790.1 NT Pneumocystis carinii f. sp. ratti guanine nucleotide binding protein alpha subunit (pcg1) gene, complete cds 12426 25815 2.1 1.4E+00 AL161500.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 12 12787 25969 1.92 1.4E+00 11546836 NT Homo sapiens cutaneous T-cell lymphoma tumor antigen se70-2 (SE70-2), mRNA 592 13659 1.99 1.3E+00 Z73640.1 NT M.mucedo gene encoding 4-Dihydromethyl-trisporate dehydrogenase 927 13979 26925 2.66 1.3E+00 AJ271192.1 NT Cantharellus sp. partial 25S rRNA gene, isolate Tibet 1156 14197 13.38 1.3E+00 Y19213.1 NT Homo sapiens putative psihl lbA pseudogene for hair keratin, exons 2 to 7 1323 14357 27304 11.53 1.3e+00 4507998 NT Homo sapiens zinc finger protein 157 (HZf22) (ZNF157) mRNA 1323 14357 27305 11.53 1.3e+00 4507998 NT Homo sapiens zinc finger protein 157 (HZf22) (ZNF157) mRNA 1384 14416 1.18 1.3E+00 U61730.2 NT Coix lacryma-jobl dihydrodipicolinate synthase (dapA) gene, complete cds 1633 14603 2.36 1.3E+00 AE002338.2 NT Chlamydia muridarum, section 66 of 85 of the complete genome Cyprinus carpio MRPb and MASPb genes for mannose-binding lectin-associated serine protease (MASP) 2258 15268 1.02 1.3E+00 AB030447.1 NT and MASP-related protein, complete cds 2429 15433 28433 0.92 1.3E+00 P25391 SWISSPROT LAMININ ALPHA-1 CHAIN PRECURSOR (LAMININ A CHAIN) Page 22 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 2582 15581 3.91 1.3E+00 BE966735.2 EST_HUMAN 601661233R1 NIH_MGC_72 Homo sapiens cDNA clone IMAGE:3915945 3' 2981 16032 28933 0.94 1.3E+00 6755621 NT Mus musculus alpha-spactrin 1, erythroid (Spna1), mRNA Fugu rubripee gemma-aminobutyric cold receptor bet@ eubunit gene, partial cds; 55kd erythrocyte membrane protein (P55), synaptio vesicle-associated integral membrane protein (VAMP-1), procollagen C-proteinase 3559 16694 29590 0.68 1.3E+00 AF016494.1 NT enhancer protein (PCOLCE) genes, complete c> 5336 18320 31168 1.36 1.3E+00 AF080222.1 NT Homo sapiens thrombin-activable fibrinolysis inhibitor gene, 5'-flanking region 5336 18320 31169 1.36 1.3E+00 AF080222.1 NT Homo sapiens thrombin-activable fibrinolysis inhibitor gene, 5'-flanking region 5704 18777 31706 0.95 1.3E+00 P19732 SWISSPROT PHENOL HYDROXYLASE P3 PROTEIN (PHENOL 2-MONDOXYGENASE P3 COMPONENT) 5908 18977 32094 0.42 1.3E+00 M27138.1 NT Human estradiol 17 beta-dehydrogenase gene, complete cds 6178 19235 32381 0.55 1.3E+00 BF663825.1 EST_HUMAN 602145264F1 NIH_MGC_48 Homo sapiens cDNA clone IMAGE:4309095 5' 6251 19304 32465 8.52 1.3E+00 AW362834.1 EST_HUMAN PM0-CT0289-291199-004-f08 CT0289 Homo sapiens cDNA 6251 19304 32466 8.52 1.3E+00 AW362834.1 EST_HUMAN PM0-CT0289-291199-004-f08 CT0289 Homo sapiens cDNA 6684 19720 32920 1.58 1.3E+00 M33496.1 NT D.melanogaster no-on-transient A gene product, complete cds 7055 20081 0.8 1.3E+00 Q00156 SWISSPROT HYPOTHETICAL GENE 64 PROTEIN 7097 20303 0.5 1.3E+00 P49940 SWISSPROT SPORE GERMINATION PROTEIN KB 7153 20261 33515 1 1.3E+00 M13918.2 NT Homo sapiens fibronectin receptor alpha-subunit precursor (ITGA5) mRNA, partial cds 7268 25664 33419 0.42 1.3E+00 AW821580.1 EST_HUMAN IL2-ST0311-020200-040-GT12 ST0311 Homo sapiens cDNA 7285 20238 33488 0.89 1.3E+00 BE538819.1 EST_HUMAN 601061420F1 NIH_MGC_10 Homo sapiens cDNA clone IMAGE:3447965 5' TCBAP1D0959 Pediatric pre-B cell acute lymphoblastic leukemia Baylor-HGSC project=TCBA Homo 7459 20399 33672 0.95 1.3E+00 BE243571.1 EST_HUMAN sapiens cDNA clone TCBAP0959 ACYLPHOSPHATASE, ORGAN-COMMON TYPE ISOZYMES A AND B (ACYLPHOSPHATE 7862 20789 34092 0.67 1.3E+00 P24540 SWISSPROT PHOSPHOHYDROLASE) 8873 21803 35157 1.69 1.3E+00 AJ009912.1 NT Sus scrofa plp gene 9015 21944 35300 2.16 1.3E+00 BE963379.2 EST_HUMAN 601657145R1 NIH_MGC_67 Homo sapiens cDNA clone IMAGE:3866195 3' 9124 22062 35412 0.95 1.3E+00 BE974280.1 EST_HUMAN 601680250R2 NIH_MGC_83 Homo sapiens cDNA clone IMAGE:3950532 3' 9268 22196 2.25 1.3E+00 9910247 NT Homo sapiens GL004 protein (GL004), mRNA 9348 22276 35638 0.99 1.3E+00 AI927629.1 EST_HUMAN wo85a07.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2462100 3' 9689 22615 35988 0.65 1.3E+00 H42881.1 EST_HUMAN yo68c03.s1 Soares breast 3NbHBst Homo sapiens cDNA clone IMAGE:183076 3' 9689 22615 35989 0.65 1.3E+00 H42881.1 EST_HUMAN yo68c03.s1 Soares breast 3NbHBst Homo sapiens cDNA clone IMAGE:183076 3' 10046 22962 5.24 1.3E+00 AF042084.1 NT Homo sapiens hoparan glucosaminyl N-deacotylase/N-sulfotraneferase-2 gene, complete cds 10054 22970 36358 2.7 1.3E+00 X72019.1 NT S.alba phr-1 mRNA for photolyase 10054 22970 36359 2.7 1.3E+00 X72019.1 NT S.alba phr-1 mRNA for photolyase 10150 23041 36440 1.16 1.3E+00 AF059250.1 NT Homo sapiens lipoxygenase (ALOX12B) mRNA, complete cds Page 23 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Aduit Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value LYSOSOMAL ALPHA-MANNOSIDASE PRECURSOR (MANNOSIDASE, ALPHA B) (LYSOSOMAL ACID 10195 23066 36487 1.87 1.3E+00 C00754 SWISSPROT ALPHA-MANNOSIDASE) (LAMAN) 10271 23161 36571 1.53 1.3E+00 AI927629.1 EST_HUMAN wo85a07.x1 NCI_CGAP_Kid11 Homo aspiens cDNA clone IMAGE:2462100 3' 10341 23230 36647 0.89 1.3E+00 AJ223962.1 NT Laclococcus lactis cremoris NCDO-inv1 chromosomal inversion junction DNA 10341 23230 36648 0.89 1.3E+00 AJ223962.1 NT Lactococcus lactis cremoris NCDO-inv1 chromosomal Inversion junction DNA 10379 23269 36690 3.8 1.3E+00 BE963379.2 EST_HUMAN 601657145R1 NIH_MGC_67 Homo sapiens cDNA clone IMAGE:3866195 3' 10709 23595 37023 1.37 1.3E+00 AE004392.1 NT Vibric cholerae chromosome II, section 49 of 93 of the complete chromosome 10725 23611 37040 1.93 1.3E+00 M29953.1 NT Gempylobecter jujuni kenemycin phosphotransferase (aphA-7) gene, complete cds 11056 23940 1.04 1.3E+00 AL163302.2 NT Homo sapiens chromosome 21 segment HS21C102 11135 24064 4.55 1.3E+00 Q14117 SWISSPROT DIHYDROPYRIMIDINASE (DHPASE) (HYDANTOINASE) (DHP) 11344 24263 37703 2.47 1.3E+00 P25299 SWISSPROT MRNA 3'-END PROCESSING PROTEIN RNA15 11366 24284 37728 2.01 1.3E+00 Z18892.2 NT Mus musculus desmin gene 11970 24813 383085 3.49 1.3E+00 D42042.1 NT Human mRNA for KIAA0085 gene, partial cds 12049 24890 38394 5.06 1.3E+00 Z98682.1 NT Bacillus subtilis genomic DNA 23.9kB fragment 12224 25058 1.39 1.3E+00 AF174585.1 NT Apple mosale virus RNA 2 putative polymerase gene, complete cds 12556 25270 3.14 1.3E+00 AF187873.1 NT Cavia porcellus inwardly-rectifying potassium channel Kir2.2 (KCNJ12) gene, complete ces 12722 25369 31800 3.77 1.3E+00 BF348043.1 EST_HUMAN 602023185F1 NCI_CGAP_Brn67 Homo saplens cDNA clone IMAGE:4158452 5' 12732 25724 1.49 1.3E+00 P33464 SWISSPROT E1 GLYCOPROTEIN PRECURSOR (MATRIXGLYCOPROTEIN) (MEMBRANE GLYCOPROTEIN) 12814 25436 1.8 1.3E+00 AF187035.1 NT Sturnira lilium cytochrome b gene, complete cds; mitochondrial gene for mitochondrial product Naphthalenesulfonate-degrading bacterlum BN6 2,3-dihydrooxybiphenyl dioxygenase (bphCll) gene, complete 13098 25614 1.54 1.3E+00 U38978.1 NT cds 673 13735 26647 7.6 1.2E+00 AA676246.1 EST_HUMAN zi22d08.s1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:431535 3' 848 13903 26843 1.31 1.2E+00 P05228 SWISSPROT HISTIDINE-RICH PROTEIN PRECURSOR (CLONE PFHRP-III) 848 13903 26844 1.31 1.2E+00 P05228 SWISSPROT HISTIDINE-RICH PROTEIN PRECURSOR (CLONE PFHRP-III) 848 13903 26845 1.31 1.2E+00 P05228 SWISSPROT HISTIDINE-RICH PROTEIN PRECURSOR (CLONE PFHRP-III) 903 13955 1.84 1.2E+00 8924234 NT Homo saplens hypothetical prctein PRO3077 (PRO3077), mRNA 1188 14227 27166 3.19 1.2E+00 AF080245.2 NT Elaeis cleifera sesquiterpens synthase mRNA, complete cds 1233 14269 27212 1.25 1.2E+00 AJ252242.1 NT pea seed-borne mosalc virus complete genome 1233 14269 27213 1.25 1.2E+00 AJ252242.1 NT pea seed-borne mosalc virus complete genome 2023 15041 28035 1.06 1.2E+00 AF140631.1 NT Homo sapiens g-protein coupled receptor 14 (GPR14) gene, complete cds 2400 15405 28408 0.99 1.2E+00 AF156495.1 NT Homo saplens post-synaptic density 95 (DLG4) gene, complete cds 3156 16206 29096 1.73 1.2E+00 AL161563.2 NT Homo sapiens mRNA for KIAA0874 protein, partial cds 3207 16255 29152 8.28 1.2E+00 AL161563.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 63 3207 16255 29153 8.26 1.2E+00 AL161563.2 NT Arabidopsis theliana DNA chrocmosome 4, contig fragment No. 63 Page 24 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) HIt Top Hit Acession SEQ ID sEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 3330 16376 4.2 1.2E+00 P54910 SWISSPROT CONJUGAL TRANSFER PROTEIN TRBE PRECURSOR 3406 16448 29356 0.67 1.2E+00 AF188740.1 NT Homo saplens LHX3 gene, intron 2 3407 16449 1.23 1.2E+00 M81779.1 NT G.gallus T-cadherin mRNA, complete cds 3776 16806 29693 10.11 1.2E+00 U75902.1 NT Mus musculus subtilisin-like serine protease LPC (PC7) gene, exons 1 to 9, partial cds 4072 17098 29981 2.441.2E+00 BF373570.1 EST_HUMAN MR0-FT0175-050900-203-g06_1 FT0175 Homo saplens cDNA 4401 16448 29356 0.97 1.2E+00 AF188740.1 NT Homo sapiens LHX3 gene, intron 2 4583 17591 2.21 1.2E+00 M87060.1 NT Ratlus rattus cardiac AE3 gene, exons 1-23 4676 17681 30549 1.88 1.2E+00 AF156495.1 NT Homo sapiens post-synaptic density 95 (DLG4) gene, complete cds 4702 17707 7.25 1.2E+00 Y09200.1 NT T.pinnatum chloroplast rbcl_ gene, partial 4795 16449 0.8 1.2E+00 M81779.1 NT G.gallus T-cadherin mRNA, complete cds 5145 18140 30983 1.25 1.2E+00 P05228 SWISSPROT HISTIDINE-RICH PROTEIN PRECURSOR (CLONE PFHRP-III) 5145 18140 30984 1.25 1.2E+00 P05228 SWISSPROT HISTIDINE-RICH PROTEIN PRECURSOR (CLONE PFHRP-III) 5145 18140 30985 1.25 1.2E+00 SWISSPROT HISTIDINE-PRICH PROTEIN PRECURSOR (CLONE PFHRP-III) 5623 18699 31597 1.33 1.2E+00 NT Human extracellular calcium-sensing receptor mRNA, complete cdo 5746 18819 31916 2.06 1.2E+00 AW813276.1 EST_HUMAN MR3-ST0191-140200-013-c05 ST0191 Homo sapiens cDNA 6007 19071 0.51 1.2E+00 X81879.1 NT Calicivirus cDNA for orf1, orf2 and orf3 6089 19150 32286 0.82 1.2E+00 AF016052.1 NT Homo sapiens zino finger protein ZNF191 (ZNF191) gene, complete cds 6392 19441 32608 2.21 1.2E+00 X74885.1 NT D.hydel ay1 repeat cluster DNA, fragment D 6457 19502 32677 4.18 1.2E+00 BE003113.1 EST_HUMAN QV4-BN0090-270400-190-a03 BN0090 Homo sapiens cDNA 6544 19587 32773 1.57 1.2E+00 X89084.1 NT C.glutamicum pta gene and eckA gene 6544 19587 32774 1.57 1.2E+00 X89084.1 NT C.glutamicum pta gene and ackA gene 6590 19631 32813 31.21 1.2E+00 AA759254.1 EST_HUMAN ah84g12 s1 Soares_testis_NHT Homo sapiens cDNA clone 1322374 3' yy39b 12.s1 Soares melanocyte 2NbHM Homo sapiens cDNA clone IMAGE:273599 3' similar to gb#M87935#HUMAALU472 Human carcinoma cell-derived Alu RNA transcript, (rRNA); gb:J04970 6704 19740 32941 0.73 1.2E+00 N33295.1 EST_HUMAN CARBOXYPEPTIDASE M PRECURSOR (HUMAN); 6778 19812 33023 0.74 1.2E+00 P17671 SWISSPROT ECDYSONE-INDUCIBLE PROTEIN E75-A 6782 19815 33027 2.02 1.2E+00 AW813276.1 EST_HUMAN MR3-ST0191-140200-013-c05 ST0191 Homo sepiens cDNA 7243 20152 33391 1.02 1.2E+00 AB0290101.1 NT Homo sapiens mRNA for KIAA1087 protein, partial cds 7257 20166 33405 2.63 1.2E+00 AJ002141.1 NT Mus musculus DSPP gene zq38f05.r1 Stratagene hNT neuron (#937233) Homo sapiens cDNA clone IMAGE:632001 5' similar to 7386 20379 33648 0.57 1.2E+00 AA167810.1 EST_HUMAN gb:D10522 Human mRNA for 80K-L protein, complete cds. (HUMAN); 7624 20559 0.75 1.2E+00 AJ271735.1 NT Homo sapiens Xq pseudoautosomal region; segment 1/2 7777 25676 34009 2.59 1.2E+00 AV734585.1 EST_HUMAN AV734585 cdA Homo sapiens cDNA clone cdAAFH03 5' 8099 21011 34337 2.59 1.2E+00 X74207.1 NT L.lactis pyrD and pyrF genes Page 25 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expresion (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 8162 21069 34398 0.44 1.2E+00 J05218.1 NT Chicken muscarinic acetylcholine receptor (cm4 mAChR) gene, complete cds 8340 21245 34579 0.47 1.2E+00 BE787646.1 EST_HUMAN 6014581761F1 NIH_MGC_68 Homo saplens cDNA clone IMAGE:3884270 5' Mus musculus major histocompatibility complex region NG27, NG28, RPS28, NADH oxidoreductase, NG29, KIFC1, Fas-binding protein, BING1, tapasin, RaIGDS-like, KE2, BING4, beta 1,3-galactosyl transferase, and 8345 21250 34585 0.48 1.2E+00 AF110520.1 NT RPS18 genes, complete cds; Sacm21 gene, partial> 9132 22060 35420 4.63 1.2E+00 AB033030.1 NT Homo sapiens mRNA for KIAA1204 protein, partial cds ALPHA,ALPHA-TREHALOSE-PHOSPHATE SYNTHASE [UDP-FORMING] 123 KD SUBUNIT (TREHALOSE-6-PHOSPHATE SYNTHASE) (UDP-GLUCOSE-GLUCOSEPHOSPHATE 9221 22149 35502 0.86 1.2E+00 P38427 SWISSPROT GLUCOSYLTRANSFERASE) 9434 22362 0.82 1.2E+00 7706271 NT Homo sapiens CGI-30 protein (LOC51611), mRNA 9576 22503 35867 2.33 1.2E+00 AW377210.1 EST_HUMAN MR2-CT0222-20199-001-e07 CT0222 Homo sapiens cDNA 9781 22705 36089 0.56 1.2E+00 H48599.1 EST_HUMAN yq80a06.r1 Soares fetal liver spieen 1NFS Homo sapiens cDNA clone IMAGE:202066 5' 9934 22839 36227 3.1 1.2E+00 Z32850.1 NT R.communis gene for pyrophosphate-depandent phosphofructokinase beta subunit 10132 23023 36419 1.9 1.2E+00 D11745.1 EST_HUMAN HUMHM01A01 Liver HopG2 cell line. Homo capiene cDNA clone hm01a01 10441 23330 36748 3.56 1.2E+00 X56832.1 NT H.sapiens ENO3 gene for muscle specific enolase 10815 23701 0.86 1.2E+00 AB009666.1 NT Homo sapiens klotho gene, exon 1 11786 24708 38200 1.74 1.2E+00 AW817817.1 EST_HUMAN PM0-ST0264-161199-001-d01 ST0264 Homo sapiens cDNA 11822 24742 12.4 1.2E+00 BE160761.1 EST_HUMAN PM1-HT0422-160200-007-g10 HT0422 Homo saplens cDNA 11890 23990 37429 5.19 1.2E+00 U50147.1 NT Rattus norvegicus synapse-associated protein 102 mRNA, complete cds 12523 25790 31577 36.12 1.2E+00 AL163203.2 NT Homo sapiens chromosome 21 segment HS21C003 12543 25262 2.45 1.2E+00 AP001515.1 NT Bacillus haloduran genomic DNA, section 9/14 486 13557 26473 1.31 1.1E+00 D86980.1 NT Human mRNA for KIAA0227 gene, partial cds 1787 14813 27782 1.2 1.1E+00 AW995393.1 EST_HUMAN QV0-BN0042-170300-163-g12 BN0042 Homo sapiens cDNA 1917 14938 27915 1.21 1.1E+00 AW575889.1 EST_HUMAN UI-HF-BR0p-ajk-f-02-0-UI.s1 NIH_MGC_52 Homo sapiens cDNA clone IMAGE:3074834 3' 3377 16421 29323 11.07 1.1E+00 AL163213.2 NT Homo sapiens chromosome 21 segment HS21C013 3377 16421 29324 11.07 1.1E+00 AL163213.2 NT Homo sapiens chromosome 21 segment HS21C013 3545 16583 29488 0.89 1.1E+00 6922641 NT Homo sapiens hypothetical protein FLJ10749 (FLJ10749), mRNA wf54h11.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2359461 3' similar to 3640 16676 29574 1.05 1.1E+00 AI808360.1 EST_HUMAN SW:P531_HUMAN Q12888 P53-BINDING PROTEIN 53BP1 ; 3782 16813 29699 1.79 1.1E+00 AE003886.1 NT Xylella fastidiosa, section 32 of 229 of the complete genome 3782 16813 29700 1.79 1.1E+00 AE003886.1 NT Xylella fastidiosa, section 32 of 229 of the complete genome 3801 16832 29718 1.96 1.1E+00 5729757 NT Homo saplens calpain 9 (nCL-4) (CAPN9) mRNA 3888 16917 0.66 1.1E+00 X85374.1 NT H.parahaemolyticus hphlM(A), hphlM(C), hphlR and manB genes 4021 17048 29937 0.67 1.1E+00 8922641 NT Homo sapiens hypothelical protein FLJ10749 (FLJ10749), mRNA page 26 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 4079 17105 29984 0.72 1.1E+00 AB040053.1 NT Oryza sativa subsp. japonica rCOP1 mRNA for COP1, complete cds 4311 17325 6.93 1.1E+00 5835331 NT R.unicomis complete mitochondrial genome 4794 17798 0.77 1.1E+00 U34992.1 NT Carcharhinus plumbeus lg lambda light chain gene, complete cds 5113 18110 30955 5.02 1.1E+00 U18466.1 NT Afrlcan swine fever virus, complete genome 5114 18111 30956 2.46 1.1E+00 AJ271740.1 NT Drosophila melanogaster D-Titin gene, exons 1-37 5204 18195 31037 1.01 1.1E+00 X78425.1 NT E.faecalis pbp5 gene 5407 18388 0.72 1.1E+00 AF140522.1 NT Glossina morsitans morsitans salivary gland growth factor-2 (TSGF-2) mRNA, complete cds 5411 18392 0.98 1.1E+00 BE409837.1 EST_HUMAN 601299534F1 NIH_MGC_21 Homo sapiens cDNA clone IMAGE:3629505 5' 5448 18529 31255 0.45 1.1E+00 P13181 SWISSPROT GALACTOSE TRANSPORTER (GALACTOSE PERMEASE) 5490 18570 31416 1.51 1.1E+00 6978530 NT Rattus norvegious Aqueporin 4 (Aqp4), mRNA 5808 18880 31987 40.8 1.1E+00 BE960184.1 EST_HUMAN 601652776R1 NIH_MGC_58 Homo sapiens cDNA clone IMAGE:3825835 3' 5828 18899 32013 14.89 1.1E+00 AI138582.1 EST_HUMAN qd85c03.x1 Scares_testis_NHT Homo sapiens cDNA clone IMAGE:1736260 3' 6329 19379 32546 1.24 1.1E+00 11419739 NT Homo saplens solute carrier family 6 (neurotransmitter transporter), member 14 (SLC6A14), mRNA 6526 19570 32753 0.65 1.1E+00 AF197861.1 NT Macgregoria pulchra cytochrome b gene, complete cds; mitoch ondrial gene for mitochondrial product 6672 19709 32904 0.68 1.1E+00 R06037.1 EST_HUMAN ye89e03.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:124924 5' 7015 20042 33276 0.71 1.1E+00 AJ404004.1 NT Mus musculus mRNA for ER protein 58 (EP58 gene) 7163 20270 33526 0.45 1.1E+00 AF267747.1 NT Mus musculus p47-phox gene, complete cds 7627 20562 0.66 1.1E+00 AF101091.1 NT Homo saplens collagen type XI alpha-1 (COL11A1) gene, exons 25 through 28 7676 20610 33909 0.68 1.1E+00 X55981.1 NT Malze mRNA for enclase (2-phospho-D-glycerate hydrolase) 7881 20807 34112 0.61 1.1E+00 BF683714.1 EST_HUMAN 602139978F1 NIH_MGC_46 Homo saplens cDNA clone IMAGE:4301322 5' 7911 20835 34137 2.14 1.1E+00 Z72338.1 NT Herpes simplex virus type 1 (strain KOS) UL41 gene 7911 20835 34138 2.14 1.1E+00 Z72338.1 NT Herpes simplex virus type 1 (strain KOS) UL41 gene 7934 20856 34164 8.75 1.1E+00 AL161588.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 84 8016 25682 34250 0.94 1.1E+00 11967960 NT Mus musculus silent mating type information regulation 2, (S.cerevlsiae, homolog)-like (Sir2l), mRNA 8709 21640 34987 3.73 1.1E+00 BF693996.1 EST_HUMAN 602082582F1 NIH_MGC_81 Homo sapiens cDNA clone IMAGE:4246628 5' 8799 21729 35078 0.86 1.1E+00 AI478339.1 EST_HUMAN tm39h11.x1 NCI_CGAP_Kid11 Homo saplene cDNA clone IMAGE:2160549 3' 9296 22224 35583 1.06 1.1E+00 AB003088.1 NT Acetabularia caliculus mitochomdrial COXI-like gene VH=anti-cytomegalovirus glycoproteln B antibody 4D4 heavy chain variable region [human, mRNA Partial, 375 9374 22302 35663 0.93 1.1E+00 S80750.1 NT nt] 9971 21329 0.58 1.1E+00 BE384876.1 EST_HUMAN 601276278F1 NIH_MGC_20 Homo sapiens cDNA clone IMAGE:3617418 5' 10154 23045 36444 0.7 1.1E+00 AJ245772.1 NT Mus musculus mRNA for stretch responsive muscle (X-chromosome) protein (Srmx gene) Page 27 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 10206 23097 0.83 1.1E+00 Y12227.1 NT Arabidopsis thaliana DNA, 24 kb surrounding PFL locus Yersinia pseudotuberculosis psaE, adhesin (psaA), chaperone (psaB), and usher (psaC) genes, 10291 23181 36593 0.56 1.1E+00 L76301.1 NT complete cds 10348 23237 36655 2.17 1.1E+00 AB023151.1 NT Homo sapiens mRNA for KIAA0934 protein, partial cds 10446 23335 36753 5.97 1.1E+00 AL161515.2 NT Arabldopsis thallana DNA chromosome 4, contig fragment No. 27 10503 23391 36802 20.33 1.1E+00 6754021 NT Mus musculus guanine nuclectide binding protein (G protein), gamma 3 subunit (Gng3). mRNA 10979 23863 37290 1.18 1.1E+00 P73769 SWISSPROT DNA MISMATCH REPAIR PROTEIN MUTS 11095 24026 37469 2.49 1.1E+00 11067364 NT Homo sapiens KIAA0626 gene product (KIAA0626), mRNA Klebsormidium fluitans cylochrome c oxidase subunit 2 (cox2) gene, mitochondrial gene encoding 11150 24079 3.12 1.1E+00 AF068942.1 NT mitochondrial protein, partial cds 11526 24436 37894 1.68 1.1E+00 11439596 NT Homo sapiens potassium inwardly-rectifying channel, subfamily J, member 11 (KCNJ11), mRNA 11543 18425 4.92 1.1E+00 8922973 NT Homo sapiens hypothetical protein FLJ11280 (FLJ11280), mRNA 11547 24456 37918 4.06 1.1E+00 AF012862.1 NT Petroselinum orispum cytosclio glucoss-6-phoephate dehydrogenase 1 (cG6PDH1) mRNA, complete cds 11547 24456 37919 4.06 1.1E+00 AF012862.1 NT Petroselinum crispum cytosolic glucose-6-phosphate dehydrogenase 1 (cG6PDH1) mRNA, complete cds 11794 24716 38208 4.19 1.1E+00 AI809699.1 EST_HUMAN wf76e11.x1 Soares_HFL_T_GBC_S1 Homo saplens cDNA clone IMAGE:2361548 3' 12002 24844 38340 1.5 1.1E+00 D89501.1 NT Human PBI gene, complete cds 12002 24844 38341 1.5 1.1E+00 D89501.1 NT Human PBI gene, complete cds 12496 25236 1.96 1.1E+00 P07866 SWISSPROT LOW TEMPERATURE ESSENTIAL PROTEIN 12591 25288 31842 2.59 1.1E+00 AF216696.1 NT Taenla sollum Immunogenic protein Ts76 mRNA, partial cds 12714 25787 2.93 1.1E+00 AF234169.1 NT Dictyostelium discoldum isopentenyl pyrophosphate isomerase (Dipl) mRNA, complete cds 102 13215 2.91 1.0E+00 U23808.1 NT Xenopus laevis rhodopsin gene, complete cds 117 13225 26137 2.72 1.0E+00 D88425.1 NT Cavia cobaya mRNA for serine/threoine kinase, complete cds 441 13512 1.72 1.0E+00 AB021684.1 NT Marchantia polymorpha genes for 26S rRNA, 5S rRNA, 18S rRNA, 5.8S rRNA and 26S rRNA 598 13665 26567 1.38 1.0E+00 AJ251660.1 NT Girardia tigrina mRNA for homeodomain transcription factor (so gene) 700 13759 26676 8.98 1.0E+00 AL163218.2 NT Homo sapiens chromosome 21 segment HS21C018 702 13761 0.89 1.0E+00 AF125984.1 NT Aedes aegypti mucin-like protein MUC1 mRNA, complete cds 1413 15900 1.41 1.0E+00 X80416.1 NT V.carteri Algal-CAM mRNA 2508 15509 28511 1.57 1.0E+00 P48355 SWISSPROT DNA GYRASE SUBUNIT B 2508 15509 28512 1.57 1.0E+00 P48355 SWISSPROT DNA GYRASE SUBUNIT B af26g08.s1 Soares_total_fetus_Nb2HF8_9w Homo sapiens cDNA clone IMAGE:1832830 3' similar to 2589 15587 0.95 1.0E+00 AA628453.1 EST_HUMAN WP:C42D8.3 CE04204 ; contains element MER22 MER22 repetitive element ; Page 28 of 545<BR> Table 4<BR> Single Exon Probes Expressed In adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 2919 15972 28869 4.6 1.0E+00 P24008 SWISSPROT 3-OXO-5-ALPHA-STEROID 4-DEHYDROGENASE 1 (STEROID 5-ALPHA-REDUCTASE 1) (SR TYPE 1) 2010 15072 28870 4.6 1.0E+00 P24008 SWISSPROT 3-OXO-5-ALPHA-STEROID 4-DEHYDROGENASE 1 (STEROID 5-ALPHA-REDUCTASE 1) (SR TYPE 1) 3008 16060 0.95 1.0E+00 O14226 SWISSPROT HYPOTHETICAL 67.9 KD PROTEIN C6F12.08C IN CHROMOSOME I af26g08.s1 Soares_total_fetus_Nb2HF8_9w Homo sapiens cDNA clone IMAGE:1032830 3' similar to 3242 16290 29193 1.18 1.0E+00 AA628453.1 EST_HUMAN WP:C42D8.3 CE04204 ; contains element MER22 MER22 repetitive alement ; 3431 16472 0.65 1.0E+00 AF222761.1 NT Rattus norvegicus neuromedin U precursor (NmU) gene, exons 5 and 6 3661 13215 0.98 1.0E+00 U23808.1 NT Xenopus laevis rhodopsin gene, complete cds 3748 16780 29669 1.99 1.0E+00 AJ223816.1 NT Agaricus bisporus mRNA for tyrosinase Homo sapiens calcium channel alpha1E subunit (CACNA1E) gene, exons 7-49, and partial cds, altematively 4157 17178 30050 1 1.0E+00 AF223391.1 NT spliced Mus musculus dipeptidyl aminopeptidase-like protein 6 (Dpp6) gene, partial cds; and proximal Rump white 5166 18158 31006 0.79 1.0E+00 AF092505.1 NT inverslon breakpoint 5394 18376 31218 0.98 1.0E+00 BE142914.1 EST_HUMAN MR0-HT0157-310300-010-g11 HT0157 Homo sapiens cDNA 5464 18545 31385 2.68 1.0E+00 Z97022.1 NT Hordeum vulgare gene encoding oysteine proteinase 6063 19125 32253 4.77 1.0E+00 AF248054.1 NT Bos taurus micromolar calcium activated neutral profease 1 (CAPN1) gene, exons 11-20, end partial cds 6063 19125 32254 4.77 1.0E+00 AF248054.1 NT Bos taurus micromolar calcium activated neutral protease 1 (CAPN1) gene, exons 11-20, and partial cds 6182 10239 32386 1.23 1.0E+00 Z97341.2 NT Arabidopsis thaliana DNA chrocmosome 4, ESSA I FCA contig fragment No. 6 6353 19402 32569 5.15 1.0E+00 P04501 SWISSPROT FIBER PROTEIN 6360 19409 32574 1.92 1.0E+00 AW452782.1 EST_HUMAN UI-H-BI3-alx-d-09-0-UI.s1 NCI_CGAP_Sub5 Homo saplens cDNA clone IMAGE:3068969 3' 6765 19799 33011 2.14 1.0E+00 U75902.1 NT Mus musculus subtilisin-like serine protease LPC (PC7) gene, exons 1 to 9, partial cds 6820 19853 33065 0.76 1.0E+00 AF104669.1 NT Homo sapiens cell cycle protein (PA2G4) gene, exons 2 though 5 6921 19951 0.9 1.0E+00 P46506 SWISSPROT SRB-11 PROTEIN 6950 19979 33202 0.48 1.0E+00 BE797716.1 EST_HUMAN 601581891F1 NIH_MGC_7 Homo sapiens cDNA clone IMAGE:3936382 5' 6950 19979 33203 0.48 1.0E+00 BE797716.1 EST_HUMAN 601581891F1 NIH_MGC_7 Homo sapiens cDNA clone IMAGE:3936382 5' 7084 20290 33549 1 1.0E+00 Y11204.1 NT V.carteri gene encoding volvoxopsin 7174 18446 31315 0.56 1.0E+00 U63721.1 NT Human elastin (ELN) gene, partial cds, and LIM-kinase (LIMK1) gene, complete cds 7498 20438 33719 1.36 1.0E+00 S52770.1 NT insulin-like growth factor-binding protein 4 [cattle, pulmonary artery endothelial cells, mRNA, 2028 nt] B-CELL RECEPTOR CD22 PRECURSOR (LEU-14) (B-LYMPHOCYTE CELL ADHESION MOLECULE) 7898 20824 9.02 1.0E+00 P20273 SWISSPROT (BL-CAM) Page 29 to 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exan Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 8171 21078 3308 1.51 1.0E+00 AF192531.1 NT Homo sapiens endothelin-converting enzyme 2 (ECE2) mRNA, complete cds 8188 21095 34426 9.27 1.0E+00 AA775191.1 EST_HUMAN ac79b08.s1 Stratagene lung (#937210) Homo sapiens cDNA clone IMAGE:868791 3' 8407 21310 0.61 1.0E+00 BF679213.1 EST_HUMAN 602153792F1 NIH NIH_MGC_83 Homo sapiens cDNA clone IMAGE:4294727 5' 8539 21470 34810 1.18 1.0E+00 BE868267.1 EST_HUMAN 601443950F1 NIH_MGC_65 Homo sapiens cDNA clone IMAGE:3848005 5' 8539 21470 34811 1.18 1.0E+00 BE868267.1 EST_HUMAN 601443950F1 NIH_MGC_65 Homo sapiens cDNA clone IMAGE:3848005 5' 8720 18431 1.60 1.0E+00 D10852.1 NT Rattus norvegicus mRNA for N-acetylglucosaminyltransferase III, complete cds PEROXISOMAL HYDRATASE-DEHYDROGENASE-EPIMERASE (HDE) (MULTIFUNGTIONAL BETA- OXIDATION PROTEIN) (MFP) [INCLUDES: 2-ENOYL-COA HYDRATASE ; D-3-HYDROXYACYL COA 8924 21854 35209 2.66 1.0E+00 Q02207 SWISSPROT DEHYDROGENASE ] PEROXISOMAL HYDRATASE-DEHYDROGENASE-EPIMERASE (HDE) (MULTIFUNGTIONAL BETA- OXIDATION PROTEIN) (MFP) [INCLUDES: 2-ENOYL-COA HYDRATASE ; D-3-HYDROXYACYL COA 8924 21854 35210 2.66 1.0E+00 Q02207 SWISSPROT DEHYDROGENASE ] UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 11 (UBIQUITIN THIOLESTERASE 11) (UBIQUITIN- 9047 21976 0.66 1.0E+00 P51784 SWISSPROT SPECIFIC PROCESSING PROTEASE 11) (DEUBIQUITINATING ENZYME 11) 9102 25689 2.23 1.0E+00 BE147331.1 EST_HUMAN RC1-HT0229-181099-011-e06 HT0229 Homo sapiens cDNA Simian Immunodeficiency virus Gag protein (gag) gene, complete cds; Pol protein (pol) gene, partial cds; and Vif protein (vif), Vpr protein (vpr), Tat protein (tat), Rev protein (rev), Vpu protein (vpu), Env protein (anv), and 9140 22068 25249 1.46 1.0E+00 U42720.2 NT Nef protein (nef) genes. > 9283 22211 35569 1.71 1.0E+00 M38427.1 NT Human Immunodeficiency virus type 1 (HIV-1), isolate SF33, 9811 22717 36099 1.83 1.0E+00 BE907592.1 EST_HUMAN 601497581F1 NIH_MGC_70 Homo sapiens cDNA clone IMAGE:3899421 5' 9903 22891 36275 0.58 1.0E+00 AF257519.1 NT Danio rerio eukaryotic translation Initiation factor elF4E-1 mRNA, complete cds 9903 22891 36276 0.58 1.0E+00 AF257519.1 NT Danio rerio eukaryotic translation Initiation factor elF4E-1 mRNA, complete cds 10014 22914 36303 1.43 1.0E+00 6753429 NT Mus musculus chloride channel calcium activated 1 (Clca1), mRNA 10014 22914 36304 1.43 1.0E+00 6753429 NT Mus musculus chloride channel calcium activated 1 (Clca1), mRNA 10137 23028 36425 1.87 1.0E+00 AV689554.1 EST_HUMAN AV689554 GKC Homo sapiens cDNA clone GKCCYA11 5' 10142 22033 36430 1.33 1.0E+00 U44952.1 NT Xenopus laevis zona pellucida C glycoprotein precursor (xIZPC) mRNA, complete cds 10142 22033 36431 1.33 1.0E+00 U44952.1 NT Xenopus laevis zona pellucida C glycoprotein precursor (xIZPC) mRNA, complete cds 10367 23256 36676 0.51 1.0E+00 X15498.1 NT Human Coronavirus gene for membrane protein 10367 23256 36677 0.51 1.0E+00 X15498.1 NT Human Coronavirus gene for membrane protein 10163 23499 36931 0.83 1.0E+00 5174562 NT Homo sapiens MHC binding factor, beta (MHCBFB) mRNA 10163 23499 36932 0.83 1.0E+00 5174562 NT Homo sapiens MHC binding factor, beta (MHCBFB) mRNA 10700 23586 37015 1.13 1.0E+00 AI077920.1 EST_HUMAN oy15d07.s1 Soares_senescent_fibroblasts_NbHSF Homo sapiens cDNA clone IMAGE:1665901 3' 10816 23702 37129 2.99 1.0E+00 AV758825.1 EST_HUMAN AV758825 BM Homo sapiens cDNA clone BMFAW C04 5' 10955 23839 37266 21.78 1.0E+00 AA004982.1 EST_HUMAN zh94a02.r1 Soares_fetal_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:428906 5' Page 30 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exan Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 10955 23839 37267 21.78 1.0E+00 AA004982.1 EST_HUMAN zh94a02.r1 Soares_fetal_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:428906 5' 10988 23872 37300 1.11 1.0E+00 L11910.1 NT Human retinoblastoma susceptibility gene exons 1-27, complete cds zi63b11.s1 Soares_fealt_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:4535453 3' similar to 11528 24438 37896 1.59 1.0E+00 AA701494.1 EST_HUMAN contains Alu repetitive element; contains element MER38 repetitive element ; 12162 18545 31385 1.57 1.0E+00 Z97022.1 NT Hordeum vulgare gene encoding cysteine proteinase 12399 25172 3.26 1.0E+00 P15306 SWISSPROT THROMBOMODULIN PRECUSOR (PETOMODULIN) (TM) 12703 25358 2.04 1.0E+00 AW976184.1 EST_HUMAN EST388293 MAGE resequences, MAGN Homo sapiens cDNA 2684 15678 28677 1.27 9.9E-01 AL163302.2 NT Homo sapiens chromosome 21 segment HS21C102 3667 16701 0.95 9.9E-01 AF174585.1 NT Apple mosaic virus RNA 2 putative polymerase gene, complete cds 5830 18901 32016 11.74 9.9E-01 P49657 SWISSPROT SERINE/THREONINE PROTEIN KINASE MINIBRAIN 5084 19145 322800.92 9.9E-01 Q09632 SWISSPROT PROBABLE OXIDOREDUcTASE ZK1290.5 IN CHROMOSOME II 9803 22709 1.76 9.9E-01 U65667.1 NT Lycopersicon esculentum putative Mi1 copy 1 nematode-resistance gene 10084 22877 2.07 9.9E-01 Q28642 SWISSPROT B2 BRADYKINN RECEPTOR (BK-2 RECEPTOR) 11157 24086 37533 2.45 9.9E-01 AJ005029.1 NT Danio rario mRNA for Eph-like receptor tyrosine kinase rtk8 546 13515 26523 1.13 9.8E-01 P22567 SWISSPROT AMINO-ACID ACETYLTRANSFERASE (N-ACETYLGLUTAMATE SYNTHASE) (AGS) (NAGS) 2316 15324 1.1 9.8E-01 AJ003108.1 NT Calithrix jacchus UBE1 gene derived retroposon on the Y chromosome Enterobacteriacese sp. JM983 partial groES gene for GroES-like protein and partial groEL gene for GroEL- 7554 20501 33789 4.61 9.8E-01 AJ302158.1 NT like protein, isolate JM983 Enterobacteriacese sp. JM983 partial groES gene for GroES-like protein and partial groEL gene for GroEL- 7554 20501 33790 4.61 9.8E-01 AJ302158.1 NT like protein, isolate JM983 8094 21006 34330 1.23 9.8E-01 BF034015.1 EST_HUMAN 601456337F1 NIH_MGC_60 Homo sapiens cDNA clone IMAGE:3860049 5' 8094 21006 34331 1.23 9.8E-01 BF034015.1 EST_HUMAN 601456337F1 NIH_MGC_60 Homo sapiens cDNA clone IMAGE:3860049 5' 9278 22206 35563 0.98 9.8E-01 P38652 SWISSPROT PHOSPHOGLUCOMUTASE (GLUCOSE PHOSPHOMUTASE) (PGM) 10918 23803 0.71 9.8E-01 AA825566.1 EST_HUMAN od55d04.s1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE:1371847 3' 11432 24348 37793 2.02 9.8E-01 BE258705.1 EST_HUMAN 601110258F1 NIH_MGC_16 Homo sapiens cDNA clone IMAGE:3350750 5' 11432 24348 37794 2.02 9.8E-01 BE258705.1 EST_HUMAN 601110258F1 NIH_MGC_16 Homo sapiens cDNA clone IMAGE:3350750 5' Homo sapiens X28 region near ALD locus containing dual specificity phosphatase 9 (DUSP9), ribosomal protein L18a (RPL18a), Ca2+/Calmodulin-dependent protein kinese I (CAMKI), creatine transporter (CRTR), 12598 25984 1.64 9.8E-01 U52111.2 NT CDM protein (CDM), adreneleukodystrophy protein > Drosophila melanogaster sodium channel protein (para) gene, exons 9, 10, 11, 12 and optional segments b, c, d 7520 20459 33745 2.22 9.7E-01 U26716.1 NT and e, partial cds 9070 21999 35353 1.89 9.7E-01 AF149112.1 NT Triticum sestivum stripe rust resistance protein Yr10 (Yr10) gene, complete cds 9076 22005 35359 1.49 9.7E-01 M90544.1 NT Salmonella typhimurium adenine-methyltransferase (mod) and restriction endonuclease (res) 9397 22325 35688 0.62 9.7E-01 BE799822.1 EST_HUMAN 601592165F1 NIH_MGC_7 Homo sapiens cDNA clone IMAGE:395904 5' Page 31 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exan Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 11612 24520 5.75 9.7E-01 BF511209.1 EST_HUMAN UI-HBI4-aci-e-07-0-UI.s1 NCI_CGAP_Sub8 Homo sapiens cDNA clone IMAGE:3085140 3' 13105 25520 5.01 9.7E-01 AL114281.1 NT Botrytis cineres strain T4 cDNA library under conditions of nitrogen deprivation 4544 17553 30413 0.71 9.6E-01 AF197925.1 NT Bromus inermie putative cytosolie phosphoglucomutase (pgm1) mRNA, complete cds 4544 17553 30414 0.71 9.6E-01 AF197925.1 NT Bromus inermie putative cytosolie phosphoglucomutase (pgm1) mRNA, complete cds 4569 17577 30439 1.72 9.6E-01 AW799674.1 EST_HUMAN PM2-UM0053-240300-005-f12 UM0053 Homo sapiens cDNA 5960 19027 32147 3.54 9.6E-01 Z70556.1 NT Parvovirus B19 DNA, partient C, genome position 2448-2994 5960 19027 32148 3.54 9.6E-01 Z70556.1 NT Parvovirus B19 DNA, partient C, genome position 2448-2994 7051 20077 33310 0.55 9.6E-01 Z97341.2 NT Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig fragment No. 6 7747 20578 33976 0.5 9.6E-01 AF197881.1 NT Helix lucorum presenilin (PS) mRNA, complete cds 8963 21893 1.74 9.6E-01 X95275.1 NT P. faiciparum complete gene map of plastid-like DNA (IR-A) 9410 22338 35702 0.85 9.6E-01 L81138.1 NT Rattus norvegicus (strain R21) Rps2r gene, complete cds 11530 24440 37899 1.44 9.6E-01 AF041427.1 NT Homo sapiens ribosomal protein s4 Y isoform gene, complete cds 11951 24795 38294 4.1 9.6E-01 AV752605.1 EST_HUMAN AV752605 NPD Homo sapiens cDNA clone NPDBAG06 5' 11951 24795 38295 4.1 9.6E-01 AV752605.1 EST_HUMAN AV752605 NPD Homo sapiens cDNA clone NPDBAG06 5' 12308 25115 2.73 9.6E-01 11421722 NT Homo sapiens centrosomal protein 2 (CEP2), mRNA Sphyma tiburo NADH dehydrogenase subunit 2 (NADH2) gene, mitochondrial gene encoding mitochondrial 12887 25856 31473 1.88 9.6E-01 U91423.1 NT protein, partial cds 2498 15500 28501 1.34 9.5E-01 7705591 NT Homo sapiens CGI-125 protein (LOC51003), mRNA 3847 16876 29759 2.53 9.5E-01 BE902340.1 EST_HUMAN 80675639F1 NIH_MGC_21 Homo sapiens cDNA clone IMAGE:3958473 5' 3847 16876 29760 2.53 9.5E-01 BE902340.1 EST_HUMAN 80675639F1 NIH_MGC_21 Homo sapiens cDNA clone IMAGE:3958473 5' 9553 22430 35839 0.83 9.5E-01 AI190162.1 EST_HUMAN qd57d07.x1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1733581 3' 9650 22576 35947 1.2 9.5E-01 AW861102.1 EST_HUMAN RC1-CT0295-241199-011-b02 CT0295 Homo sapiens cDNA 11690 24592 38070 1.89 9.5E-01 BF218771.1 Homo sapiens 601885163F1 NIH_MGC_57 Homo sapiens cDNA clone IMAGE:4103630 5' 11885 23985 37423 1.63 9.5E-01 AW293799.1 EST_HUMAN UI-H-BI2-ahp-f-03-0-UI.s1 NCI_CGAP_Sbu4 Homo sapiens cDNA clone IMAGE:2727677 3' 12196 25031 38532 2.32 9.5E-01 T67204.1 EST_HUMAN ya53d04.s1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:66631 3' 3245 16293 4.67 9.4E-01 AF165990.1 NT Bartonella clarridgeise RNA polymerase beta subunit (rpoB) gene, partial cds 3264 16312 2.72 9.4E-01 AF080595.1 NT Pimpinella brachysampa zinc finger protein (ZFP1) mRNA, complete cds 9423 22351 35717 0.78 9.4E-01 M90724.1 NT Human Fo-gamma-receptorliA (FCGR2A) gene, exon 4 12547 25255 1.59 9.4E-01 BE781251.1 EST_HUMAN 601466703F1 NIH_MGC_67 Homo sapiens cDNA clone IMAGE:3869929 5' Homo sapiens epidermal growth factor receptor (avian erythroblastio leukemia viral (v-arb-b) oncogene 12886 25782 1.45 9.4E-01 11419857 NT homolog) (EGFR), mRNA 1762 14788 7.14 9.3E-01 AF242382.1 NT Homo sapiens phytanoyl-CoA hydroxylase (PHYH) gene, exon 5 2680 15675 28674 1.35 9.3E-01 BE071172.1 EST_HUMAN RC5-BT05030271199-011-B01 BT0503 Homo sapiens cDNA 4119 17142 30014 1.43 9.3E-01 M20219.1 NT Bovine papillomavirus type 2, complete genome Page 32 of 535<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exan Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 4119 17142 30015 1.43 9.3E-01 M20219.1 NT Bovine papillomavirus type 2, complete genome Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 (NFKB1) gene, complete 5786 18858 31966 1.57 9.3E-01 AF213884.1 NT cds 5875 18945 32061 3.99 9.3E-01 L36189.1 NT Spodoptera frugiperda methylenetetrahydrofolate dehydrogenase mRNA, complete cds 7717 20649 0.84 9.3E-01 AF270648.1 NT Plasmodium falciparum mature parasite-infected erythrocyte surface antigen (MESA) gene, complete cds 8644 21575 34912 2.15 9.3E-01 AA847040.1 EST_HUMAN ce09b03.s1 NCI_CGAP_Ov2 Homo sapiens cDNA clone IMAGE:1385357 9372 22300 0.99 9.3E-01 AF061981.1 NT Xenopus laevis CCCH zinc finger protein C3H-2 (C3H-2 (C3H-2) mRNA, complete cds 9493 22421 35784 0.89 9.3E-01 AL161534.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 34 12991 25547 31753 31753 1.62 9.3E-01 11440298 NT Homo sapiens inositol 1,4,5-triphosphate receptor, type 2 (ITPR2), mRNA 12998 25551 2.01 9.3E-01 AF271207.1 NT Aedes triseriatus putative large subunit ribosomal protien rpL34 mRNA, complete cds 3285 16332 29238 5.18 9.2E-01 BE622702.1 EST_HUMAN 601441338T1 NIH_MGC_72 Homo sapiens cDNA clone IMAGE:3916154 3' 6919 18986 1.47 9.2E-01 71106410 NT Mus musculus solute carrier family 30 (zinc transporter), member 4 (Sic30a4), mRNA 6218 19273 32427 4.94 9.2E-01 BF037586.1 EST_HUMAN 601461153 F1 NIH_MGC_66 Homo sapiens cDNA clone IMAGE: 3864661 5' 6924 19953 33173 0.5 9.2E-01 M64703.1 NT N. crassa valyl-tRNA synthetase (cyt-20/un-3) gene 10184 23075 36476 0.87 9.2E-01 AL161565.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 65 10268 23158 36569 0.9 9.2E-01 6671677 NT Mus musculus carbonic anhydrase 4 (Car4), mRNA 10758 23644 37077 4.12 9.2E-011 11430963 NT Homo sapiens lysosomal apyrase-like protein 1 (LALP1), mRNA 7o58e06.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:3578219 3' similar to SW:NU5M_TRYBB 10899 23784 37210 1.63 9.2E-01 BF593251.1 EST_HUMAN P04540 NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 5 ; 11091 24022 37464 1.94 9.2E-01 BE563811.1 EST_HUMAN 601334943F1 NIH_MGC_39 Homo sapiens cDNA clone IMAGE:3688714 5' 12144 24984 38484 1.72 9.2E-01 BF132402.1 EST_HUMAN 601820312F1 NIH)MGC_58 Homo sapiens cDNA clone IMAGE:4052018 5' ye52f01.s1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE: 121369 3' similar to contains 1648 14679 27642 1.15 9.1E-01 T96675.1 EST_HUMAN Alu repetitive element; 2138 15151 0.96 9.1E-01 8923056 NT Homo sapiens hypothetical protein protein FLJ20048 (FLJ20048), mRNA 3249 16297 29200 0.98 9.1E-01 T26418.1 EST_HUMAN AB200G8R Infant brain, LLNL array of Dr. M. Scarec 1NiB Homo sapiens cDNA clone LLAB200G8 5' 3249 16297 29201 0.98 9.1E-01 T26418.1 EST_HUMAN AB200G8R Infant brain, LLNL array of Dr. M. Scarec 1NiB Homo sapiens cDNA clone LLAB200G8 5' 4547 17556 1.71 9.1E-01 D17428.1 NT Corynebacterium glutamicum secA gene for SecA protein, complete cds 6408 19456 32630 1.43 9.1E-01 L36033.1 NT Human pre-B cell stimulsting factor homologue (SDF1b) mRNA, complete cds 6783 19816 33028 3.41 9.1E-01 Q61704 SWISSPROT INTER-ALPHA-TRYPSIN INHIBITOR HEAVY CHAIN H3 PRECURSOR (ITI HEAVY CHAIN H3) 8010 20927 34244 17.06 9.1E-01 AA806623.1 EST_HUMAN ob71g08.s1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE:1336862 3' 8202 21108 34438 2.17 9.1E-01 U72995.1 NT Rattus norvegicus Rab3 GDP/GTP exchange protein mRNA, complete cds Page 33 of 535<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exan Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 10672 23558 36990 0.71 9.1E-01 P38432 SWISSPROT P80-COILIN 12632 25849 28.85 9.1E-01 AF050113.1 NT Homo sapiens uncoupling protein-3 (UCP3) gene, complet cds 3251 16299 29204 1.05 9.0E-01 7661625 NT Homo sapiens DKFZP564M2423 protein (DKFZP564M2423), mRNA 4486 17497 30357 1.31 9.0E-01 AF099810.1 NT Homo sapiens neurexin III-aphe gene, partial cds 5139 18134 30977 0.83 9.0E-01 AF017729.1 NT Oryctolagus cuniculus Rad51 (RAD51) mRNA, complete cds 7790 20719 34023 0.71 9.0E-01 L42547.1 NT Danio LIM class homeodomain protein (lim5) mRNA, complete cds 7822 20751 1.33 9.0E-01 D38621.1 NT Xenopus laevis gene for aldolase, complete cds 9887 22802 36189 0.52 9.0E-01 AF086761.1 NT Danio rerio samaphorin Z1a mRNA, complete cds 10345 23234 36652 0.52 9.0E-01 U39702.1 NT Mycoplasma genitalium section 24 of 51 of the complete genome Fugu rubripes neural cell adhesion molecule L1 homolog (L1-CAM) gene, complete cds; putative protein 1 (PUT1) gene, partial cds; mitosis-specific chromosome segregation protein SMC1 omolog (SMC1) gene, 5895 18964 32081 2.54 8.9E-01 AF026198.1 NT complete cds; and calcim channel alpha-1 subunit> 6497 19541 1.29 8.9E-01 X60986.1 NT Rabbit MHC fragment RLA-DF DNA 6734 25653 32977 0.57 8.9E-01 BF217939.1 EST_HUMAN 601882708F1 NIH_MGC_57 Homo sapiens cDNA clone IMAGE:4095216 5' 6734 25653 32978 0.57 8.9E-01 BF217939.1 EST_HUMAN 601882708F1 NIH_MGC_57 Homo sapiens cDNA clone IMAGE:4095216 5' 7567 20503 0.52 8.9E-01 AB042297.1 NT Homo sapiens PTS gene for 6-pyruvoyltetrahydropterin synthase, complete cds 7636 20571 33866 0.46 8.9E-01 AA194201.1 EST_HUMAN zr38c06.r1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:665674 5' 7636 20571 33867 0.46 8.9E-01 AA194201.1 EST_HUMAN zr38c06.r1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:665674 5' 8789 21719 0.51 8.9E-01 AF260225.1 NT Homo sapiens TESTIN 2 and TESTIN 3 genes, complete cds, altermatively spliced Oithona nana cytochrome-c oxidase subunit (coxl) gene, partial cds; mitochondrial gene for mitochendrial 8996 21925 35280 0.87 8.9E-01 AF259667.1 NT product 12193 26028 38529 2.36 8.9E-01 AE003944.1 NT Xylella fastidiosa, section 90 fo 229 of the complete genome 12481 25225 3.78 8.9E-01 AE002186.2 NT Chlamydophila pneumoniae AR39, section 21 of 94 of the complete genome 4658 17663 30531 2.44 8.8E-01 O25350 SWISSPROT PUTATIVE F420-DEPENDENT NADP REDUCTASE 5347 18330 31179 9.96 8.8E-01 L41654.1 NT Trypanosoma brucel microtuble-associated protein (MAPP15) mRNA, 3' end of cds 5558 18636 31516 0.8 8.8E-01 AF310617.1 NT Pseudorables virus Ea glycoprotein M gene, complete cds 7957 20879 34190 0.47 8.8E-01 M81182.1 NT Homo sapiens peroxisomal 70 kD membrane protein mRNA, complete cds 10726 23612 37041 0.57 8.8E-01 7656978 NT Homo sapiens cell death-inducing DFFA-like effector B (CIDEB), mRNA 11520 24430 37868 2.8 8.8E-01 Z28337.1 NT M. aeruginosa (HUB 5-2-4) DNA from plasmid PMA1 12323 25926 4.13 8.8E-01 D90911.1 NT Synechocystis sp, PCC6803 complete genome, 13/27, 1576593-1719643 487 13558 26474 1.49 8.7E-01 AF106953.2 NT Homo sapiens SOS1 (SOS1) gene, partial cds 2424 15428 28429 0.91 8.7E-01 5901893 NT Homo sapiens AT-binding transcrition factor 1 (ATBF1), mRNA 2918 15971 28868 5.93 8.7E-01 AA595863.1 EST_HUMAN nn05f11.s1 NCI_CGAP_Pr4.1 Homo sapiens cDNA clone IMAGE:1076877 Page 34 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top HitDescriptor ID NO: Signal BLAST E No. NO: NO: Source Value Pseudomonas aeruginosa topoisomerase (top), putative transcriptional regulatory protein OhbR (ohbR), otho- halobenzoate 1,3-dioxygenase beta-ISP protein OhbA (ohbA), OhbC(ohbC), ortho-halobenzoate 1,2- 5129 18125 3.52 8.7E-01 AF121970.1 NT dioxygenase alpha-ISP probein OhbB(ohbB), and put> 5330 18314 0.75 8.7E-01 AJ288065.1 NT Homo sapiena partiel LGALS9 gene for geletin-9, exon 3 5359 18342 31186 0.73 8.7E-01 BF219306.1 EST_HUMAN 601883175F1 NIH_MGC_57 Homo sapiens cDNA clone IMAGE:4095378 5' 8617 21548 34889 0.65 8.7E-01 AW897335.1 EST_HUMAN RC4-NN0057-120500-013-c07 NN0057 Homo sapiens cDNA 9485 22413 35774 0.74 8.7E-01 A1239456.1 EST_HUMAN qh36e06.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA cione IMAGE:1846786 3' 9485 22413 35775 0.74 8.7E-01 A1239456.1 EST_HUMAN qh36e06.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA cione IMAGE:1846786 3' 10258 23148 36556 1.77 8.7E-01 AE004963.1 NT Pseudomonas aeruginosa PA01, section 524 of 529 of the complete genome 10793 23679 37108 0.59 8.7E-01 BF570169.1 EST_HUMAN 602185541T1 NIH_MGC_45 Homo sapians cDNA clone IMAGE:4309906 3' 10793 23679 37109 0.59 8.7E-01 BF570169.1 EST_HUMAN 602185541T1 NIH_MGC_45 Homo sapiens cDNA clone IMAGE:4309906 3' 11271 24193 37644 6.02 8.7E-01 BF363970.1 EST_HUMAN QV0-NN1021-100800-337-c03 NN1021 Homo sapiens cDNA 12157 24996 38496 4.03 8.7E-01 BF107694.1 EST_HUMAN 601823684R1 NIH_MGC_79 Homo sapiens cDNA clone IMAGE:4043564 3' 12157 24996 38497 4.03 8.7E-01 BF107694.1 EST_HUMAN 601823684R1 NIH_MGC_79 Homo sapiens cDNA clone IMAGE:4043564 3' 12679 25755 2.12 8.7E-01 AV661898.1 EST_HUMAN AV661898 GLCHomo saplens cDNA clone GLCGYG07 3' 497 13567 1.55 8.6E-01 X17012.1 NT Rat IGFII gene for insulin-like growth factor II 883 13936 26884 4.44 8.6E-01 W69089.1 EST_HUMAN zd44e03.r1 Soares_fetal_heart_NbHH19W Homo sapiens cDNA clone IMAGE:343516 5' Homo sapiens cytochrome P450, subfamlly XXVIIA (steroid 27-hydroxylase, cerebrotendinous 2289 15297 28304 1.17 8.6E-01 4503210 NT xanthamatosis), polypeplide 1 (CYP27A1b) mRNA 3686 16719 29611 0.9 8.6E-01 AL161565.2 NT Arabidopsis thaliana DNA chromosome 4, config fragment No. 65 3865 16894 29778 1.54 8.6E-01 U49724.1 NT Drosophila melanogaster merlin (Dmerlin) mRNA, complete ods Clostridium histolyticum genes for hypoxanthine-guanine phosphoribosyl-transferase (HGPRT Tase), GTPase 5413 18394 1.6 8.6E-01 AB014075.1 NT and 12 ORFs, complete and partial cds 6116 19175 32309 8.31 8.6E-01 X60547.1 NT Chicken lipoprotein lipase gene 6116 19175 32310 8.31 8.6E-01 X60547.1 NT chlcken lipoprotein llpase gene polyprotein [Coxsackie B4 virus CB4, host=mice, E2, originally derived from Edwards CB4 human strain, 6639 25651 32868 0.51 8.6E-01 S76772.1 NT Genomic RNA Complete, 7397 nt] 7006 20033 33265 1.98 8.6E-01 AF143732.1 NT Grus canadensis recombination activating protein 1 (RAG-1) gene, opartial cds 7006 20033 33266 1.98 8.6E-01 AF143732.1 NT Grus canadensis recombination activating protein 1 (RAG-1) gene, opartial cds 7951 20873 0.63 8.6E-01 AE000591.1 NT Heliobaotor pylori 26695 section 69 of 134 of the complete genome 8506 21437 1.45 8.6E-01 AP001518.1 NT Bacillus halodurans genomic DNA, section 12/14 8620 21551 34892 0.78 8.6E-01 AF077837.1 NT Drosophila melanogaster collapsin response mediator protein (CRMP) mRNA, complete cds 7027 20053 33285 1.25 8.5E-01 AF165214.1 NT Bacteriophage D3, complete genome 7949 20871 34182 2.54 8.5E-01 BE542612.1 EST_HUMAN 601067107F1 NIH_MGC_10 Homo sapiens cDNA clone IMAGE:3453505 5' Page 35 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 8570 21501 34844 0.53 8.5E-01 AL161572.2 NT Arabldopsis thallana DNA chromosome 4, contig fragment NO. 68 8989 21918 35273 0.76 8.5E-01 P06601 SWISSPROT SEGMENTATION PROTEIN PAIRED 8989 21918 35274 0.76 8.5e-01 p06601 SWISSPROT SEGMENTATION PROTEIN PAIRED 9071 22000 35354 1.41 8.5E-01 AJ243213.1 NT Homo sapiens partial 5-HT4 receptor gene, exons 2 to 5 10837 23723 37145 2.64 8.5E-01 AB006799.1 NT Cyanidium caldarium gene for SigC, complete cds 10837 23723 37146 2.64 8.5E-01 AB006799.1 NT Cyanidium caldarium gene for SigC, complete cds 12617 25852 3.3 8.5E-01 11418543 NT Horno sapiens human immunodeficiency virus type I enhancer-binding protein 1 (HIVEP1), mRNA 12624 25308 7.93 8.5E-01 9507008 NT Rattus norvegicus protein tyrosine phosphalase, non-receptor type 5 (Ptpn 5), mRNA 4299 17313 30180 1.03 8.4E-01 AF143509.1 NT Mus musculus NK cell receptor 2B4 gene, promoter region and partial cds 5682 25631 31677 2.54 8.4E-01 L78726.1 NT Human fibroblast growth factor recaptor 3 (FGFR3) gene, intron 7 5682 25631 31678 2.54 8.4E-01 L78726.1 NT Human fibroblast growth factor receptor 3 (FGFR3) gene, intron 7 8322 21227 34561 0.2 8.4E-01 AF051142.1 NT Mamestra brassicae pheromone binding protein 2 precursor (PBP2) mRNA, complete cds 10464 23352 3.57 8.4E-01 AJ248287.1 NT Pyrococcus abyssi complete genome ; segment 5/6 765 13822 26751 2.8 8.3E-01 M93437.1 NT Thermus thermophilus cytochrome c-552 (cycA) and CycB (cycB) genes, complete cds 3142 16192 29085 4.33 8.3E-01 AL161506.2 NT Arabidopsis thaliana DNA 3878 16907 29788 0.81 8.3E-01 AB010879.1 NT Nicotiana tabacum mRNA for chloroplast ribosomal protein L10, complete cds 4098 17123 30000 3.46 8.3E-01 Y19177.1 NT Streptomyces antibloticus polyketide blosynthetic gene cluster 5451 18532 31258 2.38 8.3E-01 AL161540.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 40 nn01f12.y5 NCI_CGAP_Co9 Homo sapiens cDNA clone IMAGE:1076495 5' similar to contains THR.t1 THR 10194 23085 3.67 8.3E-01 AI791952.1 EST_HUMAN repetitive element ; 10611 23497 36928 1.42 8.3E-01 AF098070.1 NT Drosophila melanogaster Lis1 homolog mRNA, complete cds 10714 23600 37027 4.01 8.3E-01 AF108133.1 NT Mus musculus neuro-d4 gene, exon 3 through 12 and partial cds Methanobacterium thermoautotrophicum from bases 1270510 to 1283409 (section 109 of 148) of the 11118 24048 37494 2.58 8.3E-01 AE000903.1 NT complete genome 11133 24062 1.91 8.3E-01 7212472 NT Phytophthora infestans milochondrion, complete genome 11749 24650 38131 1.78 8.3E-01 AF020503.1 NT Homo sapiens FRA3B common fragile region, diadenosine triphosphate hydroalse (FHIT) gene, exon 5 2066 15081 28080 1.68 8.2E-01 AB000489.1 NT Rattus norvegicus mRNA for RPHO-1, complete cds 2102 15116 1.82 8.2E-01 AF145589.1 NT Mus musculus trophinin (Tnn) gene, complete cds 2728 15721 1.47 8.2E-01 AW376990.1 EST_HUMAN IL3-CT0219-161199-031-C08 CT0219 Homo sapiens cDNA 3994 17021 29911 0.99 8.2E-01 AF063417.1 NT Tanystylum orbiculare elongation factor 1-alpha mRNA, pertial cds 5249 18236 31086 0.98 8.2E-01 AB000489.1 NT Rattus norvgegicus mRNA for RPHO-1, complete cds 6935 19964 33185 0.59 8.2E-01 X95283.1 NT G.gallus mRNA for C-Serrate-1 protein 6935 19964 33186 0.59 8.2E-01 X95283.1 NT G.gallus mRNA for C-Serrate-1 protein Page 36 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ IDDatabase Top Hit Desoriptor ID NO: Signal BLAST E No. NO: NO: Source Value 7081 20287 33546 0.82 8.2E-01 AJ010142.1 NT Amanita muscaria mRNA for SCIII25 protein 7225 20224 33472 3.3 8.2E-01 AW379433.1 EST_HUMAN CM4-HT0243-081199-037-e01 HT0243 Homo sapiens cDNA S.oerevisiae MET, LEU4, and POL1 genes encoding MET4 protein, alpha-isoproplymalate (alpha-IPM) 7645 25673 33875 4.16 8.2E-01 Z12126.1 NT synthetase (parlial), and DNA polymerase alpha (partial) 9012 21941 35297 0.62 8.2E-01 BE263145.1 EST_HUMAN 501144885F2 NIH_MGC_19 Homo saplens cDNA clone IMAGE:3160412 5' 9492 22420 35782 0.57 8.2E-01 AW614205.1 EST_HUMAN hg77g11.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2951684 3' 9492 22420 35783 0.57 8.2E-01 AW614205.1 EST_HUMAN hg77g11.x1 NCI_CGAP_KId11 Homo sapiens cDNA clone IMAGE:2951684 3' 10528 23414 36828 0.6 8.2E-01 AB014530.1 NT Homo sapiens mRNA for KIAA0630 protein, partial cds 10561 23447 36869 2.17 8.2E-01 AF052659.1 NT Homo sapiens thioredoxin-related protein mRNA, complete cds 10719 23605 37034 0.56 8.2E-01 AF223888.1 NT Oncorhynchus tshawytscha isolata T-20 somatolactin precursor gene, exon 1 10719 23605 37035 0.56 8.2E-01 AF223888.1 NT Oncorhynchus tshawytscha isolata T-20 somatolactin precursor gene, exon 1 10873 23759 37185 4.09 8.2E-01 Q9JI70 SWISSPROT MCKUSICK-KAUFMAN/BARDET-BIEDL SYNDROMES PUTATIVE CHAPERONIN 10873 23759 37186 4.09 8.2E-01 Q9JI70 SWISSPROT MCKUSICK-KAUFMAN/BARDET-BIEDL SYNDROMES PUTATIVE CHAPERONIN 12068 24909 38412 4 8.2E-01 L10127.1 NT Mollusoum contagiosum virus type 1 ORF1 and ORF2 DNA 12151 24990 38490 6.37 8.2E-01 P10383 SWISSPROT OVARIAN TUMOR LOCUS PROTEIN yw14d02.r1 Soares_placenta_8togweeks_2NbHP8togW Homo sapiens cDNA clone IMAGE:252195 5' 12158 24997 38498 6.67 8.2E-01 H87398.1 EST_HUMAN similer to gb:M36072 60S RIBOSOMAL PROTEIN L7A(HUMAN). 12641 25317 31820 3.05 8.2E-01 AJ001261.1 NT Mus musculus mRNA for NIPSNAP2 protein 2809 15798 1.26 8.1E-01 AF191839.1 NT Mus musculus TANK binding kinase TBK1 (Tbk1) mRNA, complete cds 3518 16556 29457 3.4 8.1E-01 AF055066.1 NT Homo sapiens MHC class 1 region 3518 16556 29458 3.4 8.1E-01 AF055066.1 NT Homo sapiens MHC class 1 region 5029 18026 0.67 8.1E-01 AF202634.1 NT Drosophila melanogaster Na/K-ATPase beta subunit isoform 4 (JYbeta2) mRNA, complete cds MELANOCYTE STMULATING HORMONE RECEPTOR (MSH-R) (MELANOTROPIN RECEPTOR) 5906 18975 32093 0.51 8.1E-01 Q01727 SWISSPROT (MELANOCORTIN-1 RECEPTOR) (MC1-R) 6570 19611 32796 0.8 8.1E-01 U16790.1 NT Mus musculus putative collagen alpha-2 (XI) chain (COL11A2) gene, partial cds 6912 19942 33160 2.69 8.1E-01 Q13491 SWISSPROT NEURONAL MEMBRANE GLYCOPROTEIN M6-B 6912 19942 33161 2.69 8.1E-01 Q13491 SWISSPROT NEURONAL MEMBRANE GLYCOPROTEIN M6-B 7935 20857 34165 0.57 8.1E-01 O47477 SWISSPROT GYTOCHROME B Drosophila melanogaster putative inorganic phosphate cotransporter (Picot) gene, partial cds ; putative sodium ohannel (Nach) and putative amylaec-related protein (Amyrel) gonec, comploto cds; and putative cerine- 8490 21421 34759 1.21 8.1E-01 AF022713.2 NT enriched protein (gprs) gene, partial od> Drosophila melanogaster putative inorganic phosphate cotransporter (Plcot) gene, partial cds ; putative sodium channel (Nach) and putative amylase-related protein (Amyrel) genes, complete cds ; and putative serine- 8490 21421 34760 1.21 8.1E-01 AF022713.2 NT enriched protein (gprs) gene, partiel cd> Page 37 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Slmilar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 9170 22098 35458 0.99 8.1E-01 AP001517.1 NT Bacillus halodurans genomic DNA, section 11/14 9170 22098 35459 0.99 8.1E-01 AP001517.1 NT Bacillus halodurans genomic DNA, section 11/14 xn01h03.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2692469 3' simlar to SW:LYAP_MOUSE Q08288 CELL GROWTH REGULATING NUCLEOLAR PROTEIN. ; contains MER22.b1 PTR5 repetitive 9329 22257 35621 1.24 8.1E-01 AW242647.1 EST_HUMAN element ; 10625 3511 36944 0.56 8.1E-01 P06425 SWISSPROT PROBABLE E4 PROTEIN KK9872F Human fetal heart, Lambda ZAP Express Homo sapiens cDNA clone KK9872 5' similar to 10896 23781 37208 0.55 8.1E-01 NB4541.1 EST_HUMAN EST(CLONE C-0PE11) 11914 24761 38257 3.42 8.1E-01 BE938558.1 EST_HUMAN RC0-TN0080-220800-025-d10 TN0080 Homo sapiens cDNA 11914 24761 38258 3.42 8.1E-01 BE938558.1 EST_HUMAN RC0-TN0080-220800-025-d10 TN0080 Homo sapiens cDNA 12377 25157 31871 1.51 8.1E-01 AE001711.1 NT Thermotoga maritima section 23 of 136 of the complete genome 187 13286 2.84 8.0E-01 AJ271510.1 NT Staphylococcus aureus partial pta gene for phosphate actyltransferase allele 15 308 13401 26318 8.55 8.0E-01 AJ132772.1 NT Bos taurus futb and rtlf genes 2049 15066 1.46 8.0E-01 BF530962.1 EST_HUMAN 602072473F1 NCI_CGAP_Brn67 Homo sapiens cDNA clone IMAGE:421 5091 5' 3126 16177 29072 1.18 8.0E-01 AF127897.1 NT Saimiri boliviensis olfactory receptor (SBO27) gene, partial cds 3358 16402 29303 0.9 8.0E-01 AB006193.1 NT Mus musculus gene for oviductal glycoprotein, complete cds 3767 16799 0.98 8.0E-01 AL162758.2 NT Neisseria meningitidis serogroup A strain Z2491 complete genome ; segment 7/7 4649 17655 30521 7.44 8.0E-01 X83739.2 NT G.gallus mRNA for nicotinic acetyicholine recaptor (nAChR) beta 3 subunit 5103 18100 30948 1.18 8.0E-01 7657352 NT Mus musculus myosin IXb (Myc9b), mRNA 5345 18328 31177 0.91 8.0E-01 BE277215.1 EST_HUMAN 601178571F1 NIH_MGC_20 Homo sapiens cdNA clone IMAGE:3051088 5' 8569 21500 1/.96 8.0E-01 AW901489.1 EST_HUMAN RC0-NN1012-270300-021-h06 NN1012 Homo saplens cDNA 9089 22018 35374 1.38 8.0E-01 Y11095.1 NT Rice stripe virus RNA 3 11394 24310 37756 1.54 8.0E-01 Q92793 SWISSPROT CREB-BINDING PROTEIN 476 13547 26467 1.01 7.9E-01 E11476.1 NT Lymantria dispar nuclear polyhedrosisvirus gene for DNA polymerase, complete cds 738 13796 0.92 7.9E-01 AE002130.1 NT Ureaplasma urealyticum section 31 of 59 of the complete genome 1627 14657 15.76 7.9E-01 AB040885.1 NT Homo sapiens mRNA for KIAA1462 protein, partial cds 1682 14712 0.97 7.9E-01 U32739.1 NT Haemophillus influenzae Rd section 54 of 163 of the complete genome 2280 15289 28297 6.28 7.9E-01 AB004816.1 NT Oryctolagus cuniculus mRNA for mitsugumln29, complete cds 2281 15290 28298 2.4 7.9E-01 AF130459.1 NT Danio rerio Trp4-associated protein Tap1A(tap1A) mRNA, complete cds 3576 16613 29516 3.17 7.9E-01 AF228664.1 NT Gallus gallus SOX8 transcription factor (SOX8) mRNA, complete cds 4403 17415 0.67 7.9E-01 BE263612.1 EST_HUMAN 601192033F1 NIH_MGC_7 Homo sapiens cDNA clone IMAGE:3535785 5' 4722 17727 30590 0.82 7.9E-01 6753745 NTR Mus musculus embigin (Emb), mRNA 4722 17727 30591 0.82 7.9E-01 6753745 NTR Mus musculus embigin (Emb), mRNA 5320 18304 0.68 7.9E-01 AF139718.1 NT Chrysomya bezziana perltrophin-48 precursor, gene, complete cds Page 38 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Slmilar Probe Exon top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E NO. NO: NO: Source Value 6602 19643 32825 0.69 7.9E-01 D38145.1 NT Human mRNA for for prosiacyclin synthase, complete cds 8687 21618 34960 5.93 7.9E-01 X90996.1 NT P.sativum GR gene 10076 22991 36387 4.42 7.9E-01 U01912.1 NT Giardia lamblia variant-specific surface protein G3M-B (vspG3M-B) mRNA, partial cds 10552 23438 36859 4.89 7.9E-01 P19719 SWISSPROT SMALL HYDROPHOBIC PRO TEIN 10593 23479 36906 0.9 7.9E-01 AV700860.1 EST_HUMAN AV700860 GKC C Homo Sapiens cDNA clone GKCDRE12 3' 10989 23873 37301 0.97 7.9E-01 AB000631.1 nT Streptococcus mutans DNA for sigma 42 protein, dTDP-4-keto-L-rhamnose reductase, complete cds 11445 24361 2.21 7.9E-1 7662471 NT Homo sapiens KIAA1072 protein (KIAA1072), mRNA 11660 24566 38039 2.63 7.9E-01 P19022 WISSPROT NEURAL-CADHERIN PRECURSOR (N-CADHERIN) 901 13953 1.78 7.8E-01 Z43785.1 EST_HUMJAN HSC1KH041 nomallzed infant brain cDNA Homo sapiens cDNA clone c-1kh04 2294 15302 28308 3.77 7.8E-01 AW95967.1 EST_HUMAN EST371637 MAGE resequences, MAGF Homo sapiens cDNA Methanobacterium thermoautotrophicum from bases 862690 to 876388 (section 75 of 148) of the complete 4613 17621 30484 0.87 7.8E-01 AE000869.1 NT genome 4814 17815 30682 1.15 7.8E-01 U87305.1 NT Rattus norvegicus transmembrane receptor Unc5H1 mRNA, complete cds 5348 18331 0.72 7.8E-01 Z43785.1 EST_HUMAN HSC1KH04 normallzed infant brain cDNA Homo sapiens cDNA clone c-1kh04 6304 19355 32526 2.06 7.8E-01 AF115856.1 NT Sphenodon punctatus alpha enolase mRNA, partial cds INTERLEUKIN-6 PRECURSOR (IL-6) (B-CELL STIMULATORY FACTOR 2) (BSF-2) (INTERFERON 6463 19508 32684 1 7.8E-01 P05231 SWISSPROT BETA-2)(HYBRIDOMA GROWTH FACTOR) 6735 19769 32979 0.66 7.8E-01 q09908 SWISSPROT HYPOTHETICAL 60.7 KD PROTEIN C30D11.08C IN CHROMOSOME I 9060 21989 35342 1.28 7.8E-01 BF108927.1 EST_HUMAN 7154d05.x1 Soares_NSF_F8_9W_OT_PA_P_S1 Homo sapiens cDNA clone IMAGE:3525176 3' 9775 22699 36085 1.44 7.8E-01 Y10159.1 NT D.discoideum racGAP gene 9872 22787 36177 0.53 7.8E-01 4826873 NT Homo sapiens nucleoporin 214kD (CAIN) (NUP214), mRNA 10624 23510 1.15 7.8E-01 Q25452 SWISSPROT MUSCLE CALCIUM CHANNEL ALPHA-1 SUBUNIT (MDL-ALPHA1) 12611 25833 1.86 7.8E-01 L29260.1 NT Arabidopsis thaliana 1-amino-1-cyclopropanecarboxylate synthase (ACS5) gene, complete cds 149 13249 26168 5.28 7.7E-01 AF184345.1 NT Lycopersicon hirsutum ADP-glucose pyrophosphorylase large subunit (AGP-L1) mRNA, complete cds Mus musculus major histocompatibility locus class II region: major histocompatibility protein class II alpha chein (IAalpha) and major histocompatibility protein class II beta chain (IEbeta) genes, complete cds ; 749 13806 1.94 7.7E-01 AF050157.1 NT butyrophilin-like (NG9), butyrophilin-li> 2761 15753 28749 1.85 7.7E=01 O33915 SWISSPROT CITRATE SYNTHASE 3055 16107 29013 11.84 7.7E-01 AB011094.1 NT Homo sapiens mRNA for KIAA0522 protein, partial cds Homo sapiens UDP-N-acetyl-alpha-D-gelactosemine:polypeptide N-acetylgalactosaminylttransferase 7 3409 16451 0.79 7.7E-01 8393408 NT (GaINAC-T7) (GALNAC-T7), mRINA Page 39 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID sEQ ID Database Top Hit Descriptor Signal BLAST E No. NO: NO: Source value 3662 16696 29592 4.62 7.7E-01 AF118085.1 NT Homo sapiens PRO1975 mRNAm, complete cds 4503 17513 30379 2.52 7.7E-01 AF199488.1 NT Cotumix coturnix japonica sub-species japonica beta-actin mRNA, partial cds 4503 17513 30370 2.52 7.7E-01 AF199488.1 NT Cotumix coturnix japonica sub-species japonica beta-actin mRNA, partial cds 5752 18825 31923 1.38 7.7E-01 P16553 SWISSPROT RAFFINOSE INVERTASE (INVERTASE) 5752 18825 31924 1.38 7.7E-01 P16553 SWISSPROT RAFFINOSE INVERTASE (INVERTASE) 6181 19238 32385 0.86 7.7E-01 RO08600.1 EST_HUMAN yf24b02.s1 Soares fetal liver spleen 1NFLS Homo sapiens cDA clone IMAGE:127755 3' 10359 23248 36668 0.63 7.7E-01 AB021134.1 NT Daphnia magna hemoglobin gene cluster (dhb3, dhb1 and dhb2 genes), complete cds 12505 25240 6.05 7.7E-01 11497621 NT Archaeoglobus fulgidus, complete genome Arabidopsis thaliana 3-methylcrotonyl-CoA carboxylase non-biotinylated subunit (MCCB) mRNA, complets 6336 19386 32554 3.97 7.6E-01 AF059510.1 NT cds Arabidopsis thaliana 3-methylcrotonyl-CoA carboxyiase non-biotinylated subunit (MCCB) mRNA, complete 6336 19386 32555 3.97 7.6E-01 AF059510.1 Nt cds 6796 19829 33039 0.78 7.6E-01 P37938 SWISSPROT MATING-TYPE PROTEIN A-ALPHA Z4 7170 18442 31311 0.97 7.6E-01 AI253399.1 EST_HUMAN aq14b12.x1 Stanley Frontal NS pool 2 Homo sapiens cDNA clone IMAGE:2030879 7170 18442 31345 0.97 7.6E-01 AI253399.1 EST_HUMAN eq14b12.x1 Stanley Frontal NS pool 2 Homo sapiens cDNA clone IMAGE:2030879 7404 20103 33338 0.93 7.6E-01 U72487.1 NT Ratlus norvegicus calcium-independent alpha-latrotoxin receptor mRNA, complete cds Mus musculus neuromedin U precursor (Nmu) gene, parlial cds ; tPhLP (Tphlp) gene, partial cds ; CLOCK 8642 21573 34911 1.44 7.6E-01 AF146793.2 NT (Clock) gene, complete cds ; PFT27 (Pft27) gene, complete cds ; and H5AR(H5ar) gene, complete cds 8703 21634 34979 2.41 7.6E-01 6857752 NT Mus musculus advillin (Advil-pending), mRNA 8703 21634 34970 2.41 7.6E-01 6857752 NT Mus musculus advillin (Advil-pending), mRNA GLUTAMATE [NMDA] RECEPTOR SUBUNIT EPSIL ON 3 PRECURSOR (N-METHYLD-ASPARTATE 8900 21830 35183 0.6 7.6E-01 Q01098 SWISSPROT RECEPTOR SUBTYPE 2C) (NR2C) (NMDAR2C) GLUTAMATE [NMDA] RECEPTOR SUBUNIT EPSIL ON 3 PRECURSOR (N-METHYL D-ASPARTATE 8900 21830 35184 0.6 7.6E-01 Q01098 SWISSPROT RECEPTOR SUBTYPE 2C) (NR2C) (NMDAR2C) 9519 22446 35810 1.53 7.6E-01 6753577 NT Mus musculus cylochrome P450, 2b9, phenobarbitol inducible, type a (Cyp2b9), mRNA 9819 22725 36108 3.76 7.6E-01 P30372 SWISSPROT MUSCARINIC ACETYLCHOLINE RECEPTOR M2 9819 22725 36109 3.76 7.6E-01 P30372 SWISSPROT MUSCARINIC ACETYLCHOLINE RECEPTOR M2 11796 24718 38210 2.5 7.6E-01 XS86347.1 NT H.aspersa mRNa for neurofilament NF70 11796 24718 38211 2.5 7.6E-01 XS86347.1 NT H.aspersa mRNa for neurofilament NF70 12133 24974 3.69 7.6e-01 AL161592.2 NT Arabidopsis thaliana DNA chromosome 4, ontlg fragment No. 88 12289 25100 5.4 7.6E-01 AB020702.1 NT Homo sapiens mRNA for KIAA0895 protein, partial cds 536 13605 1.29 7.5E-01 AL163301.2 NT Homo sapiens chromosome 21 segment HS21 C101 Page 40 of 545<BR> Table 4<BR> Sigle Exon Probes Expressed in Aduit Livewr Most Similar Probe Exon Top Hit ORF SEQ Expression (top) Hit top Hit acession SEQ ID SEQ ID Database Top Hit Dascriptor ID NO: Signal BLAST E No. NO: NO: Source Value 605 13671 26574 1.39 7.5E-01 AF020503.1 NT Harno sapiens FRA3B common fraglle region, diadenosine triphosphate hydrolase (FHIT) gene, exon 5 3413 16455 29361 1.22 7.5E-01 C14203.1 EST_HUMAN C14203 Clontech human aorta polyA+ mRNA (#6572) Homo sapiens cDNA clone GEN-037E11 5' 4785 17790 1.71 7.5E-01 U48498.1 NT Human skeletal musole ryanodine receptor gene (RYR1), exon 92 5338 18415 1.15 7.5E-01 U48498.1 NT Human skeletal muscle ryanodine receptor gene (RYR1), exon 92 7945 20867 34179 0.85 7.5E-01 AF052730.1 NT Drosphila melanogaster typosine kinase receptor protein (eph) mRNA, complete cds 12569 25274 4.74 7.5E-01 AF163151.2 NT Homo sapiens dentin sialophosphoprotein precursor (DSPP) gene, complete cds 13001 25553 31757 1.95 7.5E-01 D90907.1 NT Synechocystis sp. PCC6803 complete genome, 9/27, 1056467-1188885 tn14b09.x1 NCI_CGAP_Bm25 Homo spiens cDNA clone IMAGE:2167577 3'similer to contains Alu 1157 14198 27134 1.1 7.4E-01 AI598146.1 EST_HUMAN repetitive elementcontains element MIR repeitive element ; 2366 15372 28375 1.03 7.4E-01 AB011106.1 NT Homa sapiens mRNA for KIAA0534 protein, partial cds 3790 16821 29708 1.38 7.4E-01 AF112538.1 NT Maiva pusilla actin (Act1) mRNA, complete cds 3973 17001 29888 0.69 7.4E-01 AF133310.1 NT Vibrio cholerae phage CTXphi Calculta-rstR-a (rstR-a) and Calcutta-rstR-b (rstR-b) genes, complete cds 4416 17427 302389 4.86 7.4E-01 AL163246.2 NT Homo sapiens chromosome 21 segment HS21C046 8426 21358 34697 1.09 7.4E-01 AL161551.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 51 8426 21358 34698 1.09 7.4E-01 AL161551.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 51 9192 22120 35476 0.9 7.4E-01 BF346266.1 EST_HUMAN 602018456F1 NCI_CGAP_Brn67 Homo sapiens cDNA clone IMAGE:4154340 5' Rattus norvegicus leukocyle common enfigen receptor (LAR) gene, trans-spliced alternative untransiated 9242 22200 0.9 7.4E-01 U87960.1 NT exon 9642 22568 35939 7.39 7.4E-01 BE747503.1 EST_HUMAN 601573026F1 NIH MGC_9 Homo sapiens cDNA clone IMAGE:3834174 5' zp67h01.s1 Stratagene endothelial cell 937223 Homo sapiens cDNA clone IMAGE:625297 3' similar to 9699 22624 36002 1.31 7.4E-01 AA187986.1 EST_HUMAN SW:TCPQ_MOUSE P42932 T-COMPLEX PROTEIN 1, THETA SUBUNIT : 10887 23772 37198 0.62 7.4E-01 11424933 NT Homo sapiens NY-REN-45 antigen (LOC51133), mRNA 13090 24931 38436 1.43 7.4E-01 AB021490.2 NT Oryzies latipes gene for membrane guenylyl cyclase OIGC1, complete cds 12090 24931 38437 1.43 7.4E-01 AB021490.2 NT Oryzias latipes gene for membrane guanylyl cyclase OIGC1, complete cds 12257 25077 5.27 7.4E-01 6753217 NT Mus musculus complement component 1 inhibitor (C1nh), mRNA 12363 25150 1.88 7.4E-01 AI472641.1 EST_HUMAN ta13h01.x1 NCI_CGAP_Lym5 Homo sapiens cDNA clone IMAGE:2043985 3' 4059 17085 0.72 7.3E-01 AP000062.1 NT Aeropyrum pernix genomic DNA, section 5/7 4729 17734 30596 0.7 7.3E-01 AE001166.1 NT Borrelia burgdorferi (section 62 of 70) of the complete genome 4813 17814 30681 4.08 7.3E-01 AF225421.1 NT Homo sapiens HT017 mRNA, complete cds 5238 18225 31074 0.95 7.3E-01 O43103 SWISSPROT FERICHROME SIDEROPHORE PEPTIDE SYNTHETASE 6893 19923 33137 5.62 7.3E-01 L35772.1 NT Mus musculus antigen (CD72) gene 6893 19923 33138 5.62 7.3E-01 L35772.1 NT Mus musculus antigen (CD72) gene Page 41 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon top Hit ORF SEQ Expression (Top) Hit Top Hit Acession Top Hit Descriptor SEQ ID SEQ ID Database ID NO: Signal BLAST E No. NO: NO: Source Value 7453 25670 33664 0.9 7.3E-01 A.J01141.1 NT Lycopersicon esculentum mRNA for ubiquitin activating enzyme 7863 20790 34093 0.45 7.3E-01 Z14133.1 NT D.melenogaster Chc mRNA for ciathrin heavy chain 7977 20898 34211 8.65 7.3E-01 M26511.1 NT V.alginolytious sucrase (scrB) gene, complete ods 7977 20898 34212 8.65 7.3E-01 M26511.1 NT V.alginolyticus sucrase (scrB) gene, complete ods 8332 21237 34570 0.51 7.3E-01 U34631.1 NT Mus musculus alphs-4 integrin gene, exon 7 11862 24752 38245 8.93 7.3E-01 AA678019.1 EST_HUMAN zi15b08.s1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:431799 3' 11862 24752 38246 3.93 7.3E-01 AA678019.1 EST_HUMAN zi25b08.s1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:431799 3' 856 13910 241 7.2E-01 L29281.1 NT Rattus norvegicus initiation factor-2 kinase (eIF-2a) mRNA, complete cds 1971 14989 27972 1.78 7.2E-01 X79140.1 NT N.tabacum NeIF-4A13 mRNA 2485 15487 24844 1.5 7.2E-01 AB009605.1 NT Gailus gallus gene for melanocorlin 2-receptor, complete cds 3115 16166 29060 1.5 7.2E-01 AF198100.1 NT Fowlpox virus, complete genome 3514 16552 29452 237 7.2E-01 AF065606.1 NT Giardia intestinalis veriant-specific surface protein (vsp417-6) gene,vsp417-6/A-I ellele, complete cds 3678 16711 29602 1.43 7.2E-01 AB002307.1 NT Human mRNA for KIA0309.gene, partial cds 3940 16968 29851 0.97 7.2E-01 BF338350.1 EST_HUMAN 602035589F1 NCI_CGAP_Brn61 Homo sapiens cDNA clone IMAGE:4183222 5' 4149 17170 0.78 7.2E-01 AF108093.1 NT Homo sapiens IA-2 gene, intron 18 4882 17881 30746 2.94 7.2E-01 D90314.1 NT L.mesenteroids gene for sucrose phosphorylase (EC 2.4.1.7) Homo sapiens transcription factor IGHM enhancer 3, JM11 protein, JM4 protein, JM5 protein, T54 protein, JM10 protein, A4 differentiation-dependent protein, triple LIM domain protein 6, and syaptophysin genes, 5264 18250 31100 1.27 7.2E-01 AF198779.1 NT cornplete cds; and L-type calcium channel a> Homo sapiens transcription factor IGHM enhancer 3, JM11 protein, JM4 protein, JM5 protein, T54 protein, JM10 protein, A4 differentiation-dependent protein, triple LIM domain protein 6, and synatophysin genes, 5264 18250 31101 1.27 7.2E-01 AF196779.1 NT cornplete cds; and L-type calcium channel a> 5396 18378 31220 1.94 7.2E-01 Z97335.2 NT Arabidopsis thaliana DNA chromosome 4, ESA I FCA contig fregment No. 0 7580 20516 33804 1.04 7.2E-01 U69633.1 NT Solanum tuberosum cold-stress inducible protein (C17) gene, complete cds 8046 20959 0.44 7.2E-01 9625875 NT Human herpesvirus 3, complete genome tp38b01.x1 NCI_CGAP_Ut4 Homo sapiens cDNA cione IMAGE:2190025 3' similar to gb:M23115 CALCIUM- 8288 21192 34529 0.48 7.2E-01 AI610765.1 EST_HUMAN TRANSPORTING ATPASE SARCOPLASMIC RETICULLUM TYPE, SLOW (HUMAN); 9022 21951 35307 1.44 7.2-01 AF236061.1 NT Oryctollagus cuniculus RIN-finger binding protein mRNA, partial cds 9516 22443 0.6 7.2E-01 AV743773.1 EST_HUMAN AV743773 CB Homo sapiens cDNA clone CBMAFD06 5' 10828 23714 37140 2.4 7.2E-01 BF670061.1 EST_HUMAN 602118381F1 NIH_MGC_56 Homo sapiens cDNA clone IMAGE:4275361 5' 11180 24106 37553 3.59 7.2E-01 U82623.1 NT Rattus norvegicus cytocentrin mRNA, complete cds 11698 24600 1.49 7.2E-01 AW450487.1 EST_HUMAN UI-HB13-elco-g-01-Ul.s1 NCI_CGAP_Sub5 Homo sepiens cDNA clone IMAGE:2735040 3' 12575 18427 31351 1.74 7.2E-01 U02568.1 NT Dictyocaulus viviparus nematode polyprotein antigen precursor (Dva) mRNA, complete cds Page 42 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top)Hit Top Hit Acession SEQ SEQ Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 12757 25391 4.27 7.2E-01 AP000063.1 NT Aeropyrum pernix genomic DNA, section 6/7 Rana catesbeiana mRNA for bullfrog skeletal muscle calcium release channel (ryanodine) receptor) alpha 716 13774 26694 11.44 7.1E-01 D21070.1 NT isoform(RyR1), complete cds 3110 16161 29057 20.14 7.1E-01 AJ270777.1 NT Homo sapiens partial TCF-1 gene for T-cell transcription factor-1, exons 15-16 4304 17318 30186 5.04 7.1E-01 7305360 NT Mus musculus ctogelin (Otog), mRNA 4304 17318 30187 5.04 7.1E-01 7305360 NT Mus musculus otogelin (Otog), mRNA 6173 19230 32376 1.65 7.1E-01 BF681034.1 EST_HUMAN 602155438F1 NIH_MGC_83 Homo sapiens cDNA clone IMAGE:4296344 5' 6173 19230 32377 1.65 7.1E-01 BF681034.1 EST_HUMAN 602155438F1 NIH_MGC_83 Homo sapiens cDNA clone IMAGE:4296344 5' 7281 20234 33484 6.39 7.1E-01 U36232.1 NT Drosophila melanogaster 6-pyruvoylteirahydropterin synthase (pr) gene, complete cds 8769 21699 35044 0.58 7.1E-01 H54244.1 EST_HUMAN yq89d09.s1 Soeres fetel liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:202961 3' 9295 22223 35581 0.95 7.1E-01 BE074185.1 EST_HUMAN RC1-BT0567-301299-011-d09 BT0567 Homo sapiens cDNA 9295 22223 35582 0.95 7.1E-01 BE074185.1 EST_HUMAN RC1-BT0567-301299-011-d09 BT0567 Homo sapiens cDNA 10369 23258 36680 1.56 7.1E-01 BE904405.1 EST_HUMAN 60149630F1 NIH_MGC_70 Homo sapiens cDNA clone IMAGE:3898495 5' 10894 23779 37206 1.29 7.1E-01 M12961.1 NT Human T-cell receptor germline gamma-chain J2 gene 12557 25768 2.16 7.1E-01 AA421492.1 EST_HUMAN zu06h11.s1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:731109 3' 1257 14292 27237 0.86 7.0E-01 AB014514.1 NT Homo sapiens mRNA for KIAA0614 protein, partial cds 1257 14292 27238 0.86 7.0E-01 AB014514.1 NT Homo sapiens mRNA for KIAA0614 protein, partial cds yz73e07.s1 Soares_multiple_sclerosis_2NbHMSP Homo sapiens cDNA clone IMAGE:288708 3' similar to 2473 15476 28476 1.54 7.0E-01 N62412.1 EST_HUMAN contains Alu repetitive element; yz73e07.s1 Soares_multiple_sclerosis_2NbHMSP Homo sapiens cDNA clone IMAGE:288708 3' similar to 2473 15476 28477 1.54 7.0E-01 N62412.1 EST_HUMAN contains Alu repetitive element; 5189 18181 2.5 7.0E-01 AL163301.2 NT Homo sapiens chromosome 21 segment HS21C101 6177 19234 0.86 7.0E-01 AB021316.1 NT Arabldopsis thaliana mRNA for chlorophyll b synthase, complete cds 8949 21879 7.02 7.0E-01 AE000253.1 NT Escherichia coli K-12 MG 1655 section 143 of 400 of the complete genome 11560 24469 37934 1.62 7.0E-01 AV763842.1 EST_HUMAN AV763842 MDS Homo sapiens cDNA clone MDSCHE04 5' 11560 24469 37935 1.62 7.0E-01 AV763842.1 EST_HUMAN AV763842 MDS Homo sepiens cDNA clone MDSCHE04 5' 13055 25800 31581 2.36 7.0E-01 9630464 NT Bacterlophage N15 virion, complete genome Candida albicans squalene epoxidase (CAERG1) gene, complete cds and translational regulator gene, partial 995 14046 26989 66.92 6.9E-01 U69674.1 NT cds Candida albicans squalene epoxidase (CAERG1) gene, complete cds and translational regulator gene, partial 996 14046 26990 66.92 6.9E-01 U69674.1 NT cds 1336 14370 27320 2.26 6.9E-01 AA593530.1 EST_HUMAN nn28a09.s1 NCI_CAGP_Gas1 Homo sapeins cDNA clone IMAGE:1085176 3' 3266 14370 27320 2.26 6.9E-01 AE002271.2 NT Chlamydia muridarum, section 3 of 85 of the complete genome 5992 19057 32184 0.79 6.9E-01 AB035662.1 NT Branchiostoma belcheri BbNA3 mRNA for notochord actin, complete cds Page 43 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon top Hit ORF SEQ Expression (Top) HIt Top Hit Acession SEQ ID SEQ ID ID NO: Signal BLAST E No. NO: NO: Source Value 6221 19276 32430 0.63 6.9E-01 Y18278.1 NT Drosophila melanogaster mRNA for A-Idenase anchor protein DAKAP550, partial 6630 19670 32855 1.62 6.9E-01 BE296188.1 EST_HUMAN 601177333F1 NIH_MGC_17 Homo sapiens cDNA clone IMAGE:3532328 5' 8291 21195 34532 1.23 6.9E-01 AF248863.1 NT Strongylocentrotus purpuratus myosin V, complete cds 8559 21490 34830 2.89 6.9E-01 AL161573.2 NT Arabidopsis thaliana DNA chromosome 4, cotig fragement NO. 69 8559 21490 34831 2.83 6.9E-01 AL161573.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 69 9713 22638 0.72 6.9E-01 AF118046.1 NT Entamoeba dispar cation transporting ATPase (atpase) gene, partial cds 10217 23108 36508 0.61 6.9E-01 AF206319.1 NT Musa acuminata pectate lyase 1 (PL1) mRNA, complete cds 10217 23108 36509 0.61 6.9E-01 AF206319.1 NT Musa acuminata pactate lyase 1 (PL1) mRNA. complete cds 11705 24607 38083 2.1 6.9E-01 D89013.1 NT Homo sapiens DAN gene, complete cds 11705 24607 38084 2.1 6.9E-01 D89D13.1 NT Homo sapiens DAN gene, complete cds FORKHEAD BOX PROTEIN C2 (FORKHEAD-RELATED PROTEIN FKHL14) (MESENCHYME FORK 12239 26763 1.75 6.9E-01 Q99958 SWISSPROT HEAD PROTEIN 1)(MFH-1 PROTEIN)(TRANSCRIPTION FACTOR FKH-14) 983 14034 26977 1.36 6.8E-01 AF017784.1 NT Giardia intestinalis carbamate kinase gene, complete cds 2723 16716 2.04 6.8E-01 D90917.1 NT Synechocyslis sp. PCC6803 complete genome, 27/27, 3418852-3573470 ej75aD5.s1 Soares_parathyroid_tumor_NbHPA Homo sapeins cDNA clone IMAGE: 1402256 3' similar to 2877 14668 27631 1.19 6.8E-01 AA854475.1 EST_HUMAN gb:X56411_ma1 ALCOHOL DEHYDROGENASE CLASS II PI CHAIN (HUMAN); 4687 17692 30559 1.56 6.8E-01 J00762.1 NT Rat(hooded) prolactin gene : exon iii and flanks 4966 17964 30822 0.7 6.8E-01 4758521 NT Homo sapiens hevin (HEVIN) mRNA 10164 23055 36454 1.66 6.8E-01 AB037766.1 NT Homo sapiens mRNA for KIAA1345 protein, partial cds 11529 24439 37897 2.17 6.8E-01 AJ276675.1 NT Stagonospora avenae bgI1 gene for beta-glucosidase, exons 1-4 11529 24439 37898 2.17 6.8E-01 AJ276675.1 NT Stagonospora avenae bgI1 gene for beta-glucosidase, exons 1-4 11554 24463 37928 2.65 6.8E-01 AF038939.1 NT Mus musculus zinc finger protein (Peg3) mRNA, complete cds 11554 24463 37929 2.65 6.8E-01 AF038939.1 NT Mus musculus zinc finger protein (Peg3) mRNA, complete cds 11745 24646 38126 1.39 6.8E-01 AF164151.1 NT Anopheles gambias strain M2 transiation initiation factor 4C (1A) (aIF-4C) mRNA, complete cds Mus musculus major histocompatibility complex region NG27, NG28, RPS28, NADH oxidoreductase, NG29, KIFC1, Fas-binding protein, BING1, tapasin, RaIGDS-like, KE2, BING4, beta 1,3-galactosyl transferase, and 12035 24877 38382 1.46 6.8E-01 AF110520.1 NT RPS18 genes complete cds; Sacm21 gene, partial> Mus musculus major histocompatibility complex region NG27, NG28, RPS28, NADH oxidoreductase, NG29, KIFC1, Fas-binding protein, BING1, tapasin, RalGDS-like, KE2, BING4, beta 1,3-galactosyl transferase, and 12035 24877 38383 1.46 6.8E-01 AF110520.1 NT RPS18 genes, complete cds; Sacm21 gene, partial> Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-celle 1 (NFKB1) gene, complete 318 13410 26328 24.93 6.7E-01 AF213884.1 NT cds Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 (NFKB1) gene, complete 359 13446 26358 25.65 6.7E-01 AF213884.1 NT cds Pae 44 of 545<BR> Table 4<BR> Single Exon Probes Exprossed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 1928 14949 1.17 6.7E-01 M12132.1 NT Queil fast skeletal muscle troponin 1 gene, complete cds zx12g12.s1 Soeres_total_fetus_Nb2HF8_9w Homo sapiens cDNA clone IMAGE:786310 3' similar to 2161 15173 28177 2.08 6.7E-01 AA451864.1 EST_HUMAN contains element TAR1 repetitive element ; Drosphila melanogaster Mst85C gene, complete cds; NMDMC isoform (Nmdmc) gene, complete cds, 2179 15918 28197 3.88 6.7E-01 AF186073.1 NT alternatively spliced; and transcription factor (Rellsh) gene, cormplete cds, alternatively spliced 3039 16091 28993 4.6 6.7E-01 6678580 NT Mus musculus Wiskott-Aldrich syndrome protein (Wasp), mRNA 4563 17571 30434 0.67 6.7E-01 X74421.1 NT S.tuberosum mRNA for glucose-6-phosphete dehydrogenase 5080 18077 30926 1.11 6.7E-01 AW079110.1 EST_HUMAN xa95g12x1 NCI_CGAP_Co17 Homo sapiens cDNA cione IMAGE:2574598 3' 5699 18772 31700 0.87 6.7E-01 J04836.1 NT M.barkeri ATPase alpha and beta subunit (atpA and stpB) genes, complete cds 5699 18772 31701 0.87 6.7E-01 J04836.1 NT M.barkeri ATPase alpha and beta subunit (alpA and atpB) genes, complete cds 6189 19245 32392 0.89 6.7E-01 AE001486.1 NT Helicobacter pylori, strain J99 section 47 of 132 of the complete genome 6579 19620 32804 1.86 6.7E-01 9635035 NT Galid herpesvirus 2, complete genome 6579 19620 32805 1.86 6.7E-01 9635035 NT Galid herpesvirus 2, complete genome 6907 19937 33165 0.48 6.7E-01 BE966241.2 EST_HUMAN 601660177R1 NIH_MGC_71 Homo sapiens cDNA clone IMAGE:3905778 3' 6907 19937 33156 0.48 6.7E-01 BE966241.2 EST_HUMAN 601660177R1 NIH_MGC_71 Homo sapiens cDNA clone IMAGE:3905778 3' 7599 20631 3.77 6.7E-01 AE004606.1 NT Pseudomonas aerugincsa PA01, section 187 of 529 of the complete genome 7726 20658 33955 0.98 6.7E-01 AE001486.1 NT Halicobacter pylori, strain J99 section 47 of 132 of the complete genome 10642 23528 0.89 6.7E-01 M34046.1 NT Human placental protein 14 (PP14) gene, complete cds 11392 24308 37754 2.29 6.7E-01 BF354649.1 EST_HUMAN CM3-HT0769-01600-197-c03 HT0769 Homosapiens cDNA 11891 23991 37430 3.38 6.7E-01 O14357 SWISSPROT N-ACETYLGLUCOSAMINYL-PHOSPHATIDYLINOSITOL SIOSYNTHETIC PROTEIN GPI1 2524 15525 28528 1.41 6.6E-01 AF076240.1 NT Homo sapiens SLIT1 protein (SLIL2) mRNA, partial cds 2751 15742 28737 1.44 6.6E-01 AF1993391. NT Homo sapiens lens epithelium-derived growth factor gene, alternatively spliced, complete cds Homo sapiens sema domain, seven thrombospondin repests (type 1 and type 1-like), transmembrane domain 3548 16586 29491 1.26 6.6E-01 4506880 NT (TM) and short cytoplasmic domain, (semaphorin) 5A (SEMA5A) mRNA 3726 16758 29646 2.9 6.6E-01 Y07669.1 NT C.alblcans random DNA marker, 282bp 5167 18159 31007 0.83 6.6E-01 Z28337.1 NT M.aeruginosa (HUB 5-2-4) DNA from plasmid PMA1 5167 18159 31008 0.83 6.6E-01 Z28337.1 NT M.aeruginosa (HUB 5-2-4) DNA from plasmid PMA1 6589 19630 32812 4.16 6.6E-01 6680577 NT Mus musculus kinesin light chain 2 (Klc2), mRNA 7482 20422 33701 0.58 6.6E-01 AE004458.1 NT Pseudomonas aerugincea PA01, section 19 of 529 of the complete genome 7482 20422 33702 0.68 6.6E-01 AE004458.1 NT Pseudomonas aeruginosa PA01, section 19 of 529 of the complete genome 8138 21047 34377 3.09 6.6E-01 AV660506.1 EST_HUMAN AV660506 GLC Homo sapiens cDNA clone GLCGID04 3' 9129 22057 35417 0.72 6.6E-01 AV704700.1 EST_HUMAN AV704700 ADB Homo sapiens cDNA clone ADBCAF11 5' 10189 23080 1.14 6.6E-01 AL163278.2 NT Homo capiens chromosme 21 segment HS21CO78 Page 45 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Probe Exon Most Similar ORF SEQ Expression (Top) Hit Top Hil Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 647 13708 26615 1.33 6.5E-01 M75140.1 NT H.vulgaris Na,K-ATPase alpha subunit mRNA, complete cds 647 13708 26616 1.33 6.5E-01 M75140.1 NT H.VULGARIS Na,K-ATPase alpha subunit mRNA, complete cdes 3494 16533 29433 5.85 6.5E-01 AB041225.1 NT Mue musculus gene for Tob2, complete cds 4121 17144 30017 1.01 6.5E-01 4504632 NT Homo sapiens interleukin 10 receptor, alpha (IL10RA) mRNA 4380 17394 30259 4.79 6.5E-01 AJ272265.1 NT Homo sapiens SPP2 gene for secreted phosphoprotein 24 precursor, exons 1-8 5197 18189 31030 2.9 6.5E-01 U28921.1 NT Phaseolus vulgaris ATPase gemma subunit mRNA, nuclear gene encoding mitochondrial protein, partial cds 5915 18984 32103 0.56 6.5E-01 AL163249.2 NT Homo sapiens chromosome 21 segment HS21C049 7026 20052 33284 1.31 6.5E-01 D88348.1 NT Chicken mRNA for 115-kDa melanosomal matrix protein, complete cds 8025 20941 34256 0.78 6.5E-01 X04769.1 NT Murine Ig-related Iambda(50) gene (exon 1) transcribed selectively in pre-B lymphocytes 8119 21030 34357 0.9 6.5E-01 AI799882.1 EST_HUMAN wc46a02.x1 NCI_CGAP_Pr28 Homo sapiens cDNA clone IMAGE:2321642 3' 10352 23241 0.85 6.5E-01 T78904.1 EST_HUMAN yd21b04.s1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:108847 3' 10823 23709 37136 4.51 6.5E-01 AF119676.1 NT Mue musculus small GTP-binding protein RAB25 (Rab25) gene, complete cds 11079 24011 37452 2.87 6.5E-01 H87583.1 EST_HUMAN yw17f06.r1 Soares_placenta_8to9weeks_2NbHP8to9W Homo sapiens cDNA clone IMAGE:252515 5' 11128 24058 37504 3.7 8.5E-01 AA601287.1 EST_HUMAN no15c07.s1 NCI_CGAP_Phe1 Homo sapiens cDNA clone IMAGE: 110748 3' 11230 24156 3.97 6.5E-01 AU138078.1 EST_HUMAN AU138078 PLACE1 Homo sapiens cDNA clone PLACE1007810 5' Plasmodium berghel cytochrcme c oxidase subunit III, cytochrome c oxidase subunit, I, and cytochrome b 12029 24871 38374 2.3 6.5E-01 AF014115.1 NT genes, mitochondrial genes encoding mitochondrial proteins, complete cds 12606 25301 4.15 6.3E-01 BE466050.1 EST_HUMAN hv74a10.x1 NCI_CGAP_Lu24 Homo sapiens cDNA clone IMAGE:3179130 3' 12828 25715 3.67 6.5E-01 Z74145.1 NT S.cerevisiae chromosome IV reading frame ORF YDL097c 271 13366 26282 6.03 6.RE-01 U48848.1 NT Drosophila melanogaster 8kd dynein light chain mRNA, complete cds 2626 15624 28617 1.03 6.4E-01 AF161184.1 NT Pseudomonas fluorescens tryptophen halogenase (pmA) gene, complete cds 3516 16554 29455 1.4 6.4E-01 U48854.2 NT Mue musculus dystroglycan 1 (DAG1) gene, exons 1 and 2 and complete cds 3928 16956 29839 1.39 6.4E-01 AB046827.1 NT Homo sapiens mRNA for KIAA 1607 protein, partial cds 4358 17372 0.96 6.4E-01 Z74155.1 NT S.cerevisiae chromosome IV reading frame ORFYDL107w 4605 17613 30473 0.75 6.4E-01 Y12488.1 NT M.musculus whn gene 4605 17613 30474 0.75 6.4E-01 Y12488.1 NT M.musculus whn gene 5055 18052 30905 1.04 6.4E-01 AF239978.1 NT Salmonella enteriticlis SefR (sefR), hypothetical protein 7, and Dlp (dip) genes, complete cds 9173 22101 35461 1.73 6.4E-01 AE001247.1 NT Treponema pallidum section 63 of 87 of the complete genome 10591 23477 36905 10.78 6.4E-01 U82828.1 NT Homo sapiens ataxla telanglectasla (ATM) gene, complete cds 10605 23491 36920 1.35 6.4E-01 BF670405.1 EST_HUMAN 602150289F1 NIH_MGC_81 Homo sapiens cDNA clone IMAGE:4291126 5' 12718 25366 12.64 6.4E-01 AV759212.1 EST_HUMAN AV759212 MDS Homo sapiens cDNA clone MDSCGC09 5' 457 13529 26452 5.03 6.3E-01 P05228 SWISSPROT HISTIDINE-RICH PROTEIN PRECURSOR (CLONE PFHRP-III) Page 46 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Probe Exon Most Similar ORF SEQ Expression (Top) Hit Top Hil Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 558 13627 26535 144.48 6.3E-01 U32689.1 NT Haemophilus influenzes Rd section 4 of 163 of the complete genome 2175 16187 26192 2.6 6.3E-01 U81136.1 NT Shigella flexneri multi-antiblotic resistance locus 2616 15614 28609 3.63 6.3E-01 U75331.1 NT Gallus gallus bone morphogenetic protein 1 (BMP1) mRNA, partial cds 2616 15614 28610 3.63 6.3E-01 U75331.1 NT Gallus gallus bone morphogenetic protein 1 (BMP1) mRNA, partial cds 3061 16113 0.86 6.3E-01 Y17275.1 NT Lycopersicon esulentum p69a gene, complete CDS 6299 19350 32518 0.87 6.3E-01 BE093906.1 EST_HUMAN PM0-BT0757 010500-002 a05 BT0757 Homo sapiens cDNA 6885 19915 33131 1.02 6.3E-01 L27798.1 NT Streptococcus dysgalactiae (mag) gene, complete cds 6885 19915 33132 1.02 6.3E-01 L27798.1 NT Streptococcus dysgalactiae (mag) gene, complete cds 9086 22015 3.21 6.3E-01 BE902944.1 EST_HUMAN 601676889F1 NIH_MGC_21 Homo sapiens cDNA clone IMAGE:3959351 5' 9443 22371 35735 0.98 6.3E-01 S62927.1 NT glycoprotein IIIa {Alu 1 and 3 fusion junction} [human, Genomic Mutant, 300 nt] 9761 22685 36072 0.67 6.3E-01 BF216984.1 EST_HUMAN 601884050F1 NIH_MGC_57 Homo sapiens cDNA clone IMAGE:4102596 5' 9954 22859 36247 3.73 6.3E-01 9627521 NT Variola virus, complete genome 9954 22859 36248 3.73 .63E-01 9627521 NT Variola virus, complete genome 10447 23336 0.75 6.3E-01 AE002329.2 NT Chlamydia muridarum, section 59 of 85 of the complete genome 10909 23794 37223 1.46 6.3E-01 Z73003.1 NT S.cerevisiae chromosome VII reading frame ORF YGR218w 11008 23892 37326 0.72 6.3E-01 AE000313.1 NT Escherichla coli K-12 MG 1655 section 203 of 400 of the complete genome nr09h06.s1 NCI_CGAP_Co10 Homo sapiens cDNA clone IMAGE:1161371 3' similar to TR:O02916 O02916 11500 24411 37865 2.1 6.3E-01 AA877715.1 EST_HUMAN HLARK.; 11779 24678 38167 8.4 6.3E-01 AI904160.1 EST_HUMAN CM-BT043-090299-046 BT043 Homo sapiens cDNA 11857 24747 38239 1.75 6.3E-01 P47003 SWISSPROT HYPOTHETICAL 13.7 KD PROTEIN IN INO1-IDS2 INTERGENIC REGION 12019 24861 38361 2.14 6.3E-01 P36073 SWISSPROT HYPOTHETICAL 15.3 KD PROTEIN IN VMA12-APN1 INTERGENIC REGION 12219 25053 1.56 6.3E-01 BF333356.1 EST-HUMAN RC0-CI0037 250900-031-e09 CI0037 Homo saplens cDNA 12341 25905 31365 13.98 6.3E-01 9910293 NT Mus musculus keratin complex 2, gene 6g (Krt2-6g), mRNA 12425 25188 1.61 6.3E-01 AF105227.1 NT Homo sapiens 3'-phosphoadenosine 5'-phosphosulfate synthetase (PAPSS) mRNA, complete cds 12623 25830 1.74 6.3E-01 X83528.1 NT C.limicola pscD gene Spermophllus suslicus isolate S47 cytochrome b (cylb) gene, complete cds; mitochondrial gene for 5158 18151 30997 0.74 6.2E-01 AF157898.1 NT mitochondrial product 6085 19146 32281 2.06 6.2E-01 Q10135 SWISSPROT HYPOTHETICAL 142.5 KD PROTEIN C23E2.02 IN CHROMOSOMEI 7916 20840 2.84 6.2E-01 AF022253.1 NT Mus musculus calcium-sensing receptor related protein 4 (Casr-rs4) mRNA, partial cds Mus musculus chromosome X oontigA; putative Magoa@ gono, Caltractin, NAD(P) eteroid dehydrogenase 7973 25681 34207 1.15 6.2E-01 AL021127.2 NT and Zinc finger protein 185 8876 21806 35159 5.59 6.2E-01 H72255.1 EST_HUMAN ys01e08.s1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:213542 3' Lycopersicon esculentum cytosolic Cu,Zn superoxide dismutase (Sod) gene, partial cds; and dehydroquinate 9415 22343 35708 0.63 6.2E-01 AF034411.1 NT dehydralase/shikimate:NADF oxidoreductase gene, complete cds Page 47 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Aduit Liver Probe Exon Most Similar ORF SEQ Expression (Top) Hit Top Hil Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 9981 21339 34675 1.67 6.2E-01 BE562687.1 EST-HUMAN 601336146F1 NIH_MGC_44 Homo saplens cDNA clone IMAGE:3690010 5' 10041 22941 3.87 6.2E-01 M24461.1 NT Human pulmonary surfactant-associated protein SP-B (SFTP3) mRNA, complete cds 10580 23466 36891 7.51 6.2E-01 AL161511.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 23 10717 23603 37031 0.6 6.2E-01 11420793 NT Homo sapiens potassium voltage-gated channel, shab-related subfamily, member 1 (KCNB1), mRNA 10717 23603 37032 0.6 6.2E-01 11420793 NT Homo sapiens potassium voltage-gated channel, Shab-related subfamily, member 1 (KCNB1), mRNA NON-STRUCTURAL POLYPROTEIN [CONTAINS:RNA-DIRECTED RNA POLYMERASE; THIOL 11015 23899 37335 5.73 6.2E-01 P27410 SWISSPROT PROTEASE P3C; HELICASE (2C LIKE PROTEIN); COAT PROTEIN] NON-STRUCTURAL POLYPROTEIN [CONTAINS:RNA-DIRECTED RNA POLYMERASE; THIOL 11015 23899 37336 5.73 6.2E-01 P27410 SWISSPROT PROTEASE P3C; HELICASE (2C LIKE PROTEIN); COAT PROTEIN] 2417 15421 7.14 6.1E-01 6678076 NT Mus musculus secreted acidic cysteine rich glycoprotein (Sparc), mRNA 4651 17657 30523 12.86 6.1E-01 4557538 NT Homo sapians solute carrier family 26 (sulfate transporter), member 2 9SLC26A2) mRNA 5726 18799 31892 1.21 6.1E-01 M59940.1 NT Caenorhabditis elegans N2 CeMyoD (hih-1) alternatively spliced genes, complete cds 7195 20195 33439 3.56 6.1E-01 M64733.1 NT Rat TRPM-2 gene, complete cds 7195 20195 33440 3.56 6.1E-01 M64733.1 NT Rat TRPM-2 gene, complete cds xd50h03.x1 NCI_CGAP_Ov23 Homo sapiens cDNA clone IMAGE:2597237 3' similar to gb:X12671_rna1 7365 20359 33628 0.61 6.1E-01 AW105553.1 EST_HUMAN HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN A1 (HUMAN); SUSHI REPEAT-CONTAINING PROTEIN SRPX PRECURSOR (DRS PROTEIN)(DOWN-REGULATED 7464 20404 33680 0.53 6.1E-01 Q63769 SWISSPROT BYV-SRC) 8811 21741 35090 3.73 6.1E-01 AF033535.1 NT Arabidopsis thaliana putative zinc transporter (ZIP1) mRNA, complete cds 9353 22281 35641 1.39 6.1E-01 11431065 NT Homo sapiens mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), mRNA 9353 22281 35642 1.39 6.1E-01 11431065 NT Homo sapiens mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), mRNA 9949 22854 36241 23.9 6.1E-01 AF236117.1 NT Homo sapiens G-protein coupled receptor EDG-7 mRNA, complete cds 9949 22854 36242 23.9 6.1E-01 AF236117.1 NT Homo sapiens G-protein coupled receptor EDG-7 mRNA, complete cds 10357 23246 36665 1.08 6.1E-01 AE004452.1 NT Pseudomonas aeruglnosa PA01, section 13 of 529 of the complete genome 10549 23435 36855 1.48 6.1E-01 AF119117.1 NT Homo sapiens dopamine transporter (SLC6A3) gene, complete cds 12156 24995 38494 2.24 6.1E-01 S83182.1 NT hyaluronan-binding protein=hepatocyte growth factor activator homolog [human, plasma, mRNA, 2408 nt] 12156 24995 38495 2.24 6.1E-01 S83182.1 NT hyaluronan-binding protein=hepatocyte growth factor activator homolog [human, plasma, mRNA, 2408 nt] 517 13587 26500 6.03 6.0E-01 D87675.1 NT Homo sapiens DNA for amyloid precursor protein, complete cds 583 13651 2.78 6.0E-01 5802999 NT Homo sapiens adaptor-related protein complex 3, mu 2 subunit (CLA20), mRNA 1389 14420 27375 1.67 6.0E-01 AF065253.1 NT Human respiratory syncytial virus strain CH93-53b attachment protein (G) gene, complete cds Page 48 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Probe Exon Most Similar ORF SEQ Expression (Top) Hit Top Hil Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 3885 16914 29792 0.93 6.0E-01 AJ233396.1 NT Viral hemorrhagic septicemia virus N, P, M, G, Nv, L genes, French strain 07-71 5463 18544 31384 3.6 6.0E-01 P20288 SWISSPROT D(2) DOPAMINE RECEPTOR 5625 18701 31600 2.44 6.0E-01 AW139713.1 EST_HUMAN UI-H-BI1-aeb-a-10-0-UI.s1 NCI_CGAP_Sub3 Homo sapiens cDNA clone IMAGE:2718619 3' 6818 19851 33062 2.9 6.0E-01 U38813.1 NT Musca domestica insecticide-susceptible strain voltage-sensitive sodium channel mRNA, complete cds MACROPHAGE-STIMULATING PROTEIN PECEPTOR PRECURSOR (MSP RECEPTOR)(P185-RON) 6955 19984 33208 0.79 6.0E-01 Q04912 SWISSPROT (CDW136)(CD136 ANTIGEN) 7127 20331 33594 0.82 6.0E-01 L10234.1 NT Strongylocentrotus purpuratus kinesin light chain isoform 2 mRNA, complete cds 7127 20331 33595 0.82 6.0E-01 L10234.1 NT Strongylocentrotus purpuratus kinesin light chain isoform 2 mRNA, complete cds 7742 20673 33971 6.6 6.0E-01 AJ277661.1 NT Homo sapiens partial LMO1 gene for LIM domain only 1 protein, exon 1 8701 21632 34977 4.43 6.0E-01 P02835 SWISSPROT SEGMENTATION PROTEIN FUSHI TARAZU 8701 21632 34978 4.43 6.0E-01 P02835 SWISSPROT SEGMENTATION PROTEIN FUSHI TARAZU 10338 23227 36643 1.75 6.0E-01 AB008193.1 NT Homo sapiens genes for leukotriene B4 receptor BLT2, leukotriene B4 receptor BLT1, complete cds 10766 23652 1.55 6.0E-01 Q01497 SWISSPROT PEROXISOMAL MEMBRANE PROTEIN PER9 (PEROXIN-3) 10871 23757 0.52 6.0E-01 BE837779.1 EST_HUMAN RC2-FN0094-190700-017-d03 FN0094 Homo sapiens cDNA 11497 24408 37862 1.77 6.0E-01 AJ131892.1 NT Gallus gallus mRNA for Hyperion protein, 419 kD isoform 11497 24408 37863 1.77 6.0E-01 AJ131892.1 NT Gallus gallus mRNA for Hyperion protein, 419 kD isoform 11984 24827 38324 3.16 6.0E-01 AI420623.1 EST_HUMAN tf08f07.x1 NCI_CGAP_Pr28 Homo sapiens cDNA clone IMAGE:2095621 3' 12688 25345 31826 1.52 6.0E-01 11421663 NT Homo sapiens nuclear factor (erythroid-derived 2)-like 3 (NFE2L3), mRNA 12960 25771 31576 2.29 6.0E-01 9055303 NT Mus musculus cGMP-inhibited phosphodiesterase (Pde3a), mRNA 12986 25709 5.41 6.0E-01 BE157617.1 EST_HUMAN RC1-HT0375-030500-015-c03 HT0375 Homo sapiens cDNA 1028 14077 27017 0.95 5.9E-01 U32701.1 NT Haemophilus influenzae Rd section 16 of 163 of the complete genome 1427 14458 27411 1.18 5.9E-01 6680232 NT Mus musculus 3-hydroxy-3-methylglutaryl-Coenzyme A lyase (Hmgcl), mRNA 3314 16361 29261 6.06 5.9E-01 AL163267.2 NT Homo sapiens chromosome 21 segment HS21C067 3314 16361 29262 6.06 5.9E-01 AL163267.2 NT Homo sapiens chromosome 21 segment HS21C067 4319 17333 3.5 5.9E-01 AF162756.1 NT Rattue norvegicus cenexin 2 mRNA, partial cds 5236 18223 31072 2.12 5.9E-01 L27316.1 NT Oryctolagus cuniculus immunoglobulin VDJ region gene 5326 18310 31160 2.6 5.9E-01 AF026566.1 NT Ovls arles SRY gene promoter region 6738 19772 32983 2.3 5.9E-01 AF065440.2 NT Homo sapiens low density lipcprotein receptor-related protein II (LRP2) gene, exon 1 and pertial cds 7642 20577 33871 3.8 5.9E-01 AB023486.1 NT Homo sapiens gene for histamine H2 receptor, promoter region and complete cds 7795 20724 0.56 5.9E-01 X68801.1 NT G.gallus gene for skeletal alpha-actinin, exon EF2 8578 21509 34855 0.61 5.9E-01 D90911.1 NT Synechocystis sp. PCC6803 complete genome, 13/27, 1576593-1719643 Page 49 of 545<BR> Table<BR> Single Exon Probes Expressed in Adult Liver Probe Exon Most Similar ORF SEQ Expression (Top) Hit Top Hil Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 9197 22125 35481 0.54 5.9E-01 D12922.1 NT Legionella pneumophila gene for iron superoxidde dismutase, complete cds 10072 22987 36382 0.59 5.9E-01 AF063204.2 NT Chlamydia trachomatis strain K/UW31/Cx major outer membrane protein (omp1) gene, complete cds 10424 23313 0.6 5.9E-01 P06463 SWISSPROT E6 PROTEIN 10685 23571 37001 1.82 5.9E-01 P55284 SWISSPROT VASCULAR ENDOTHELIAL-CADHERIN PRECURSOR (VE-CADHERIN)(CADHERIN-5) 11115 24045 37491 2.77 5.9E-01 Q9X013 SWISSPROT THYMIDYLATE KINASE (DTMP KINASE) 11120 24050 37495 1.7 5.9E-01 AF197944.1 NT Xenopus laevis receptor protein tyrosine phosphatase deita (XPTP-D) mRNA, complete cds 11398 24314 37760 3.48 5.9E-01 AW937175.1 EST_HUMAN PM1-DT0041-190100-002-h03 DT0041 Homo sapiens cDNA 11639 24545 38019 2.85 5.9E-01 AF064626.1 NT Mus spretus strain SPRET/Ei CD48 antigen (Cd48) gene, partial cds 11909 24757 38251 1.47 5.9E-01 P47135 SWISSPROT JSN1 PROTEIN 11909 24757 38252 1.47 5.9E-01 P47135 SWISSPROT JSN1 PROTEIN 12376 25156 31870 1.8 5.9E-01 L42320.1 NT Oryctolagus cuniculus alpha 1 anti-trypsin (alpha 1 AT) gene, promoter region 12593 25289 3.38 5.9E-01 AB017705.1 NT Aspergillus oryzae pyrG gene for orotidine-5'-phosphate decarboxylase, complete cds 12794 25421 5.68 5.9E-01 P34926 SWISSPROT MICROTUBULE-ASSOCIATED PROTEIN 1A [CONTAINS: MAP1 LIGHT CHAIN LC2] 1925 14946 27922 1.05 5.8E-01 P40472 SWISSPROT SIM1 PROTEIN 4069 17095 29978 1.22 5.8E-01 BF695738.1 EST_HUMAN 601852474F1 NIH_MGC_56 Homo sapiens cDNA clone IMAGE:4076131 5' 4635 17641 30504 5.31 5.8E-01 AB009077.1 NT Vigna radiata mRNA for proton pyrophosphatase, complete cds 4912 17911 1.23 5.8E-01 AF110846.1 NT Megaselia scalaris sex-lethal homolog (Megsxl) gene, partia cds, alternatively spliced products 5559 18637 0.62 5.8E-01 AE002152.1 NT Ureaplasma urealyticum section 53 of 59 of the complete genome 5721 18794 31886 3.59 5.8E-01 Q10699 SWISSPROT POTENTIAL 5'-3' EXONUCLEASE 6425 19472 32646 2.18 5.8E-01 D78659.1 EST_HUMAN HUM500E06B Human placenta polyA+ (TFujiwara) Homo sapiens cDNA clone GEN-500E06 5' 6567 19608 32793 0.7 5.8E-01 D50601.1 NT Shigella sonnei DNA for 26 ORFs, complete cds 7124 20328 2 5.8E-01 S65091.1 NT cyclic AMP-regulated phosphoprotein [rats, mRNA, 1030 nt] yn91b03.s1 Soares aduit brain N2b5HB55Y Hono sapiens cDNA clone IMAGE:175757 3' similar to 8467 21398 2.69 5.8E-01 H41571.1 EST_HUMAN gb;S78187 M-PHASE INDUCER PHOSPHATASE 2 (HUMAN); 8665 21596 34935 0.78 5.8E-01 AI280051.1 EST_HUMAN qh85d10.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:1853779 3' 8665 21596 34936 0.78 5.8E-01 AI280051.1 EST_HUMAN qh85d10.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:1853779 3' 8768 21698 35042 2.74 5.8E-01 P14328 SWISSPROT SPORE COAT PROTEIN SP96 8768 21698 35043 2.74 3.8E-01 P14328 SWISSPROT SPORE COAT PROTEIN SP96 9448 22376 35739 11.31 5.8E-01 AJ270774.1 NT Homo sapiens partial TCF-4 gene for T-cell transcription factor-4, exons 6-11 9524 22451 35814 1.05 5.8E-01 Q27368 SWISSPROT TRANSCRIPTION FACTOR E2F 10123 23014 0.64 5.8E-01 BF031606.1 EST_HUMAN 601557774F1 NIH_MGC_58 Homo sapiens cDNA clone IMAGE:3827298 5' 11428 24344 37789 7.78 5.8E-01 AJ243213.1 NT Homo sapiens partial 5-HT4 receptor gene, exons 2 to 5 11475 24388 3.57 5.8E-01 BF700092.1 EST_HUMAN 602127577F1 NIH_MGC_56 Homo sapiens cDNA clone IMAGE:4284403 5' Page 50 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 11582 24491 1.97 5.8E-01 BF700092.1 EST_HUMAN 602127577F1 NIH_MGC_56 Homo saplens cDNA clone IMAGE:4284403 5' 1512 14543 27504 1.03 5.7E-01 P06727 SWISSPROT APOLIPOPROTEIN A-IV PROECURSOR (APO-AIV) 1512 14543 27505 1.03 5.7E-01 P06727 SWISSPROT APOLIPOPROTEIN A-IV PROECURSOR (APO-AIV) 3090 16141 0.96 5.7E-01 6755253 NT Mus musculus plasmacytoma variant translocation 1 (Pvt1), mRNA 3270 16318 29221 1.69 5.7E-01 Q9WTJ2 SWISSPROT PUTATIVE TRANSCRIPTION FACTOR OVO-LIKE 1 (MOVO1)(MOVO1A) 3561 16598 3.73 5.7E-01 AB033503.1 NT Populus euramericana peaca-2 mRNA for 1-aminocyclopropane-1-carboxylate synthase, complete cds 6613 19654 32838 4.16 5.7E-01 BF035413.1 EST_HUMAN 601454962F1 NIH_MGC_66 Homo sapiens cDNA clone IMAGE:3858590 5' 7008 20035 343268 0.78 5.7E-01 AA194201.1 EST_HUMAN zr38c06.r1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:665674 5' 7183 18455 31325 1.24 5.7E-01 AL111440.1 NT Bolrytis cinerea strain T4 cDNA library under conditions of nitrogen deporivation 8233 21138 34470 2 5.7E-01 P00373 SWISSPROT PYRROLINE-5-CARBOXYLATE REDUCTASE (P5CR)(P5C REDUCTASE) 8548 21479 0.57 5.7E-01 AJ251835.1 NT Mus musculus Kcnq1. Ltrpc5, Mash2, Tapa-1, Tssc4 and Tssc8 genes, alternative transcripts 8951 21881 0.84 5.7E-01 AI065061.1 EST_HUMAN HA0895 Human fetal cDNA librery Homo sapiens cDNA 10316 23205 36615 1.24 5.7E-01 AL161532.2 NT Arabiclopsis thaliana DNA chromosome 4, contig fragment No. 32 10316 23205 36616 1.24 5.7E-01 AL161532.2 NT Arabiclopsis thaliana DNA chromosome 4, contig fragment No. 32 11048 23932 37372 1.07 5.7E-01 BF540962.1 EST_HUMAN 602067712F1 NIHJ_MGC_58 Homo sapiens cDNA clone IMAGE:4066610 5' 3419 16461 29367 1.11 5.6E-01 AB018283.2 NT Homo sapiens mRNA for KIAA0740 protein, partial cds 3419 16461 29368 1.11 5.6E-01 AB018283.2 NT Homo sapiens mRNA for KIAA0740 protein, partial cds 3952 15980 29864 0.85 5.6E-01 AL161501.2 NT Arebidopsis thaliana DNA chromosome 4, contig fragment No. 13 8159 21066 34396 0.41 5.6E-01 L44513.1 EST_HUMAN HUMEST4B9 Human thymus NSTH II Homo sapiens cDNA 9361 22289 35654 4.78 5.6E-01 AV684703.1 EST_HUMAN AV684703 GKC Homo sapiens cDNA clone GKCFSF05 5' 9361 22289 35655 4.78 5.6E-01 AV684703.1 EST_HUMAN AV684703 GKC Homo sapiens cDNA clone GKCFSF05 5' 9914 22902 36289 1.51 5.6E-01 AB038782.1 NT Homo sapiens MUC3A gene for intestinal mucin, partial cds 12244 25068 3.53 5.6E-01 BE888280.1 EST_HUMAN 601514007F1 NIH_MGC_71 Homo sapiens cDNA clone IMAGE:3915457 5' 12686 16980 29864 3.48 5.6E-01 AL161501.2 NT Arabiciopsis thaliana DNA chromosome 4, contig fragment No. 13 12715 25365 2.95 5.6E-01 P50505 SWISSPROT HIGH AFFINITY POTASSIUM TRANSPORTER 13074 25598 3.35 5.6E-01 BF573829.1 EST_HUMAN 602132029F1 HIH_MGC_81 Homo sapiens cDNA clone IMAGE:4271334 5' 1239 14275 27218 1.54 5.6E-01 8393912 NT Rattus norvegicus Proplonyl Coenzyme A carboxylase, beta polypeptide (Pccb), mRNA GAG POLYPROTEIN [CONTAINS: INNER COAT PROTEIN P12; CORE PROTEIN P15; CORE SHELL 2752 15743 28738 4.81 5.5E-01 P03341 SWISSPROT PROTEIN P30; NUCLEOPROTEIN P10] GAG POLYPROTEIN [CONTAINS: INNER COAT PROTEIN P12; CORE PROTEIN P15; CORE SHELL 2752 15743 28739 4.81 5.5E-01 P03341 SWISSPROT PROTEIN P30; NUCLEOPROTEIN P10] 2961 16013 28911 1.09 5.5E-01 5902085 NT Homo saplens superklller virallcidic activity 2 (S. cerevlslae homolog)-like (SKIV2L), mRNA 3114 16165 1.76 5.5E-01 H46219.1 EST_HUMAN yo18a10.s1 Soares adult brain N2b5HB55Y Homo sapiens cDNA clone IMAGE:178266 3' Page 51 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 3281 16329 29234 2.75 5.5E-01 AF227240.1 NT Rabit oral papillomavirus, complete genome 3757 16789 29679 1.22 5.5E-01 P48755 SWISSPROT FOS-RELATED ANTIGEN-1 Mus musculus major histocompatibility locus class III region:butyrophilin-like protein gene, partial cds; Notch4, PBX2, RAGE, lysophatidic acid acyl transferase-alpha, palmitoyl-protein thioesterase 2 (PPT2), 7626 20561 33854 0.56 5.5E-01 AF030001.1 NT CREB-RP, and tenascin X (TNX) genes, comple> Mus musculus major histocompatibility locus class III region:butyrophilin-like protein gene, partial cds; Notch4, PBX2, RAGE, lysophatidic acid acyl transferase-alpha, palmitoyl-protein thioesterase 2 (PPT2), 7626 20561 33855 0.56 5.5E-01 AF030001.1 NT CREB-RP, and tenascin X (TNX) genes, comple> 7666 20600 0.66 5.5E-01 AB015596.1 NT Carassius auratus gene for gonadotyropin Il beta subunit, complete cds 9017 21946 35302 0.61 5.5E-01 AI791766.1 EST_HUMAN or82c01.y5 NCI_CGAP_Lu5 Homo sapiens cDNA clone IMAGE:1602336 5' 10287 23177 0.77 5.5E-01 U88415.1 NT Crimean-Congo hemorrhagic fever virus strain SPU 415/85 nucleoprotein gene, complete cds 10865 23751 37176 1.06 5.5E-01 T05047.1 EST_HUMAN EST02935 Fetal brain, Stratagene (cat#936206) Homo saplens cDNA clone HFBCQ35 11580 24480 37958 1.56 5.5E-01 BF129507.1 EST_HUMAN 601811077R1 NIH_MGC_48 Homo sapiens cDNA clone IMAGE:4054003 3' 150 13250 26167 7.75 5.4E-01 7657266 NT Homo sapiens KIAA0929 protein Msx2 interacting nuclear terget (MINT) homolog (KIAA0929), mRNA 150 13250 26168 7.75 5.4E-01 7657266 NT Homo sapiens KIAA0929 protein Msx2 interacting nuclear terget (MINT) homolog (KIAA0929), mRNA Pseudomonas syringae pv. tomato strain DC3000 AvrE (avrE), HrpW (hrpW), and GstA (gstA) genes, 606 13672 26575 1.71 5.4E-01 AF232006.1 NT complete cds; and unknown genes Pseudomonas syringae pv. tomato strain DC3000 AvrE (avrE), HrpW (hrpW), and GstA (gstA) genes, 606 13672 26576 1.71 5.4E-01 AF232006.1 NT complete cds; and unknown genes 1298 14331 27277 2.28 5.4E-01 AW896087.1 EST_HUMAN QV4-NN0040-070400-160-c04 NN0040 Homo sapiens cDNA 2118 15131 1.71 5.4E-01 AE002247.2 NT Chlamydophila pneumoniae AR39, section 74 of 94 of the comlplete genome 2271 15281 28288 2.29 5.4E-01 AJ276682.1 NT Drosophila melanogaster mRNA for 15,15' beta carotene dioxygenase (beta_diox gene) Pseudomonas syringae pv. tomato strain DC3000 AvrE (avrE), HrpW (hrpW), and GstA (gstA) genes, 5360 13672 26575 0.7 5.4E-01 AF232006.1 NT complete cds; and unknown genes Pseudomonas syringae pv. tomato strain DC3000 AvrE (avrE), HrpW (hrpW), and GstA (gstA) genes, 5360 13672 26576 0.7 5.4E-01 AF232006.1 NT complete cds; and unknown genes 5384 18366 0.91 5.4E-01 X85973.1 NT A.thaliana mRNA for phosphoinositide-specific phospholipase C 5854 18925 32041 0.79 5.4E-01 AW842327.1 EST_HUMAN PM2-CN0030-030200-003-c10 CN0030 Homo sapiens cDNA 6432 19479 32656 1.52 5.4E-01 AB025017.1 NT Rattus norvegicus gene for TIS11, complete cds 6690 19726 32926 0.41 5.4E-01 11559924 NT Homo sapiens hypothetical protein LOC63929 (LOC63929), mRNA 7376 20370 33639 0.63 5.4E-01 BE966592.2 EST_HUMAN 601660276R1 NIH_MGC_71 Homo saplens cDNA clone IMAGE:3906090 3' 7721 20653 33948 0.69 5.4E-01 Z21619.1 NT S.cerevisiae RIB3 gene encoding DBP synthase Page 52 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 7721 20653 33949 0.69 5.4E-01 Z21619.1 NT S.cerevisiae RIB3 gene encoding DBP synthase MITOCHONDRIAL TRIFUNCTIONAL ENZYME ALPHA SUBUNIT PRECURSOR (TP-ALPHA) [INCLUDES: LONG-CHAIN ENOYL-COA HYDRATASE; LONG CHAINE 3-HYDROXYACYL-COA 7723 20655 33952 1.67 5.4E-01 Q64428 SWISSPROT DEHYDROGENASE ] 10495 23384 2.35 5.4E-01 BF572536.1 EST_HUMAN 602076545F1 NIH_MGC_62 Homo sapiens cDNA clone IMAGE:4243690 5' 11518 24428 37886 2.8 5.4E-01 P36858 SWISSPROT NITRATE REDUCTASE [NADPH](NR) 12045 24886 38390 2.58 5.4E-01 Q60675 SWISSPROT LAMININ ALPHA-2 CHAIN PRECURSOR (LAMININ M CHAIN) (MEROSIN HEAVY CHAIN) 12045 24886 38391 2.58 5.4E-01 Q60675 SWISSPROT LAMININ ALPHA-2 CHAIN PRECURSOR (LAMININ M CHAIN) (MEROSIN HEAVY CHAIN) 12161 19479 32656 5.5 5.4E-01 AB025017.1 NT Rattus norvegicus gene for TIS11, complete cds wl37g04.x1 NCI_CGAP_Ut1 Homo sapiens cDNA clone IMAGE:2427126 3' similar to gb:M13452 LAMIN A 12301 25110 3.13 5.4E-01 AI858398.1 EST_HUMAN (HUMAN); Homo sapiens HLA class III region containing tenascin X (tenascin-X) gene, partial cds; cytochrome P450 21- hydroxylase (CYP21B), complement component C4 (C4B) G11, hellcase (SKI2W), RD, complement factor B 539 13608 26518 2.16 5.3E-01 AF019413.1 NT (Bf), and complement component C2 (C2) genes,> 2154 15166 28168 0.94 5.3E-01 AF113919.1 NT Brassica oleracea var. capitata phospholipase D2 (PLD2) gene, complete cds 2154 15166 28169 0.94 5.3E-01 AF113919.1 NT Brassica oleracea var. capitata phospholipase D2 (PLD2) gene, complete cds 2833 15822 28817 7.36 5.3E-01 4506328 NT Homo sapiens protein tyrosine phosphatase, receptor-type, zeta polypeptide 1 (PTPRZ1) mRNA 2833 15822 28818 7.36 5.3E-01 4506328 NT Homo sapiens protein tyrosine phosphatase, receptor-type, zeta polypeptide 1 (PTPRZ1) mRNA 3289 16336 29239 4.03 5.3E-01 AF087658.1 NT Homo sapiens secreted C-type lectin precursor (LSLCL) gene, complete cds 4307 17321 2.5 5.3E-01 U39687.1 NT Mycoplasma genitalium section 9 of 51 of the complete genome 5643 18718 31621 1.43 5.3E-01 AI820921.1 EST HUMAN zu42h12.y5 Soares ovary tumor NbHOT Homo sapiens cDNA clone IMAGE:740711 5' 5643 18718 31622 1.43 5.3E-01 AI820921.1 EST_HUMAN zu42h12.y5 Soares ovary tumor NbHOT Homo sapiens cDNA clone IMAGE:740711 5' 5745 18818 31914 0.85 5.3E-01 AA193672.1 EST_HUMAN zr42g09.r1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:666112 5' 5745 18818 31915 0.85 5.3E-01 AA193672.1 EST_HUMAN zr42g09.r1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:666112 5' 7e73c12.x1 NCI_CGAP_Pr28 Homo sapiens cDNA clone IMAGE:3288118 3' similar to gb:J02783 5842 18913 32029 1.93 5.3E-01 BE645620.1 EST_HUMAN PROTEIN DISULFIDE ISOMERASE PRECURSOR (HUMAN); 7e73c12.x1 NCI_CGAP_Pr28 Homo sapiens cDNA clone IMAGE:3288118 3' similar to gb:J02783 5842 18913 32030 1.93 5.3E-01 BE645620.1 EST_HUMAN PROTEIN DISULFIDE ISOMERASE PRECURSOR (HUMAN); Roridula gorgonias ribulose 1,5-bisphosphate carboxylase (rbcL) gene, partial cds; chloroplast gene for 9461 22389 1.81 5.3E-01 L01950.2 NT chloroplast product 7q71c12.x1 NCI_CGAP_Lu24 Homo sapiens cDNA clone IMAGE: 3' similar to contains element MER29 9510 22437 35801 0.84 5.3E-01 BF433956.1 EST_HUMAN repetitlve element; 7q71c12.x1 NCI_CGAP_Lu24 Homo sapiens cDNA clone IMAGE: 3' similar to contains element MER29 9510 22437 35802 0.84 5.3E-01 BF433956.1 EST_HUMAN repetitlve element; Page 53 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit descriptor ID NO: Signal BLAST E No. NO: NO: Source Value wx94b02.x1 NCI_CGAP_Mel15 Homo sapiens cDNA clone IMAGE:2551275 3' similar to 10707 23593 37020 0.8 5.3E-01 AI954210.1 EST_HUMAN SW:COXA_HUMAN P205674 CYTOCHROME C OXIDASE POLYPEPTIDE VA PRECURSOR ; 11073 23957 37393 0.52 5.3E-01 11428833 NT Homo sapiens nucieoporin 214kD (CAIN) (NUP214), mRNA 11993 24835 38333 5.75 5.3E-01 BE566291.1 EST_HUMAN 601339867F1 NIH_MGC_53 Homo sapiens cDNA clone IMAGE:3682168 5' og30e05.s1 NCI_CGAP_Br7 Homo sapiens cDNA clone IMAGE:1441376 3' similar to gb:J02611 12238 25769 4.27 5.3E-01 AA916053.1 EST_HUMAN APOLIPORTEIN D PRECURSOR (HUMAN); 841 13896 26833 13.59 5.2E-01 L20770.1 NT Drosophila melanogaster helix-loop-helix mRNA, complete cds NUCLEAR FACTOR OF ACTIVATED T COELL 5(T CELL TRANSCRIPTION FACTOR NFAT5) (NF-AT5) 1191 14230 27169 7.93 5.2E-01 Q9WV30 SWISSPROT (REL DOMAIN-CONTAINING TRANSCRIPTION FACTOR NFAT5) 1219 14257 27197 2.31 5.2E-01 AF224492.1 NT Homo sapiens phospholipid seramblase 1 gene, complete ods 1906 14927 2.81 5.2E-01 AL163285.2 NT Homo sapiens chromsome 21 segment HS21C085 2160 15172 28176 2.02 5.2E-01 AB018283.2 NT Homo sapiens mRNA for KIAA0740 protein, partial cds 3164 16214 29103 1.48 5.2E-01 U65942.1 NT Chlamyclophila abortus strain s26/3 POMP91A and POMP90A precusor, genes, comaplete cds 3465 16505 1.84 5.2E-01 AL116780.1 NT Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation 3505 16543 29443 2.26 5.2E-01 AA984165.1 EST_HUMAN am77g05.s1 Stratagene schizo brain S11 Homo sapiens cDNA clone IMAGE: 1616504 3' Medicago sativa chloropiast malate dehydrogenase preacursor (p1mdh) mRNA, nuclear gene encoding 3699 16731 1.03 5.2E-01 AF020269.1 NT chloroplast protein, complete cds 4717 17722 30584 0.69 5.2E-01 6752947 NT Mus musculus acetyichcline receptor beta (Acrb), mRNA 5850 18921 32035 0.92 5.2E-01 AA284261.1 EST_HUMAN zc44d09.T7 Soares_senescent_fibroblasts_NbHSF Homo sapiens cDNA clone IMAGE:325169 3' 10251 25693 36549 0.82 5.2E-01 X02218.1 NT Chicken duplicated genes for histone H2A, H4 and a histone H3 gene 10251 25693 36550 0.82 5.2E-01 X02218.1 NT Chicken duplicated genes for histone H2A, H4 and a histone H3 gene 10530 23416 36830 1.28 5.2E-01 AF143952.2 NT Homo sapiens PELOTA (PELOTA) gene, complete cds RETINOIC ACID RECEPTOR GAMMA (RAR-GAMMA) (RETINOIC ACID RECEPTOR DELTA)(RAR- 13051 25583 4.1 5.2E-01 P18516 SWISSPROT DELTA) 640 13701 26608 1.85 5.1E-01 M58509.1 NT Human adrenodoxin reductase gene, exons 3 to 12 671 13733 26644 3.66 5.1E-01 AJ233944.1 NT Polyangium vitellinum (strain PI vt1) 16S rRNA gene 671 13733 26645 3.66 5.1E-01 AJ233944.1 NT Polyangium vitellinum (strain PI vt1) 16S rRNA gene 1679 14709 1.08 5.1E-01 X87885.1 NT R.norvegicus mRNA for mammalian fusoa protein 4163 17184 30057 5.45 5.1E-01 AI858495.1 EST_HUMAN wl39b12.x1 NCI_CGAP_Ut1 Homo sapiens cDNA clone IMAGE:2427263 3' 4283 17297 30163 3.94 5.1E-01 P96380 SWISSPROT TRANSCRIPTION-REPAIR COUPLING FACTOR (TRCF) 6467 19512 32687 0.64 5.1E-01 BE541068.1 EST_HUMAN 601063606F1 NIH_MGC_10 Homo sapiens cDNA clone IMAGE:3450000 5' 6528 19572 0.91 5.1E-01 AV712326.1 EST_HUMAN AV712326 DCA Homo sapiens cDNA clone DCAAUF07 5' 7246 20155 33395 1.3 5.1E-01 R80873.1 EST_HUMAN yi94a09.s1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE:146872 3' 8856 21786 35135 0.52 5.1E-01 BE772052.1 EST_HUMAN CM4-FT0103-220600-210-e12 FT0103 Homo sapiens cDNA Page 54 OF 545<BR> Table 4<BR> Single Exon Probes Expressed in Aduit Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 9135 22063 35422 0.81 5.1E-01 AW806881.1 EST_HUMAN QV4-ST0023-160400-172-a01 ST0023 Homo saplens cDNA 9135 22063 35423 0.81 5.1E-01 AW806881.1 EST_HUMAN QV4-ST0023-160400-172-a01 ST0023 Homo saplens cDNA 10209 23100 36500 4.79 5.1E-01 J05412.1 NT Human regenerating protein (reg) gene, complete cds 10211 23102 36503 3.8 5.1E-01 W22302.1 EST_HUMAN 65B1 Human retina cDNA Tsp5091-cleaved sublibrary Homo sapiens cDNA not directional 10656 23542 36976 1.02 5.1E-01 M94579.1 NT Human carboxyl ester llpase (CEL) gene, complete cds 12434 25702 2.66 5.1E-01 BF030207.1 EST_HUMAN 601556863F1 NIH_MGC_58 Homo sapiens cDNA clone IMAGE:3826767 5' nac51f10.x1 NCI_CGAP_Brn23 Homo sapiens cDNA clone IMAGE:3406218 3' similar to contains element 12664 25335 1.86 5.1E-01 BF43e9982.1 EST_HUMAN TAR1 repetitive element ; 2148 15161 28162 0.98 5.0E-01 4885552 NT Homo sapiens postmeiotic segregation increased 2-like 9 (PMS2L9), mRNA 2148 15161 28163 0.98 5.0E-01 4885552 NT Homo sapiens postmeiotic segregation increased 2-like 9 (PMS2L9), mRNA Buchnera aphidicola genomic fragment containing (chaperone Hsp60) groEL, DNA blosynthesis initiating protein (dnaA), ATP operon (atpCDGAHFEB), and putative chromosome replication protein (gldA) genes, 2159 15171 28174 1.28 5.0E-01 AF008210.1 NT complete cds; and termination factor Rho (rho) gene> Buchnera aphidicola genomic fragment containing (chaperone Hsp60) groEL, DNA blosynthesis initiating protein (dnaA), ATP operon (atpCDGAHFEB), and putative chromosome replication protein (gldA) genes, 2159 15171 28175 1.28 5.0E-01 AF008210.1 NT complete cds; and termination factor Rho (rho) gene> 3904 16933 29812 1.11 6.0E-01 L38483.1 NT Rattus norvegicus jagged protein mRNA, complete cds 3942 16970 29852 3.68 6.0E-01 AB033010.1 NT Homo sapiens mRNA for KIAA1184 protein, partial cds 5776 18848 31952 0.44 5.0E-01 U30320.1 NT Sparus aurata gonadotropin-releasing hormone (sbGnRH) precursor mRNA, complete cds 5776 18848 31953 0.44 5.0E-01 U30320.1 NT Sparus aurata gonadotropin-releasing hormone (sbGnRH) precursor mRNA, complete cds 6936 19965 0.62 5.0E-01 BF575199.1 EST_HUMAN602132642F1 NIH_MGC_81 Homo saplens cDNA clone IMAGE:4271939 5' 7029 2005 33288 0.55 5.0E-01 AF042848.1 NT Homo sapiens EMMPRIN gene, promoter and exon 1 8115 21026 34351 0.74 5.0E-01 AL161549.2 NT Arabidopsis thaliana DNA chromosome 4, conting fragment No. 49 8115 21026 34352 0.74 5.0E-01 AL161549.2 NT Arabidopsis thaliana DNA chromosome 4, conting fragment No. 49 8371 21275 0.44 5.0E-01 Z71560.1 NT S.cerevislae chromosome XIV reading frame ORF YNL284c 9094 22023 1.97 5.0E-01 M92304.1 NT Xenopus laevis smooth muscle beta-tropoomyosin mRNA, complete cds 9228 22156 35509 0.69 5.0E-01 BF107848.1 EST_HUMAN 601823850R1 NIH_MGC_79 Homo sapiens cDNA clone IMAGE:4043485 3' 9990 21348 34682 3.39 5.0E-01 BF317212.1 EST_HUMAN 601903871F1 NIH_MGC_19 Homo sapiens cDNA clone IMAGE:4136632 5' GLYCOGEN DEBRANCHING ENZYME (GLYCOGEN DEBRANCHER) [INCLUDES: 4-ALPHA- GLUCANO TRANSFERASE (OLIGO-1,4-1,4-GLUCANTRANSFERASE); AMYLO-1,6-GLUCOSIDASE 10151 23042 36441 1.63 5.0E-01 P35573 SWISSPROT (DEXTRIN 6-ALPHA-D-GLUCOSIDASE)] GLYCOGEN DEBRANCHING ENZYME (GLYCOGEN DEBRANCHER) [INCLUDES: 4-ALPHA- GLUCANO TRANSFERASE (OLIGO-1,4-1,4-GLUCANTRANSFERASE); AMYLO-1,6-GLUCOSIDASE 10151 23042 36442 1.63 5.0E-01 P35573 SWISSPROT (DEXTRIN 6-ALPHA-D-GLUCOSIDASE)] Page 55 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 10878 23764 0.86 5.0E-01 EB869218.1 EST_HUMAN 601445024F1 NIH_MGC_65 Homo sapiens cDNA clone IMAGE:3849436 6' 11066 23950 37386 0.59 5.0E-01 AW845172.1 EST_HUMAN QV0-CT0010-100899-009 CT0010 Homo sapiens cDNA 12380 25160 4.42 5.0E-01 AF029215.1 NT Mus musculus MRC OX-2 antigen homolog gene, exons 2-5, and complete cds 13028 25508 3.91 5.0E-01 AL163302.2 NT Homo sapiens chromosome 21 segment HS21C102 13039 25576 3 5.0E-01 O13961 SWISSPROT NUCLEAR ENVELOPE ENVELOPE PROTEIN CUT11 816 13871 26808 1.95 4.9E-01 BF57146.1 EST_HUMAN 602076649F1 NIH_MGC_62 Homo sapiens cDNA clone IMAGE:4243860 5' 1686 14716 27677 1.09 4.9E-01 AJ243955.1 NT Xenopus laevis mRNA for c Jun protein, 1978 BP 4788 17792 0.99 4.9E-01 AW968790.1 EST_HUMAN EST380866 MAGE resequences, MAGJ Homo sapiens cDNA 5591 18667 31545 1.38 4.9E-01 Q61554 SWISSPROT FIBRILLIN 1 PRECURSOR 6270 19321 32485 2.64 4.9E-01 AF020931.1 NT Homo sapiens diacylglycerol kinase 3 (DAGK3) gene, exon 10 6270 19321 32486 2.64 4.9E-01 AF020931.1 NT Homo sapiens diacylglycerol kinase 3 (DAGK3) gene, exon 10 7856 20783 34086 1.65 4.9E-01 AB040051.1 NT Cryza sativa subsp. japonica mEF-G mRNA for mitochondrial elongation factor G, complete cds 8164 21071 34400 0.7 4.9E-01 Q10606 SWISSPROT PUTATIVE UNDECAPRENYL-PHOSPHATE ALPHA-N-ACETYLGLUCOSAMINYL TRANSFERASE 8164 21071 34401 0.7 4.9E-01 Q10606 SWISSPROT PUTATIVE UNDECAPRENYL-PHOSPHATE ALPHA-N-ACETYLGLUCOSAMINYL TRANSFERASE 9541 22468 2.01 4.9E-01 BF209791.1 EST_HUMAN 601874964F1 NIH_MGC_54 Homo sapiens cDNA clone IMAGE:4102503 5' hc90c02.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2907266 3' similar to TR:O95714 9729 22654 36037 1.17 4.9E-01 AW339905.1 EST_HUMAN O95714HERC2. ; 9836 25992 2.07 4.9E-01 10946863 NT Mus musculus unc13 homolog (C. elegans) 1 (Unc13h1), mRNA 10807 23693 37120 1.11 4.9E-01 AF053980.1 NT Mus musculus adenylyl cyclase 1 (Adcy1) cDNA, partial cds 11002 23886 37319 0.53 4.9E-01 X90000.1 NT H.sapiens DNA for BCL7A gene and BCL7A/IGH locus fusion 13020 25942 4.94 4.9E-01 AA613562.1 EST_HUMAN nq22e11.s1 NCI_CGAP_Co10 Homo sapiens cDNA clone IMAGE:1144652 3' 13029 25569 31738 1.58 4.9E-01 AL163301.2 NT Homo sapiens chromosome 21 segment HS21C101 Homo sapiens potassium channel, subamily K, member 5 (TASK-2) (KCNK5) mRNA, and translated 4440 17451 0.72 4.8E-01 4504850 NT products Homo sapiens potassium channel, subamily K, member 5 (TASK-2) (KCNK5) mRNA, and translated 4787 17451 0.8 4.8E-01 4504850 NT products Saccharomyces cerevisiae) sporulation protein (SPO11) gene required for meiotic recombination complete 5697 18770 31698 8.47 4.8E-01 J02987.1 NT cds 6975 20002 33234 0.75 4.8E-01 U92882.1 Mus musculus slow skeletal muscle troponin T (Tnnt1) gene, complete cds 6985 20012 4.23 4.8E-01 AA659878.1 EST_HUMAN nu85f09.s1 NCI_CGAP_Aiv1 Homo sapiens cDNA clone IMAGE:1217513 7700 20632 2 4.8E-01 5031650 NT Homo sapiens reproduction 8 (D8S2298E) mRNA 8118 21029 34356 0.88 4.8E-01 AL163209.2 NT Homo sapiens chromosome 21 segment HS21C009 8229 21134 34465 3.51 4.8E-01 AL161492.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 4 8229 21134 34466 3.51 4.8E-01 AL161492.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 4 Page 56 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value yl77f10.y5 Soares breast 2NbHBst Homo sapiens cDNA clone IMAGE: 154795 5' similar to conteins element 8484 21415 34752 1.2 4.8E-01 AI820744.1 EST_HUMAN MER6 repetitive element; 9787 22751 1.06 4.8E-01 BE155148.1 EST_HUMAN PM1-HT0350-201299-004-b04 HT0350 Homo sapiens cDNA 10513 23400 0.58 4.8E-01 BF568633.1 EST_HUMAN 602184267F1 NIH_MGC_42 Homo sapiens cDNA clone IMAGE:4300048 5' 11170 24098 2.4 4.8E-01 X83502.1 NT S.cerevisiae ORFs from chromosome X 12357 25146 1.66 4.8E-01 AL163227.2 NT Homo sapiens chromosome 21 segment HS21C027 12561 25735 4.16 4.8E-01 AF227565.1 NT Trypanosoma cruzi transposon VI(P II SIRE repeat region 3123 16174 0.74 4.7E-01 AF192387.1 NT Fells catus feline leukemia virus subgroup C receptor (FLVCR10 mRNA, complete cds 6793 19826 33036 8.84 4.7E-01 BF217173.1 EST_HUMAN 601883880F1 NIH_MGC_57 Homo sapiens cDNA clone IMAGE:4096387 5' 7392 20091 33325 0.74 4.7E-01 AI204374.1 EST_HUMAN qf72a09.x1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1755544 3' 8446 21378 34719 0.68 4.7E-01 T11414.1 EST_HUMAN hbc811 Human pancreatic islet Homo sapiens cDNA clone hbc811 5'end 8446 21378 34720 0.68 4.7E-01 T11414.1 EST_HUMAN hbc811 Human pancreatic islet Homo sapiens cDNA clone hbc811 5'end 11282 24203 5.26 4.7E-01 AF102673.1 NT Influenza A virus isolate hk51697 hemagglutinin (HA) gene, partial cds 11525 24435 37893 2.11 4.7E-01 U41069.1 NT Human collagen alpha2(XI) (COL11A2) gene, exons 6 through 16, and partial cds 11728 24630 38110 1.4 4.7E-01 BF529658.1 EST_HUMAN 602043889F1 NCI_CGAP_Brn67 Homo sapiens cDNA clone IMAGE:4181303 5' 11815 24736 38227 1.58 4.7E-01 AW889448.1 EST_HUMAN RC6-NT0029-240400-011-E08 NT0029 Homo sapiens cDNA 12463 25210 2.06 4.7E-01 BE887763.1 EST_HUMAN 601511333F1 NIH_MGC_71 Homo sapiens cDNA clone IMAGE:3912488 5' 3806 16837 29723 2.16 4.6-01 BF693300.1 EST_HUMAN 602081103F1 NIH_MGC_81 Homo sapiens cDNA clone IMAGE:4245481 5' 3806 16837 29724 2.16 4.6-01 BF693300.1 EST_HUMAN 602081103F1 NIH_MGC_81 Homo sapiens cDNA clone IMAGE:4245481 5' 5604 18680 31557 0.93 4.6-01 BF313593.1 EST_HUMAN 601900234F1 NIH_MGC_19 Homo sapiens cDNA clone IMAGE:4129472 5' 5604 18680 31558 0.93 4.6-01 BF313593.1 EST_HUMAN 601900234F1 NIH_MGC_19 Homo sapiens cDNA clone IMAGE:4129472 5' 5659 18733 31639 3.46E-01 Q90643 SWISSPROT INTERFERON REGULATORY FACTOR 3 (IRF-3) 5659 18733 31640 3.46E-01 Q90643 SWISSPROT INTERFERON REGULATORY FACTOR 3 (IRF-3) 5737 18810 31904 2.35 4.6E-01 BE734781.1 EST_HUMAN 601568755F1 NIH_MGC_21 Homo sapiens cDNA clone IMAGE:3843637 5' qh59h02.x1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:1849011 3' similar to 5751 18824 31921 2.32 4.6E-01 AI247679.1 EST_HUMAN TR:O15338 O15338 BUTYROPHILIN.; qh59h02.x1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:1849011 3' similar to 5751 18824 31922 2.32 4.6E-01 AI247679.1 EST_HUMAN TR:O15338 O15338 BUTYROPHILIN.; 5759 18832 31933 1.52 4.6E-01 P20050 SWISSPROT MEIOSIS SPECIFIC PROTEIN HOP1 5843 18914 0.66 4.6E-01 AF212124.1 NT Anolis schwartzi cytochrome b gene, partial cds; mitochondrial gene for mitochondrial product 5934 19001 0.86 4.6E-01 BE817247.1 EST_HUMAN PM0-BN0260-120600-001-F07 BN0260 Homo sapiens cDNA 6117 19176 32311 0.46 4.6E-01 D26215.1 NT Unidentified soll bacterla 16S rRNA gene encoding 16S ribosomal RNA Methanobacterium thermoautotrophicum from bases 1165751 to 1176238 (section 100 of 148) of the 6506 19550 32730 0.95 4.6E-01 AE000894.1 NT complete genome page 57 of 545<BR> Table 4<BR> single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 7020 20046 33281 0.49 4.6E-01 AF115340.1 NT Bacillus subtills Bmma (bbma) gene, complete de Emericella nidulans NEMPA (nempA) gene, mitochondrial gene encoding putative mitochondrial protein, 7073 20279 33533 1.66 4.6E-01 U62332.1 NT complete cds Emericella nidulans NEMPA (nempA) gene, mitochondrial gene encoding putative mitochondrial protein, 7073 20279 33534 1.66 4.6E-01 U62332.1 NT complete cds 7600 26672 33824 0.63 4.6E-01 L07320.1 NT Murine cytomegalovirus et protein gene, complete cds nh04h05.s1 NCI_CGAP_Thyl Homo sapiens cDNA clone IMAGE:943353 similar to contains Alu repetitive 8192 21099 34429 0.74 4.6E-01 AA493577.1 EST_HUMAN element;contains element L1 repetitive element; GENOME POLYPROTEIN [CONTAINS: N-TERMINAL PROTEIN (P1); HELPER COMPONENT PROTEINASE (HC-PRO); PROTEIN P3; 6 KD PROTEIN 1 (6K1); CYTOPLASMIC INCLUSION PROTEIN (CI); 6 KD PROTEIN 2 (6K2); GENOME-LINKED PROTEIN (VPG); NUCLEAR INCLUSION PROTEIN A 8229 21131 0.49 4.6E-01 Q90069 SWISSPROT (NI-A) (NI> 8300 21204 0.56 4.6E-01 AE004031.1 NT Xylella fastidiosa, section 177 of 229 of the complete genome 8895 21825 35177 19.05 4.6E-01 BF697399.1 EST_HUMAN 602130953F1 NIH_MGC_56 Homo sapiens cDNA clone IMAGE:4287828 5' oo76b08.s1 NCI_CGAP_Kid5 Homo sapiens cDNA clone IMAGE:1572087 3' similar to gb:M36341 ADP- 9306 22234 35594 0.51 4.6E-01 AA932237.1 EST_HUMAN RIBOSYLATION FACTOR 4 (HUMAN); oo76b08.s1 NCI_CGAP_Kid5 Homo sapiens cDNA clone IMAGE:1572087 3' similar to gb:M36341 ADP- 9306 22234 35595 0.51 4.6E-01 AA932237.1 EST_HUMAN RIBOSYLATION FACTOR 4 (HUMAN); ATRIAL NATRIURETIC PEPTIDE RECEPTOR B PRECURSOR (ANP-B) (ANPRB) (GC-B) (GUANYLATE 9841 22746 36128 1.04 4.6E-01 P55202 SWISSPROT CYCLASE) ATRIAL NATRIURETIC PEPTIDE RECEPTOR B PRECURSOR (ANP-B) (ANPRB) (GC-B) (GUANYLATE 9841 22746 36129 1.04 4.6E-01 P55202 SWISSPROT CYCLASE) 10482 23370 36782 1.64 4.6E-01 AI9156341. EST_HUMAN wg73e12.x1 Soares_NSF_F8_9W_OT_PA_P_S1 Homo sapiens cDNA clone IMAGE:2370766 3' 10482 23370 36783 1.64 4.6E-01 AI9156341. EST_HUMAN wg73e12.x1 Soares_NSF_F8_9W_OT_PA_P_S1 Homo sapiens cDNA clone IMAGE:2370766 3' 11429 24345 2.79 4.6E-01 P98163 SWISSPROT PUTATIVE VITELLOGENIN RECEPTOR PRECURSOR (YL) 11438 24354 37801 5.16 4.6E-01 BE 185449.1 EST_HUMAN IL5-HT0730-100500-075-g05 HT0730 Homo saplens cDNA 11438 24354 37802 5.16 4.6E-01 BE 185449.1 EST_HUMAN IL5-HT0730-100500-075-g05 HT0730 Homo saplens cDNA 11903 24003 37442 5.82 4.6E-01 AF019369.1 NT Human thiopurine methyltransferase (TPMT) gene, exon 10 and complete cds 11903 24003 37443 5.82 4.6E-01 AF019369.1 NT Human thiopurine methyltransferase (TPMT) gene, exon 10 and complete cds 12209 25043 38646 1.43 4.6E-01 M23080.1 NT Hordeum vulgare alpha-hordothionin (Hth-1) gene, complete cds 1733 14760 1.89 4.5E-01 BE311420.1 EST_HUMAN 601142105F1 NIH_MGC_14 Homo sapiens cDNA clone IMAGE:3505993 5' 1927 14948 27924 1 4.5E-01 AE001931.1 NT Deinococcus radiodurans R1 section 68 of 229 of the corrplete chromosome 1 1927 14948 27925 1 4.5E-01 AE001931.1 NT Deinococcus radiodurans R1 section 68 of 229 of the corrplete chromosome 1 2913 15966 28865 5.96 4.5E-01 AA677086.1 EST_HUMAN zj55d02.s1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:454179 3' Page 58 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value BASEMENT MEMBRANE-SPECIFIC HEPARAN SULFATE PROTEOGLYCAN CORE PROTEIN 3362 16406 29307 6.69 4.5E-01 Q05793 SWISSPROT PRECURSOR (HSPG) (PERLECAN) (PLC) 3435 16476 29382 1.71 4.5E-01 AF126378.1 NT Mus musculus DNA polymerase epsilon catalytic subunit (Pole) gene, exons 2 through 12 4112 17136 1.38 4.5E-01 Q28247 SWISSPROT COLLAGEN ALPHA 5(IV) CHAIN 4161 17182 30055 0.89 4.5E-01 AI708908.1 EST_HUMAN as96e09.x1 Barstead aorta HPLRB6 Homo sapiens cDNA clone IMAGE:2353480 3' 4272 18412 4.09 4.5E-01 AW873495.1 EST_HUMAN ho60g02.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:3041810 3' 5057 18054 30907 1.33 4.5E-01 BE963445.2 EST_HUMAN 601657225R1 NIH_MGC_67 Homo sapiens cDNA clone IMAGE:3866023 3' 5740 18813 31909 1.49 4.5E-01 AW608814.1 EST_HUMAN QV2-PT0012-140100-031-c09 PT0012 Homo sapiens cDNA 6892 19922 1.6 4.5E-01 Q00956 SWISSPROT COAT PROTEIN 7813 20742 34046 0.68 4.5E-01 M37036.1 NT Rat nucleolar proteins B23.1 and B23.2 wl32e02.x1 NCI_CGAP_UI1 Homo sapiens cDNA clone IMAGE:2426618 3' similar to TR:Q92923 Q92923 8053 20966 34281 2.54 4.5E-01 AI858849.1 EST_HUMAN SWI/SNF COMPLEX 170 KDA SUBUNIT.; 8882 21812 1.43 4.5E-01 M32661.1 NT D.melanogaster Shaw2 protein mRNA, complete cds 8974 21904 34260 2.98 4.5E-01 AI648596.1 EST_HUMAN tz56g11.x1 NCI_CGAP_Ov35 Homo sapiens cDNA clone IMAGE:2292644 3' POLY-BETA-HYDROXYBUTYRATE POLYMERASE (POLY(3-HYDROXYBUTYRATE) POLYMERASE) (PHB POLYMERASE) (PHB SYNTHASE) (POLY(3-HYDROXYALKANOATE) POLYMERASE) (PHA 9122 22050 35410 0.8 4.5E-01 Q52728 SWISSPROT POLYMERASE) (PHA SYNTHASE) (POLYHYDROXYALKANOIC ACID SYNTHASE) 9340 22268 2.07 4.5E-01 11444786 NT Homo sapiens hypothetical protein DKFZp547G183 (DKFZp547G183), mRNA 9551 22478 35837 0.83 4.5E-01 AE000218.1 NT Escherichia coli K-12 MG1655 section 108 of 400 of the complete genome 10450 23339 1.02 4.5E-01 9630816 NT Bombyx mori nuclear polyhedrosis virus, complete genome 10973 23857 37284 24.91 4.5E-01 M86006.1 EST_HUMAN EST02531 Fetal brain, Stratagene (cat#936206) Homo sapiens cDNA clone HFBCY17 10973 23857 37285 24.91 4.5E-01 M86006.1 EST_HUMAN EST02531 Fetal brain, Stratagene (cat#936206) Homo sapiens cDNA clone HFBCY17 xo14h01.x1 NCI_CGAP_Ut3 Homo sapiens cDNA clone IMAGE:2703985 3' similar to SW:INT6_MOUSE 11298 24217 37667 2.63 4.5E-01 AW591271.1 EST_HUMAN Q64252 VIRAL INTEGRATION SITE PROTEIN INT-6. [1]; 11699 24601 1.43 4.5E-01 AV719382.1 EST_HUMAN AV719382 GLC Homo sapiens cDNA clone GLCCED12 6' 12253 25932 4.79 4.5E-01 BE871461.1 EST_HUMAN 601449201F1 NIH_MGC_65 Homo sapiens cDNA clone IMAGE:3852961 5' 12935 25503 5.32 4.5E-01 11422099 NT Homo sapiens testis-specific kinase 2 (TESK2), mRNA 2050 15067 9.95 4.4E-01 6680503 NT Mus musculus integral membrane-associated protein 1 (ltmap1), mRNA VASCULAR ENDOTHELIAL GROWTH FACTOR B PRECURSOR (VEGF-B) (VEGF RELATED 2412 15416 28418 4.14 4.4E-01 P49765 SWISSPROT FACTOR) 3360 16404 29305 1.59 4.4E-01 AF058790.1 NT Rattus norvegicus SynGAP-b mRNA, complete cds 3360 16404 29306 1.59 4.4E-01 AF058790.1 NT Rattus norvegicus SynGAP-b mRNA, complete cds 3364 16408 29309 2.86 4.4E-01 BF056726.1 EST_HUMAN 7j91d02.y1 NCI_CGAP_Br16 Homo sapiens cDNA clone IMAGE:3393795 5' Page 59 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 4334 17348 1.95 4.4E-01 BE378707.1 EST_HUMAN 601237139F1 NIH_MGC_44 Homo sapiens cDNA clone IMAGE:3609393 5' 5605 18681 31559 1.37 4.4E-01 P04929 SWISSPROT HISTIDINE-RICH GLYCOPROTEIN PRECURSOR 5605 18681 31560 1.37 4.4E-01 P04929 SWISSPROT HISTIDINE-RICH GLYCOPROTEIN PRECURSOR 5866 18955 32072 1.57 4.4E-01 S65019.1 NT mucin [rats, Sprague-Dawley, sulfur-dioxide-treated tracheal epithelium, mRNA Partial, 390 nt] 5904 18973 32091 1.92 4.4E-01 AV720408.1 EST_HUMAN AV720408 GLC Homo sapiens cDNA clone GLCCSC12 5' qi62h11.x1 NCI_CGAP_Brn25 Homo sapiens cDNA clone IMAGE:1861125 3' similar to TR:Q29168 Q29168 6179 19236 32382 1.09 4.4E-01 AI98413.1 EST_HUMAN UNKNOWN PROTEIN ; qi62h11.x1 NCI_CGAP_Brn25 Homo sapiens cDNA clone IMAGE:1861125 3' similar to TR:Q29168 Q29168 6179 19236 32383 1.09 4.4E-01 AI98413.1 EST_HUMAN UNKNOWN PROTEIN ; xc27e08.x1 NCI_CGAP_Co18 Homo sapiens cDNA clone IMAGE:2585510 3' similar to TR:O95154 O95154 6488 19532 32711 1.6 4.4E-01 AW080795.1 EST_HUMAN AFLATOXIN B1-ALDEHYDE REDUCTASE.; ae85d11.s1 Stratagene schizo brain S11 Homo sapiens cDNA clone IMAGE:970965 3' SIMILAR TO gb:M16028 6585 19626 0.98 4.4E-01 AA776132.1 EST_HUMAN TYROSINE-PROTEIN KINASE LYN (HUMAN); 7796 20725 34027 0.86 4.4E-01 AE000571.1 NT Helicobacter pylori 26695 section 49 of 134 of the complete genome 8361 25687 0.64 4.4E-01 AE001188.1 NT Treponema pallidum section 4 of 87 of the complete genome 8423 21355 13.12 4.4E-01 Z11679.1 NT S.tuberosum mRNA for induced stolon tip protein (partial) 9322 22250 35614 1 4.4E-01 AA056427.1 EST_HUMAN zl69a03.s1 Stratagene colon (#937204) Homo sapiens cDNA clone IMAGE:609836 3' 9694 22619 35997 0.78 4.4E-01 AF112540.1 NT HIV-1 isolate 08107v6 from USA, envelope glyooprotein (env) gene, partial cds hh05c08.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2954222 3' similar to 9725 22650 36032 0.56 4.4E-01 AW612578.1 4.4E-01 SW:MSH6_HUMAN P52701 DNA MISMATCH REPAIR PROTEIN MSH6 ; 9830 22736 36118 1.27 4.4E-01 O62836 SWISSPROT ZINC FINGER X-CHROMOSOMAL PROTEIN 10468 23356 36771 2.12 4.4E-01 AI268650.1 EST_HUMAN qo39f09.x1 NCI_CGAP-Lu5 Homo sapiens cDNA clone IMAGE:1910921 3' 10469 23357 2.33 4.4E-01 P28922 SWISSPROT GLYCOPROTEIN B PRECURSOR (GLYCOPROTEIN 14) 10599 23485 36914 4.95 4.4E-01 P35590 SWISSPROT TYROSINE-PROTEIN KINASE RECEPTOR TIE-1 PRECURSOR 10862 23748 37172 1.99 4.4E-01 S76404.1 NT bela -HKA=H,K-ATPase beta-subunit [rats, Genomic, 8983 nt, segment 2 of 2] 10862 23748 37173 1.99 4.4E-01 S76404.1 NT bela -HKA=H,K-ATPase beta-subunit [rats, Genomic, 8983 nt, segment 2 of 2] 12491 25232 31859 4.51 4.4E-01 6677874 NT Mus musculus sodium chennel, type X, alpha polypeptide (Son 10a), mRNA 12501 25673 15.77 4.4E-01 AL163282.2 NT Homo sapiens chromosome 21 segment HS21C082 434 13505 28429 1.87 4.3E-01 AF155218.1 NT Callithrix jacchus MW/LW opsin gene, upstream flanking region 434 13505 28430 1.87 4.3E-01 AF155218.1 NT Callithrix jacchus MW/LW opsin gene, upstream flanking region 1626 14656 27620 1.25 4.3E-01 AW866550.1 EST_HUMAN QV4-SN0024-200400-183-b01 SN0024 Homo sapiens cDNA 2915 15968 1.02 4.3E-01 AW935269.1 EST_HUMAN CM2-DT0003-010200-077-c01 DT0003 Homo sapiens cDNA 4249 17265 30132 1.59 4.3E-01 J00306.1 NT Human somatostatin I gene and flanks 4512 13505 26429 1.01 4.3E-01 AF155218.1 NT Callithrix jacchus MW/LW opsin gene, upstream flanking region Page 60 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 4512 13505 26430 1.01 4.3E-01 AF155218.1 NT Callithrix jacchus MW/LW opsin gene, upstream flanking region 5261 18247 1.11 4.3E-01 9635260 NT Xestia c-nigrum granulovirus, complete genome 5549 18627 31503 0.9 4.3E-01 P48634 SWISSPROT LARGE PROLINE-RICH PROTEIN BAT2 (HLA-B-ASSOCIATED TRANSCRIPT 2) 5549 18627 31504 0.9 4.3E-01 P48634 SWISSPROT LARGE PROLINE-RICH PROTEIN BAT2 (HLA-B-ASSOCIATED TRANSCRIPT 2) 6105 19166 32299 1.15 4.3E-01 BE181655.1 EST_HUMAN QV1-HT0638-70500-191-d08 HT0638 Homo sapiens cDNA 6125 19184 32319 2.07 4.3E-01 AF179825.1 NT Saimiri sciureus olfactory receptor (SSIC186) gene, partial cds 7005 20032 33264 4.36 4.3E-01 AJ001878.1 NT Cotumix cotumix japonica infG gene 7094 20300 33561 0.66 4.3E-01 AF075629.1 NT Equus caballus microsatellite LEX027 7191 20191 0.7 4.3E-01 O33367 SWISSPROT DNA GYRASE SUBUNIT B 7832 20761 1.55 4.3E-01 BF348001.1 EST_HUMAN 602023134F1 NCI_CGAP_Brn87 Homo sapiens cDNA clone IMAGE:4158296 5' 8333 21238 0.44 4.3E-01 M58643.1 NT Human lipoprotein associated coagulation inhibitor (LACI) gene, exon 2 8997 21926 3.19 4.3E-01 U97040.1 NT Methenoooccus voltae flagella-related protein C-I(flaC-fla@) genes, complete cds 9797 22761 36146 1.17 4.3E-01 Y14604.1 NT Erwinia amylovora rcsV gene 10247 23138 36543 1.91 4.3E-01 AW630048.1 EST_HUMAN hh74e10.y1 NCI_CGAP_GU1 Homo sapiens cDNA clone IMAGE:2968554 5' 10247 23138 36544 1.91 4.3E-01 AW630048.1 EST_HUMAN hh74e10.y1 NCI_CGAP_GU1 Homo sapiens cDNA clone IMAGE:2968554 5' xn63e05.x1 Soares_NHCeC_cervical_tumor Homo sapiens cDNA clone IMAGE:2698400 3' similar to 10723 23609 37039 0.66 4.3E-01 AW170559.1 EST_HUMAN TR:O00189O00189 MU-ADAPTIN-RELATED PROTEIN 2.; 10991 23875 37304 0.59 4.3E-01 H65292.1 EST_HUMAN yr45b05.s1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:208209 3' 11389 20300 33561 2.26 4.3E-01 AF075629.1 NT Equus caballus microsatellite LEX027 12163 24999 38500 1.53 4.3E-01 AI874332.1 EST_HUMAN tz64d04.x1 NCI_CGAP_Ov35 Homo sapiens cDNA clone IMAGE:2293351 3' 1385 15899 27371 1.38 4.2E-01 Q39102 SWISSPROT CELL DIVISION PROTEIN FTSH HOMOLOG PRECURSOR 3673 16706 29598 6.15 4.2E-01 AE003947.1 NT Xylella fastidiosa, section 93 of 229 of the complete genome 3705 16737 29626 1.13 4.2E-01 AI280338.1 EST_HUMAN ql94b01.x1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:1879945 3' 3774 18411 0.7 4.2E-01 N81203.1 EST_HUMAN 788iE1 fetal brain cDNA Homo sapiens cDNA clone 788iE1-K similar to R07879, Z40498 4067 17093 29977 1.16 4.2E-01 Q04886 SWISSPROT SOX-8 PROTEIN nj69h01.s1 NCI_CGAP_Pr10 Homo sapiens cDNA clone IMAGE:997777 similar to gb:M33600 HLA CLASS 4810 17811 30677 6.24 4.2E-01 AA534093.1 EST_HUMAN II HISTOCOMPATIBILITY ANTIGEN, DR-1 BETA CHAIN (HUMAN); 4894 17893 30759 4.12 4.2E-01 R13487.1 EST_HUMAN yf77e01.r1 Soares infant brain 1NIB Homo sapiens cDNA clone IMAGE:28278 5' 5914 18983 32102 1.58 4.2E-01 BF242055.1 EST_HUMAN 601879721F1 NIH_MGC_55 Homo sapiens cDNA clone IMAGE:4108493 5' 5990 19065 32182 1.71 4.2E-01 AW854162.1 EST_HUMAN RC3-CT0254-050400-029-g04 CT0254 Homo sapiens cDNA 6446 19492 32669 1.05 4.2E-01 AL163247.2 NT Homo sapiens chromosome 21 segment HS21C047 7283 20236 33486 9.31 4.2E-01 AU158472.1 EST_HUMAN AU158472 PLACD2 Homo sapiens cDNA clone PLACE200470 3' 7283 20236 33487 9.31 4.2E-01 AU158472.1 EST_HUMAN AU158472 PLACD2 Homo sapiens cDNA clone PLACE200470 3' 7355 25668 33618 2.39 4.2E-01 S82504.1 NT Brca1=breast cancer gene [rats, WF, spleen, Genomic, 419 nt, segment 2 of 2] Page 61 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 7452 20393 33663 6.45 4.2E-01 AL161547.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 47 8005 20922 34238 0.47 4.2E-01 Al163252.2 NT Homo sapiens chromosome 21 segment HS21C052 8572 21503 34846 3.88 4.2E-01 AW957448.1 EST_HUMAN EST369413 MAGE resequences, MAGE Homo sapiens cDNA 8572 21503 34847 3.88 4.2E-01 AW957448.1 EST_HUMAN EST369413 MAGE resequences, MAGE Homo sapiens cDNA Homo sapiens cytochrome c oxddase subunit Vlc (COX6C), nuclear gene encoding mitochondrial protein, 8784 21714 35061 0.58 4.2E-01 4758039 NT mRNA 9851 22766 36150 0.53 4.2E-01 U67431.1 NT Human cytomegalovirus early phosphoproteln p50 mRNA, complete cds 9851 22766 36151 0.53 4.2E-01 U67431.1 NT Human cytomegalovirus early phosphoproteln p50 mRNA, complete cds 10476 23364 0.66 4.2E-01 AA705007.1 EST_HUMAN zj95f01.s1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:462649 3' 10677 23563 36993 0.55 4.2E-01 AF181864.1 NT Lassa virus strain 803213 glycoprotein precursor and nucleoprotein genes, complete cds 10974 23858 37286 1.67 4.2E-01 AW863666.1 EST_HUMAN MR3-SN0010-280300-103-h07 Sn0010 Homo sapiens cDNA 11479 24392 37842 1.93 4.2E-01 AB023489.1 NT Oryzlas latipes OIGC7 mRNA for membrane guanylyi cyclase, complete cds 11833 24681 38173 2.4 4.2E-01 BE966485.2 EST_HUMAN 601660352R1 NIH_MGC_71 Homo sapiens cDNA clone IMAGE:3906085 3' 1121 14163 27100 1.72 4.1E-01 AI905481.1 EST_HUMAN RC-BT091-210 199-142 BT091 Homo sapiens cDNA 1130 14172 27109 1.01 4.1E-01 AV705243ADB Homo sapiens cDNA clone ADBAHF08 5' 1130 14172 27110 1.01 4.1E-01 AV705243ADB Homo sapiens cDNA clone ADBAHF08 5' 1632 14662 27625 1.02 4.1E-01 AI905949.1 EST_HUMAN PM-BT103-270499-684 BT 103 Homo sapiens cDNA 2760 15751 28747 1.51 4.1E-01 7705283 NT Homo sapiens anaphase-promoting comple subunit 7 (APC7), mRNA 2982 16033 28934 2.77 4.1E-01 AL161536.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 36 2982 16033 28935 2.77 4.1E-01 AL161536.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 36 3347 16393 29294 1.07 4.1E-01 AA906344.1 EST_HUMAN oj94b08.s1 Soares NFL T_GBC_S1 Homo sapiens cDNA clone IAMGE:1505943 3' 3839 16868 29751 1.67 4.1E-01 AW9612921 EST_HUMAN EST373364 MAGE resequences, MAGG Homo sapiens cDNA 3839 16868 29752 1.67 4.1E-01 AW9612921 EST_HUMAN EST373364 MAGE resequences, MAGG Homo sapiens cDNA 4373 17387 30251 3.51 4.1E-01 AJ249207.1 NT Rhodococcus sp. AD45 isoG, isoH, isol, iso@, isoA, isoB, isoC, isoD, isoE and isoF genes 4409 17421 0.69 4.1E-01 AA909257.1 EST_HUMAN cm33d02.s1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:1542819 3' 4572 17580 30442 1.03 4.1E-01 AI290232.1 EST_HUMAN ql85a10.x1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:1879098 3' 4778 17783 3653 1.49 4.1E-01 AV747880.1 EST_HUMAN AV747880 NPC Homo sapiens cDNA clone NPCBDF10 5' 4792 17796 30664 0.97 4.1E-01 AA460067.1 EST_HUMAN zx66d07.r1 Soares_total_fetus_Nb2HF8_9w Homo sapiens cDNA IMAGE:7964929 5' 4987 17986 30843 0.95 4.1E-01 BE621909.1 EST_HUMAN 601493807T1 NIH_MGC_70 Homo sapiens cDNA clone IMAGE:3896232 3' Homo sapiens aggrecan 1 (chondroitin sulfate proteoglycan 1, alrge aggregating proteoglycan, anfigen 5319 18303 31153 0.65 4.1E-01 6995993 NT identified by monoclonal antibody A0122) (AGC1), transcript variant 2, mRNA Homo sapiens aggrecan 1 (chondroitin sulfate proteoglycan 1, large aggregaling proteoglycan, antigen 5319 18303 31154 0.65 4.1E-01 6995993 NT identified by monocional antibody A0122) (AGC1), transcript varlant 2, mRNA 6220 19275 32429 4.22 4.1E-01 BF681393.1 EST_HUMAN 602156590F1 NIH_MGC_83 Homo sapiens cDNA clone IMAGE:4297319 5' Page 62 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 7016 20043 33277 0.68 4.1E-01 U02298.1 NT Mus musculus NIH 3T3 chemokine rantes (Scya5) gene, complet cds 7836 20784 34067 2.97 4.1E-01 U67535.1 NT Methanococcus jannaschil section 77 of 150 of the complete genome 8387 21291 0.47 4.1E-01 M84594.1 NT Homo sapiens aromatic dacarboxylase gene, exon 4 8613 21544 34885 1.69 4.1E-01 BF674604.1 EST_HUMAN 602133261F1 NIH_MGC_81 Homo sapiens cDNA clone IMAGE:4288238 5' 9636 22562 35932 1.34 4.1E-01 6755521 NT Mus mucculus signaling intermediate in Toll pathway-evolutionarily conserved (Sitpec-pending), mRNA Volalavo gymnocaudus Vgym560 cytochrome b (cytb) gene, complete cds; mitochondrial gene for 10094 22944 0.84 4.1E-0.1 AF160597.1 NT mitochondrial product 10756 23642 1.52 4.1E-01 AL139076.2 NT Camplyobacter jejuni NCTC11168 complete genome; segment 3/6 10895 23780 37207 1.13 4.1E-01 AV649579.1 EST_HUMAN Av649579 GLC Homo sapiens cDNA clone GLCBVD12 3' 10985 23869 37297 0.58 4.1E-01 P18684 SWISSPROT PROBABLE SERINE PROTEASE DO-LIKE PRECURSOR (59 KDA IMMUNOGENIC PROTEIN) (SK59) 10985 23869 37298 0.58 4.1E-01 P18684 SWISSPROT PROBABLE SERINE PROTEASE DO-LIKE PRECURSOR (59 KDA IMMUNOGENIC PROTEIN) (SK59) 11051 23935 1.01 4.1E-01 BF349382.1 EST_HUMAN CM2-HT0137-200999-010-e08 HT0137 Homo sapiens cDNA 11277 24199 37651 80.3 4.1E-01 X58700.1 NT Zea mays ZMPMS2 gene for 19 kDa zein protein 11830 23965 37400 2.12 4.1E-01 Q09470 SWISSPROT VOLTAGE-GATED POTASSIUM CHANNEL PROTEIN KV1.1 (HUKI) (HBK1) 12803 25912 2.53 4.1E-01 D87675.1 NT Homo sapiens DNA for amyloid precursor protein, complete cds 146 15867 3.81 4.0E-01 AW847123.1 EST_HUMAN RC2-CT0201-290999-012-d10 CT020 Homo sapiens cDNA 1066 14108 27046 0.97 4.0E-01 8404656 NT Laqueus rubellus mitochondrion, complete genome 1367 14399 27353 1.49 4.0E-01 AF203478.1 NT Drosophila melanogaster Dalmatian (dmt) mRNA, complete cds 1508 14534 5.87 4.0E-01 6679258 NT Mus musculus platelet derived growth factor receptor, beta polypeptide (Pdgfrb), mRNA 2852 13247 2165 1.48 4.0E-01 6678490 NT Mus mueculus ubiquitin-protein ligase c3 componen n-rcoognin (Ubr1), mRNA 3009 16061 28964 1.35 4.0E-01 AL163280.2 NT Homo sapiens chromosome 21 segment HS21C080 3009 16061 28965 1.35 4.0E-01 AL163280.2 NT Homo sapiens chromosome 21 segment HS21C080 Streptococcus pneumoniae YllC (yllC), YllD (yllD), pencillin-binding protein 2x(pbp2#), and undecaprenyl- phosphate-UDP-MurNAc-pentapeptide phospho-MurNAc-pentapeptide transferase (mraY) genes, complete 3760 16792 29683 2.47 4.0E-01 AF068903.1 NT cds 3901 16930 29808 4.68 4.0E-01 Aj277511.1 NT Ovis aries partial JD2 gene for T cell receptor delta chain (TCRDJ2), exon 1 3901 16930 29809 4.68 4.0E-01 Aj277511.1 NT Ovis aries partial JD2 gene for T cell receptor delta chain (TCRDJ2), exon 1 4931 179300 11.58 4.0E-01 Q31849 SWISSPROT NADH-PLASTOQUINONE OXIDOREDUCTASE CHAIN 5, CHLOROPLAST 6130 19189 32325 1.08 4.0E-01 AW970610.1 EST_HUMAN EST382691 MAGE resequences, MAGK Homo sapiens cDNA STRUCTURAL POLYPROTEIN (P130) [CONTAINS: COAT PROTEIN C; SPIKE GLYCOPROTEINS E3, 6706 19742 32944 0.76 4.0E-01 P27285 SWISSPROT E2 AND E1; 6 KD PEPTIDE] 8507 21438 34778 0.51 4.0E-01 BF092634.1 EST_HUMAN MR4-TN0110-180900-202-g02 TN0110 Homo sapiens cDNA 8590 21521 34866 1.1 4.0E-01 AB016625.1 NT Homo sapiens OCTN2 gene, complete cds Page 63 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 9558 22485 35845 1.27 4.0E-01 AA323289.1 EST_HUMAN EST 26066 Cerebellum II Homo sapiens cDnA 5' end similar to EST containing Alu repee@ 12001 24843 2.28 4.0E-01 BF030262.1 EST_HUMAN 601558283F1 NIH_MGC_58 Homo sapiens cDNA clone IMAGE:3828092 5' 12143 24983 2.52 4.0E-01 L76080.1 NT Synechocystls sp. PCC 9413 transposase gene, complete cds 12506 25785 1.58 4.0E-01 AL163300.2 NT Homo sapiens chromosome 21 segment HS21C100 1404 14435 27391 1.88 3.9E-01 AF206618.1 NT Gorilla gorilla carboxyl-ester lipase (CEL) gene, complete cds 2690 15684 28683 3.5 3.9E-01 AB033019.1 NT Homo sapiens mRNA for KIAA1193 protein, partial cds 2755 15746 28740 6.31 3.9E-01 X82032.1 NT H.sapiens B-myb gene 2755 15746 28741 6.31 3.9E-01 X82032.1 NT H.sapiens B-myb gene 3144 18194 29087 8.19 3.9E-01 AJ225896.1 NT Sinorhlzobium meliloti egi, syrB2, cya3 genes and orf3 4166 17187 30060 1.82 3.9E-01 BF592611.1 EST_HUMAN 7@61d01.x1 NCI_CGAP_Br16 Homo sapiens cDNA clone IMAGE:3339169 3' 5112 18109 30954 1.59 3.9E-01 BE728667.1 EST_HUMAN 601563948F1 NIH_MGC_20 Homo sapiens cDNA clone IMAGE:3833699 5' 6157 19215 32355 4.8 3.9E-01 BF208036.1 EST_HUMAN 601862362F1 NIH_MGC_63 Homo sapiens cDNA clone IMAGE:4082055 5' Homo sapiene zino finger protein 92 (ZFP92), expressed-Xq28STS protein (XQ28ORF), and biglycan (BGN) 6532 19576 32758 0.56 3.9E-01 U82695.2 NT genes, complete cds; and plasma membrane calclum ATpase isoform 3 (PMCA3) gene, partial cds 8532 21463 34803 1.02 3.9E-01 U79415.1 NT Homo sapiens prepro dipaptidyl paptidase I (DPP-I) gene, complete cds 9420 22348 35713 0.83 3.9E-01 AW177011.1 EST_HUMAN CM3-CT0105-170899-004-b08 CT0105 Homo sapiens cDNA 9428 22356 0.76 3.9E-01 BF348634.1 Homo sapiens 6020 19944F1 NCI_CGAP_Brn67 Homo sapiens cDNA clone IMAGE:4155322 5 xn86d04.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2701351 3' similar to TR:O94821 9776 22700 36086 1.93 3.9E-01 AW195888.1 EST_HUMAN C94821 KIAA0713 PROTEIN ; wp76a02.x1 NCI CGAP Bm25 Homo sapiens cDNA clone IMAGE:2467658 3' similar to 10074 22989 36384 1.68 3.9E-01 AI937337.1 EST_HUMAN SW:RFX5_HUMAN P48382 BINDING REGULATORY FACTOR.; 10390 23279 36700 3.46 3.9E-01 M19879.1 NT Human clabindn 27 gene, exons 10 and 11, and L1 and Alu repeats 10662 23548 36982 0.7 3.9E-01 D86722.1 NT Nicctiana tabacum mRNA for TATA binding protein (TBP), complete cds 10840 23726 37149 1.14 3.9E-01 BF361856. EST_HUMAN CM2-NN0034-030600-218-h04 NN0034 Homo sapiens cDNA 10840 23726 37150 1.14 3.9E-01 BF361856. EST_HUMAN CM2-NN0034-030600-218-h04 NN0034 Homo sapiens cDNA 11068 23952 37387 0.55 3.9E-01 M18440.1 NT Human bata-B2-crystallin (B2-1) gene, exon 4, partial cds 11259 24182 2.64 3.9E-01 AV695974.1 EST_HUMAN AV695974 GKC Homo sapiens cDNA clone GKCBQC11 5' 12170 25006 38509 1.64 3.9E-01 AV702623.1 EST_HUMAN AV702623 ADB Homo sapiens cDNA clone ADBDBE06 5' 12305 25851 3.39 3.9E-01 AF304354.1 NT Homo sapiens proteoglycan 3 (PRG3) gene, complete cds 12888 25480 1.63 3.9E-01 11433336 NT Homo sapiens hypothetical protein FLJ10583 (FLJ10583), mRNA 170 13271 3.69 3.8E-01 7019488 NT Homo sapiens protein klnase PKNbeta (pknbeta), mRNA 528 13597 4.86 3.8E-01 AB029291.1 NT Mus musculus pcm-1 mRNA for pericentriolar material-1, complete cds 1893 14914 1.11 3.8E-01 AE003870.1 NT Xylella fastidiosa, section 16 of 229 of the complete genome Page 64 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 2606 15604 28598 1.22 3.8E-01 AF214117.1 NT Arebidopsis thaliana putative 6-myb-like transoription factor (MYB3R-3) mRNA, complete cds 2679 15930 28673 5.44 3.8E-01 6678002 NT Mus musculus solute carrler family 1, member 6 (Slc 1a6), mRNA 3048 16098 22.67 3.8E-01 AJ251057.1 NT Human immunodeficiency virus type 1 complete genome (isolate 98SE-MP1213) 3095 16146 29044 2.06 3.8E-01 AF043383.1 NT Pleuronectes americanus aminopeptidase N (ampN) gene, partial cds 3542 16580 29483 10.02 3.8E-01 AL161518.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 30 3599 16636 0.69 3.8E-01 Ai807219.1 EST_HUMAN wf38b12.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2357855 3' 3614 16636 1.21 3.8E-01 AI807219.1 EST_HUMAN wf38b12.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2357855 3' 3820 16850 29734 1.38 3.8E-01 BE154080.1 Homo sapiens PM0-HT0339-200400-010-G01HT0339 Homo sapiens cDNA 3990 17017 2990 0.98 3.8E-01 6754095 NT Mus musculus general transcription factor II I (Gtf21), mRNA 5804 18876 31983 1.03 3.8E-01 Q04888 SWISPROT TRANSCRIPTION FACTOR SOX-10 6596 19637 0.5 3.8E-01 S46825.1 NT prion protein [mink, Genomic, 2446 nt] 6914 19944 33163 4.63 3.8E-01 BE072399.1 EST_HUMAN QV3-BT0537-271299-049-e02 BT0537 Homo sapiens cDNA ta54f11.x1 Soares_totel_fetus_Nb2HF8_9w Homo sapiens cDNA clone IMAGE:2047917 3' similar to 7065 20271 33527 4.54 3.8E-01 AI37460.1 EST_HUMAN contains Alu repetitive element; 7270 20178 33421 1.15 3.8E-01 AL161513.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 25 7922 20846 34160 4.03 3.8E-01 AA626274.1 EST_HUMAN zu88c05.s1 Soares_testis_NHP Homo sapiens cDNA clone IMAAGE:745064 3' 7939 20861 4.31 3.8E-01 X61597.1 NT M.musculus gene for kallikrein-binding protein 8189 21096 34427 0.53 3.8E-01 V00683.1 NT Yeast mitochondrial gene for ATPase (genes oli-2 and oli-4) 9120 22048 35407 3.24 3.8E-01 AB046851.1 NT Homo sapiens mRNA for KIAA1631 protein, pertial cds 9185 22113 35471 0.82 3.8E-01 11441264 NT Homo sapiens FOS-like antigen-f (FOSL1), mRNA 9376 22304 35665 1.45 3.8E-01 AL163279.2 NT Homo sapiens chromosome 21 segment HS21C079 ys43h06.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:120539 5' similar to contains 10090 22883 5.51 3.8E-01 T95413.1 EST_HUMAN Alu repetitive element,contains PTR5 repetitive element ; 10190 23081 36482 0.54 3.8E-01 7305518 NT Mus musculus Sfpi1PU.1 interaction partner (Spip), mRNA 11235 24161 1.72 3.8E-01 AV755814.1 EST_HUMAN AV755814 BM Homo sapiens cDNA clone BMFBCE07 5' 11965 24808 3.55 3.8E-01 BE719219.1 EST_HUMAN RC0-HT0841-040800-032-b12 HT0841 Homo sapiens cDNA 12117 24958 38461 2.41 3.8E-01 R42550.1 EST_HUMAN yf92h11.st Soares infant brain 1NIB Homo sapiens cDNA clone IMAGE:30289 3' 12117 24958 38462 2.41 3.8E-01 R42550.1 EST_HUMAN yf92h11.st Soares infant brain 1NIB Homo sapiens cDNA clone IMAGE:30289 3' 12492 25233 2 3.8E-01 AE001124.1 NT Borrelia burgdorferi (section 10 of 70) of the complete genome 12609 25870 1.71 3.8E-01 U94788.1 NT Human p53 (TP53) gene, complete cds 12720 25368 1.88 3.8E-01 BE829256.1 EST_HUMAN QV3-ET0063-190700-271-a05 ET0063 Homo sapiens cDNA 2504 15505 28507 10.48 3.7E-01 AB037831.1 NT Homo sapiens mRNA for KIAA1410 protein, partial cds 3521 16559 29461 12.37 3.7E-01 AF056336.1 NT Danlo rerlo bone morphogeneffc protein 4 precursor (BMP4) gene, compelte cds 3939 16967 29850 0.64 3.7E-01 AA319482.1 EST_HUMAN EST21715 Adrenal gland tumor Homo sapiens cDNA 5' end Page 65 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 4329 17343 30209 12.09 3.7E-01 AI218707.1 EST_HUMAN ok39c07.x1 Soares_NSF_F8_9W_OT_PA_P_S1 Homo sapiens cDNA clone IMAGE:1510188 3' 4426 17437 30297 1.58 3.7E-01 AW878037.1 EST_HUMAN MR3-OT0007-080300-104-b02 OT0007 Homo sapiens cDNA 4497 17507 30373 2.58 3.7E-01 AE002408.1 NT Neisserie meningitidie serogroup B strain MC59 section 50 of 206 of the complete genome 5971 19037 32158 1.22 3.7E-01 AF135187.1 NT Homo sapiens inferferon-induced protein p78 (MX1) gene, complete cds 6175 19232 32379 1 3.7E-01 AL163278.2 NT Homo sapiens chromosome 21 segment HS21C078 6788 19821 33033 0.96 3.7E-01 M10806.1 NT Chicken (White leghom) delta-1 and delta-2 crystallin genes, complete cds 6809 19842 0.69 3.7E-01 L10353.1 NT Mus saxicola haptoglobin mRNA, complete cds 7503 20442 33725 5.21 3.7E-01 11525843 NT Homo sapiens tumor endotheliaf marker 7 precursor (TEM7), mRNA 7828 20757 34061 0.51 3.7E-01 BE873743.1 EST_HUMAN 601483887F1 NIH_MGC_69 Homo sapiens cDNA clone IMAGE:3886652 5' 7828 20757 34062 0.51 3.7E-01 BE873743.1 EST_HUMAN 601483887F1 NIH_MGC_69 Homo sapiens cDNA clone IMAGE:3886652 5' 8263 21168 34502 0.66 3.7E-01 T66802.1 EST_HUMAN ya50a07.r3 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:66324 5' hd45d05.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2912457 3' similar to contains Alu 8349 21254 34589 0.48 3.7E-01 AW511326.1 EST_HUMAN repatitive element;containe L1 .t2 L1 repetitive element; 8904 21834 35189 2.31 3.7E-01 11436739 NT Homo sapiens chromosome 12 open reading frame 4 (C12ORF4), mRNA 8904 21834 35190 2.31 3.7E-01 11436739 NT Homo sapiens chromosome 12 open reading frame 4 (C12ORF4), mRNA 8937 21867 35225 0.79 3.7E-01 AA902912.1 EST_HUMAN ok43b11.s1 NCI_CGAP_Let2 Homo sapiens cDNA clone IMAGE:1516701 3' 9743 22667 1.67 3.7E-01 AJ271386.1 NT Gallus gallus mRNA for beta-carolene 15,15'-dioxygenase (bCDO gene) 10666 23552 0.55 3.7E-01 K00691.1 NT mouse ig germline alpha membrane exons region 10706 23592 37019 4.2 3.7E-01 AI336411.1 EST_HUMAN qt46b07.x1 Soares_feta_lung_NbHL19W Homo sapiens cDNA clone IMAGE:1950997 3' 11291 24211 37660 1.8 3.7E-01 X05958.1 NT Rabbit mRNA for fast skeletal muscle myosin heavy chain (MHC) 11471 24384 37832 5.03 3.7E-01 AJ297357.1 NT Homo sapiens partial LIMD1 gene for LIM domeins containing protein 1 and KIAA0851 gene 11471 24384 37833 5.03 3.7E-01 AJ297357.1 NT Homo sapiens partial LIMD1 gene for LIM domeins containing protein 1 and KIAA0851 gene 11898 23998 37436 2.46 3.7E-01 X04122.1 NT Bovine mRNA for terminal deoxynucleotidytransferase (TdT) (EC 2.7.7.31) 12100 24941 38444 2.93 3.7E-01 D79348.1 EST_HUMAN HUM230A06B Human eorta polyA+(TFujiwara) Homo sapiens cDNA clone GEN-230A06 5' oo46d03.s1 NCI_CGAP_Lu5 Homo sapiens cDNA clone IMAGE:1569221 3' similar to gb:M77698 12126 24967 1.9 3.7E-01 AA973540.1 EST_HUMAN TRANSCRIPTIONAL REPRESSOR PROTEIN YY1 (HUMAN); 12182 25018 3.09 3.7E-01 6677678 NT Mus musculus retinoblestome 1 (Rb1), mRNA 12386 25164 4.15 3.7E-01 AJ243525.1 NT Chlamydophila psittaci partial omp1 gene for outer membrane protein 1 12470 25216 1.98 3.7E-01 D86976.1 NT Human mRNA for KIAA0223 gene, partial cds 12813 25435 2.7 3.7E-01 AL121154.1 EST_HUMAN DKFZp762K076_r1 762 (synonym; hmel2) Homo sapiens cDNA clone DKFZp762K075 5' 12876 25475 31762 2.36 3.7E-01 Y18000.1 NT Homo sapiens NF2 gene 280 13374 26289 0.75 3.6E-01 AJ009609.1 NT Brassica napus mRNA for MAP4K aopha2 protein 1023 14072 6.82 3.6E-01 U89241.1 NT Human mibp gene, partial cds 1340 14373 27325 4.1 3.6E-01 T80255.1 EST_HUMAN yc03e05.r1 Soares infant brain 1NIB Homo sapiens cDNA clone IMAGE:24443 5' Page 66 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 1340 14373 27326 4.1 3.6E-01 T80255.1 EST_HUMAN yd03e05.r1 Soares infant brain 1NIB Homo sapiens cDNA clone IMAGE:24443 5' 1932 14953 27929 5.21 3.6E-01 AW590184.1 EST_HUMAN hg33f02.x1 NCI_CGAP_GC6 Homo sapiens cDNA clone IMAGE:2947419 3' 1932 14953 27930 5.21 3.6E-01 AW590184.1 EST_HUMAN hg33f02.x1 NCI_CGAP_GC6 Homo sapiens cDNA clone IMAGE:2947419 3' 1966 14984 27968 4.68 3.6E-01 AF216207.1 NT Mus musculus ribosomal protein S19 (Rps19) gene, complete cds 2288 15296 1.56 3.6E-01 AB002321.1 NT Human mRNA for KIAA0323 gene, partial cds 2413 15417 2.44 3.6E-01 X76725.1 NT P.irregulare (P3804) gene for actin 2497 15499 28499 1.31 3.6E-01 L05435.1 NT Ratlus norvegicus synaptic vesicle protein (SV2) mRNA, complete cds 2497 15499 28500 1.31 3.6E-01 L05435.1 NT Ratlus norvegicus synaptic vesicle protein (SV2) mRNA, complete cds 2510 15511 28514 1.77 3.6E-01 AW812033.1 EST_HUMAN RC5-ST0171-181099-011-g07 ST0171 Homo sapiens cDNA PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE (PROTEIN-BETA-ASPARTATE METHYL TRANSFERASE) 9PIMT) (PROTEIN L-ISOASPARTYL METHYLTRANSFERASE)(L- 2677 15673 28671 1.69 3.6E-01 P24206 SWISSPROT ISOASPARTYL PROTEIN CARBOXYL METHYL TRANSFERASE) 2942 18409 10.87 3.6E-01 AF199485.1 NT Drosophila melanogater eugar transporter 3 (#ut3) mRNA, complete cds 3530 16568 29471 1.92 3.6E-01 X76758.1 NT H.sapiens serotorin transporter gene, exons 9 and 10 3530 16568 29472 1.92 3.6E-01 X76758.1 NT H.sapiens serotorin transporter gene, exons 9 and 10 4514 17523 30388 1.24 3.6E-01 BE707883.1 EST_HUMAN RC1-HT0545-150600-014-b12 HT0545 Homo sapiens cDNA 4854 17856 30721 0.8 3.6E-01 AJ009609.1 NT Brassica napus mRNA for MAP4K alpha2 protein 5131 18127 30969 3.83 3.6E-01 AW339393.1 EST_HUMAN ha02g04.x1 NCI_CGAP_Lu24 Homo sapiens cDNA clone IMAGE:2872566 3' 5240 18227 31075 0.68 3.6E-01 BE067699.1 EST_HUMAN MR4-BT0358-270300-005-c10 BT0358 Homo sapiens cDNA 5567 18645 31523 0.75 3.6E-01 AJ006565.1 NT Homo sapiens lipe gene intron 5 FORMATE HYDROGENL YASE SUBUNIT 5 PRECURSOR (PHL SUBUNIT 5) 9HYDROGENASE-3 6323 19373 32541 0.92 3.6E-01 P16431 SWISSPROT COMPONENT E) 6752 19786 32998 1.55 3.6E-01 Y10196.1 NT Homo sapiens PHEX gene 7508 20447 3.84 3.6E-01 R94090.1 EST_HUMAN yt74a06.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:275987 5' wt72c10.x1 Soares_thymus_NHFTh Homo sapiens cDNA clone IMAGE:2513010 3' similar to TR:O15117 7662 20596 33895 1.47 3.6E-01 AW027174.1 EST_HUMAN O15117 FYN BINDING PROTEIN. [1]; xa94h12.x1 NCI_CGAP_Co17 Homo sapiens cDNA clone IMAGE:2574503 3' similar to contains element 8270 21175 34510 0.47 3.6E-01 AW079100.1 EST_HUMAN MER5 repetitive elemtn; 8802 21732 35081 0.74 3.6E-01 P89167 SWISSPROT SCO-SPONDIN 8855 21785 35134 8.06 3.6E-01 AL161583.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 79 Human hereditary haemochromatosis region, histone 2A-like protein gene, hareditary haemochromatosis 9530 22457 35819 0.57 3.6E-01 U91328.1 NT (HLA-H) gene, RoRet gene, and sodium phosphate transporter (NPT3) gene, complte cds Page 67 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value Human hereditary haemochromatosls region, histon 2A-like protein gene, heraditary haemochromatosis 9530 22457 35820 0.57 3.6E-01 U91328.1 NT (HLA-H) gene, RoRet gene, and sodium phosphate transporter (NPT3) gene, complete cds 9554 22481 35840 3.22 3.6E-01 4504956 NT Homo sapiens lysosomal-associated membrane protein 2 (LAMP2), transcript variant LAMP2A, mRNA 9554 22481 35841 3.22 3.6E-01 4504956 NT Homo sapiens lysosomal-associated membrane protein 2 (LAMP2), transcript variant LAMP2A, mRNA 9734 22659 36042 1.47 3.6E-01 AL163204.2 NT Homo sapiens chromsome 21 segment HS21C004 9935 22840 36228 1.05 3.6E-01 X17550.1 NT D. melanogaster singed gene, exons 3, 4, 5 & 6 9935 22840 36229 1.05 3.6E-01 X17550.1 NT D. melanogaster singed gene, exons 3, 4, 5 & 6 10002 22819 0.7 3.6E-01 X62825.1 NT C.perfringene plc gene for phospholipase C upstream egion containing bent DNA fragment 10377 23266 36688 20.27 3.6E-01 Q53194 SWISSPROT PROBABLE PEPTIDE ABC TRANSPORTER ATP-BINDING PROTEIN Y4TS 11383 24299 37745 1.94 3.6E-01 BE902390.1 EST_HUMAN 601676418F1 NIH_MGC_21 Homo sapiens cDNA clone IMAGE:3958997 5' 11550 24459 37922 3.81 3.6E-01 AB004293.1 NT Arabidopsis thaliana mRNA for SigB, complete cds Methanobacterium thermoautotrophicum from bases 702375 to 714311 (section 62 of 148) of the complete 11677 23977 37415 2.68 3.6E-01 AE000856.1 NT geome 12260 25970 4.08 3.6E-01 Y19210.1 NT Homo sapiens hHb5 gene for hair keratin, exons 1 to 9 12340 25135 7.58 3.6E-01 AE000335.1 NT Escharichia coli K-12 MG 1655 section 225 of 400 of the complete genome 12478 25222 3.44 3.6E-01 U66888.1 NT Mus musculus Emr1 mRNA, complete cds Homo sapiens myeloid3.6E-01lymphoid or mixed-lineage leukemia, (trithorax (Drosophila) homolog); translocated to, 12819 25439 1.81 3.6E-01 11432598 NT 10 (AF10), mRNA 119 13227 26139 1.45 3.5E-01 AL161536.2 NT Arbidopsis thaliana DNA chromosome 4, contig fragment No. 36 222 13321 26237 231 3.5E-01 6678933 NT Mus muscul;us mannose receptor, C type 2 (Mrc2), mRNA 701 13760 26677 4.76 3.5E-01 AL161581.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 77 748 13805 26730 1.48 3.5E-01 7705136 NT Homo sapiens GAP-like protein (LOC51306), mRNA 748 13805 26731 1.48 3.5E-01 7705136 NT Homo sapiens GAP-like protein (LOC51306), mRNA 806 13862 26797 3.87 3.5E-01 BF129796.1 EST_HUMAN 601811060R1 NIH_MGC_48 Homo sapiens cDNA clone IMAGE:4053951 3' 1642 1473 27638 1.06 3.5E-01 BF310688.1 EST_HUMAN 60184653F2 NIH_MGC_19 Homo sapiens cDNA clone IMAGE:4124244 5' 1666 14696 27656 0.95 3.5E-01 U35776.1 NT Raffus norvegicus ADP-ribosylation factor-directed GTPase activating protein mRNA, complete cds 2302 15310 28316 0.99 3.5E-01 P06798 SWISSPROT HOMEOBOXPROTEIN HOX-A4(HOX-1.4)(MH-3) 2648 15929 28643 1.14 3.5E-01 AA223252.1 EST_HUMAN zr08a09.s1 Stratagene NT2 neuronal precursor 937230 Homo sapiens cDNA clone IMAGE:650872 3' 3873 16902 0.91 3.5E-01 AA642138.1 EST_HUMAN nr60d03.s1 NCI_CGAP_Lym3 Homo sapiens cDNA clone IMAGE:1172357 3' Page 68 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 4362 17376 30239 2.6 3.5E-01 AF071253.1 NT Danlo rerio homeobox protein (haxb5b) gene, complete cds 5044 18041 30897 4.88 3.5E-01 M18349.1 NT Rat leukocyte common antigen (L-CA) gene, exons 1 through 5 5328 18312 31161 1.47 3.5E-01 H12094.1 EST_HUMAN ym11h12.s1 Soares infant brain 1NIB Homo sapiens cDNA clone IMAGE:47811 3' 5517 18596 31444 1.21 3.5E-01 Q96687 SWISSPROT EARLY E2A DNA-BINDING PROTEIN 5517 18596 31445 1.21 3.5E-01 Q96687 SWISSPROT EARLY E2A DNA-BINDING PROTEIN 5741 18814 31910 1.31 3.5E-01 D42045.1 NT Human mRNA for KIAA0086 gene, complete cds 6485 19530 1.02 3.5E-01 AW863916.1 EST_HUMAN PM4-SN0012-030400-001-a11 SN0012 Homo sapiens cDNA zw79f03.r1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:782429 5' similar to TR:G1066935 6673 19710 32905 0.59 3.5E-01 AA431833.1 EST_HUMAN G1066935 F10F2.1 ; 6721 19757 32964 0.64 3.5E-01 U37150.1 NT Bos leurue peptide methionine sulfoxide reductase (msrA) mRNA, complete cds 6958 19987 33211 0.92 3.5E-01 O24357 SWISSPROT GLUCOSE-6-PHOSPHATE 1-DEHYDROGENASE, CHLOROPLAST PRECURSOR (G6PD) 7409 20108 2.9 3.5E-01 X98505.1 NT S.scrofa mRNA for CD31 protein (PECAM-1) 7971 20893 34205 0.55 3.5E-01 P47281 SWISSPROT HISTIDYL-TRNA SYNTHETASE (HISTIDINE-TRNALIGASE) (HISRS) 7971 20893 34206 0.55 3.5E-01 P47281 SWISSPROT HISTIDYL-TRNA SYNTHETASE (HISTIDINE-TRNALIGASE) (HISRS) 8214 21119 34452 0.54 3.5E-01 X06091.1 NT E.coli L-arabinose transport operon with genes araF, araG and araH 8649 21580 2.72 3.5E-01 11448042 NT Homo sapiens tumor protein p53-binding protein, 2 (TP53BP2), mRNA 8652 21583 349180.69 3.5E-01 BF358871.L1 EST_HUMAN RC4-ET0024-260600-014-d07 ET0024 Homo sapiens cDNA 9036 21965 0.79 3.5E-01 AF051561.1 NT Rattus norvegicus Na-K-Cl cotransporter (Nlkco1) mRNA, complete cds 9482 22410 35771 1.34 3.5E-01 4507610 NT Homo sapiens tyrosine kinase ron-receceptor 1 (TNK1), mRNA VOLTAGE-DEPENDENT N-TYPE CALCIUM CHANNEL ALPHA1B SUBUNIT (CALCIUM CHANNEL, L 10255 23146 35554 1.98 3.5E-01 Q02294 SWISSPROT TYPE, ALPHA-1 POLYPEPOTIDE ISFORM5) (BRAIN CALCIUM CHANNEL III) (BIII) 10398 23287 36709 5.09 3.5E-01 Z26825.1 NT X.laevis glene for albumin including HP1 enhancer 10473 23361 36775 0.89 3.5E-01 BE174794.1 EST_HUMAN QV2-HT0677-090400-128-c07 HT0677 Homo sapiens cDNA 11175 24102 37548 3.66 3.5E-01 X61084.1 NT C.griseus rhodopsin gene for opsin protein 11462 24377 37826 2.05 3.5E-01 AJ243178.1 NT Galius gallus SPARC gene for osteonectin, promoter and exon 1 11462 24377 37826 2.05 3.5E-01 AJ243178.1 NT Galius gallus SPARC gene for osteonectin, promoter and exon 1 11953 24797 38297 1.51 3.5E-01 U07000.1 NT Human breakpoint cluster region (BCR) gene, complete cds 12022 24864 38365 1.58 3.5E-01 N77597.1 EST_HUMAN yz90h12.r1 Soares_)multiple_sclerosis_2NbHMSP Homo sapiens cDNA clone IMAGE:290376 5' 12044 24885 1.74 3.5E-01 M82885.1 NT Drosophila melanogaster dual bar protein (BarH2) gene, exon 1 12109 24950 38453 1.62 3.5E-01 L05145.1 NT Human glucokinase (GCK) gene, repeat polymorphism Schristosoma mansoni strain NMRI chromain assembly factor 1 small subunit-like protein (RBAP48) mRNA, 12351 25973 2.69 3.5E-01 AF297468.1 NT complete cds 12413 25182 4.57 3.5E-01 X64565.1 NT B.taurus atpA1 gene for F(0)F(1) ATP synthase alpha-subunit 12559 25271 1.93 3.5E-01 AE001774.1 NT Thermologa maritima section 86 of 136 of the complete genome Page 69 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 13094 25827 31486 2.82 3.5E-01 H80814.1 EST_HUMAN ys64f11.r1 Soar3es retina N2b4HR Homo sapiens cDNA clone IMAGE:219597 5' 13094 25827 31487 2.82 3.5E-01 H80814.1 EST_HUMAN ys64f11.r1 Soar3es retina N2b4HR Homo sapiens cDNA clone IMAGE:219597 5' Homo sapiens partial N-myc (exon 3), HPV45L2, HPV46 L1, HPV45 E6, HPV46 E7 and HPV45 E1 genes 730 13788 1.78 3.4E-01 AJ242956.1 NT isolated from IC4 cervical carcinoma cell line 1002 14051 26995 5.28 3.4E-01 Y09798.2 NT Pseudomonas fluorescens colR, colS genes, orf222 and partial inaA gene 1004 14053 26997 21.9 3.4E-01 AW380120.1 EST_HUMAN QV3-HT0261-241199-019-g10 HT0261 Homo sapiens cDNA 1354 14386 27339 1.3 3.4E-01 Y00554.1 NT Azotobacter vinelandii nifA gene for NifA protein (positive regulatory element) 2423 15427 28428 2.47 3.4E-01 D90909.1 NT Synechocystis sp. PCC6803 complete genome, 11/27, 1311235-1430418 3044 16096 28998 0.72 3.4E-01 AL163210.2 NT Homo sapiens chrosome 21 segment HS21C010 3044 16096 28999 0.72 3.4E-01 AL163210.2 NT Homo sapiens chrosome 21 segment HS21C010 3191 16240 29135 0.98 3.4E-01 D90909.1 NT Synechocystis sp. PCC6803 complete genome, 11/27, 1311235-1430418 3204 16252 29148 7.69 3.4E-01 U83905.1 NT Cains familiaris rod photoreceptor cGMP-gated channel alpha-subunit (CNGC1) mRNA, complete cds 3392 16435 29338 0.94 3.4E-01 AF034662.1 NT Homo sapiens pulmonary surfactant protein D, promoter region and exon 1 Methylovorus sp. strain SS1 putative GrpE (grpE), DnaK (dnaK), and putative DnaJ (dnaJ) genes, complete 3593 16630 29534 5.01 3.4E-01 AF106835.1 NT cds 7n94a01.x1 NCI_CGAP_Ov18 Homo sapiens cDNA clone IMAGE:3572232 3' similar to TR;Q9UJ15 3855 16884 1.31 3.4E-01 BF449010.1 EST_HUMAN Q9UJ15 DJ18C9.1 ; 4136 17157 1.62 3.4E-01 AA584196.1 EST_HUMAN no11b10.s1 NCI_CGAP_Phe1 Homo sapiens cDNA clone IMAGE:1100347 3' 4614 17622 30485 1.13 3.4E-01 AF166341.1 NT Homo sapiens integrin alpha 6 (ITGA6) gene, exons 12 through 23 4755 17760 30622 2.1 3.4E-01 BE069912.1 EST_HUMAN MR4-BT0404-230200-202-c01 BT0404 Homo sapiens cDNA 4771 17776 30644 1.42 3.4E-01 BF3146789.1 EST_HUMAN 601901632F1 NIH_MGC_19 Homo sapiens cDNA clone IMAGE:4130935 5' qj95c05.x1 NCI_CGAP_Kid3 Homo sapiens cDNA clone IMAGE:1867208 3' similar to contains Alu repetitive 5067 18064 6.1 3.4E-01 AI240973.1 EST_HUMAN element; nn73g04.s1 NCI_CGAP_Lar1 Homo sapiens cDNA clone IMAGE:1089558 3' similar to gb:M98776_ma1 5256 18242 0.66 3.4E-01 AA587031.1 EST_HUMAN KERATIN, TYPE II CYTOSKELETAL 1 (HUMAN); wu10d12.x1 NCI_CGAP_GC6 Homo sapiens cDNA clone IMAGE:2516567 3' similar to TR;Q13537 Q13537 5373 18355 31195 1.16 3.4E-01 AW002545.1 EST_HUMAN SIMILAR TO POGO ELEMENT. ; 5882 18951 32067 2.72 3.4E-01 AL161594.2 NT Arabidopsis thallana DNA chromosome 4, contig fragment No. 90 6022 19084 4.43 3.4E-01 AA085313.1 EST_HUMAN zn12d11.s1 Stratagene hNT neuron (#937233) Homo sapiens cDNA clone IMAGE:547221 3' 6239 19293 2.27 3.4E-01 L02971.1 NT Echovirus 22 1AB, 1C, 1D, 2A, 2B, 2C, 3A, 3B, 3C, 3D proteins RNA, complete mature peptides and cds 6263 19314 32479 0.83 3.4E-01 BE748912.1 EST_HUMAN 601571811T1 NIH_MGC-55 Homo sapiens cDNA clone IMAGE:3838826 3' 6346 19396 32563 2.27 3.4E-01 AW204505.1 EST_HUMAN UI-H-BI1-ael-e-12-0-Ul.s1 NCI_CGAP_Sub3 Homo sapiens cDNA clone IMAGE:2719582 3' Page 70 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 6482 19527 32705 1.82 3.4E-01 AL120544.1 EST_HUMAN DKFZp761A249_r1 761 (synonym: hamy2) Homo sapiens cDNA clone DKFZp761A249 5' 7047 20073 1.3 3.4E-01 N95225.1 EST_HUMAN zb53e12.s1 Soares_fetal_lung_nbHL19W Homo sapiens cDNA clone IMAGE:307342 3' tm53g05.x1 NCI_CGAP_Brn25 Homo sapiens cDNA clone IMAGE:2162840 3' similar to gb:S37431 7279 20232 33482 1.22 3.4E-01 AI468082.1 EST_HUMAN LAMININ RECEPTOR (HUMAN); 7413 20112 33346 0.48 3.4E-01 BF678702.1 EST_HUMAN 602085283F1 NIH_MGC_83 Homo sapiens cDNA clone IMAGE:4249365 5' 7886 20812 34118 0.41 3.4E-01 BE971689.1 EST_HUMAN 601651613R1 NIH_MGC_81 Homo sapiens cDNA clone IMAGE:3934947 3' 8485 21416 0.61 3.4E-01 AE000493.1 NT Escherichia coli K-12 MG 1655 section 383 of 400 of the complete genome 8814 21744 35092 0.77 3.4E-01 Y14930.1 NT Homo sapiens TCRAV28 gene, allele A4, partial 9056 21985 2 3.4E-01 AA337063.1 EST_HUMAN EST41765 Endometrial tumor Homo sapiens cDNA 5' end 9126 22054 35414 1.25 3.4E-01 L04690.1 NT Cricetulus griseus cholesterol 7-alpha-hydroxylase gene, complete cds 9411 22339 35703 1.9 3.4E-01 9633624 NT Bovine enterovirus strain K2577, complete genome 9753 22677 36061 4.32 3.4E-01 P26013 SWISSPROT INTEGRIN BETA-8 PRECURSOR 9753 22677 36062 4.32 3.4E-01 P26013 SWISSPROT INTEGRIN BETA-8 PRECURSOR 9955 22860 0.63 3.4E-01 AB017510.1 NT Ephydatia fluvietilis mRNA for PLC-gemmaS, complete cds 9979 21337 34672 5.71 3.4E-01 U19492.1 NT Sacharomyces cerevislae Maf1p (MAF1) gene, complete cds 9979 21337 34673 5.71 3.4E-01 U19492.1 NT Sacharomyces cerevislae Maf1p (MAF1) gene, complete cds 10218 23109 36510 0.93 3.4E-01 U68763.1 NT Glycine max putative transcription factor SCOF-1 (scof-1) mRNA, complete cds 10401 23290 36713 1.51 3.4E-01 AJ225084.1 NT Homo sapiens FAA gene, exon 16, 17 and 18 10956 23840 0.74 3.4E-01 AE04096.1 NT Vibrio cholerae chromosome I, section 4 of 251 of the complete chromosome Methanobacterium thermoautotrophicum from bases 1018444 to 1029212 (section 87 of 148) of the complete 11455 24371 4.38 3.4E-01 AE000881.1 NT genome 11491 24403 37854 3.01 3.4E-01 P06926 SWISSPROT PROBABLE E4 PROTEIN 11534 24444 37905 2.43 3.4E-01 AF045981.1 NT Rutilus arcasii cytochrome b (cytb) gene, mitochondrial gene encoding mitochondrial protein, partial cds 11729 24631 38111 1.62 3.4E-01 M25856.1 NT Human on Willebrand factor gene, exons 36 and 37 11729 24631 38112 1.62 3.4E-01 M25856.1 NT Human on Willebrand factor gene, exons 36 and 37 11930 24775 38273 2.47 3.4E-01 AB035507.1 NT Rattus norveglcus mRNA for s-glcerin(MUC18, complete cds 11958 24801 38299 3.9 3.4E-01 AL161515.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 27 12192 25027 38528 1.84 3.4E-01 BF061948.1 EST_HUMAN 7k69d12.x1 NCI_CGAP_GC6 Homo sapiens EST_HUMAN clone IMAGE:3480646 3' 12242 25066 2.46 3.4E-01 U93604.1 NT Citrus variegation virus putative replicase gene, partial cds 12344 25137 1.49 3.4E-01 Z21621.1 NT S.cerevisiae RIB5 gene encoding Riboflavin synthase 12433 25733 1.82 3.4E-01 AF254351.1 NT Schizosaccharomyces pombe Cwf8p (cwf8) gene, complete cds 12541 25261 12.67 3.4E-01 L26339.1 NT Human autoantigen mRNA, complete cds Page 71 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value hy42h08.x1 NCI_CGAP_Lu24 Homo sapiens cDNA clone IMAGE:3176127 3' similar to contains PTR5.t3 12566 26758 3.15 3.4E-01 BE218652.1 EST_HUMAN PTR5 repetitive element ; 12620 25847 2.91 3.4E-01 9838361 NT Beta vulgaris mitochondrion, complte genome 12725 25370 31801 1.9 3.4E-01 AJ297131.1 NT Mus musculus IL, MAP-17, CYP_a, SCL & CYP_b genes 12921 25930 1.46 3.4E-01 AJ288948.1 NT Clostridium cellulolyticum partial spolVB gene and spo0A gene, train ATCC 35319 Homo sapiens HLA class III region containing tenascin X (tenascin-X) gene, partial css; cytochrome P450 21- hydroxylase (CYP21B), complement componant C4 (C4B) G11, helicase (SK12W), RD, complement factor B 13002 2554 2.08 3.4E-01 AF019413.1 NT Bf), and complement component C2 (C2) genes.> 13101 25616 1.62 3.4E-01 11466174 NT Naegieria gruberi mitochondrion, complete genome 15 13130 26016 5.42 3.3E-01 X07990.1 NT Rhizobium eguminosarum sym plasmid pRL5JI nodX gene 109 13130 26016 4.93 3.3E-01 X07990.1 NT Rhizobium eguminosarum sym plasmid pRL5JI nodX gene 470 13541 26464 0.93 3.3E-01 AL161545.2 NT Arabidopsis thalitana DNA chromosome 4, contig fragment No. 45 656 13718 26629 2.53 3.3E-01 7662485 NT Homo sapiens KIAA1100 protein (KIAA1100), mRNA 1228 14265 27209 3.64 3.3E-01 Q12446 SWISSPROT PROLINE-RICH PROTEIN LAS17 1333 14367 27317 4.03 3.3E-01 BF568880.1 EST_HUMAN 602184016T1 NIH_MGC_42 Homo sapiens cDNA clone IMAGE:4300251 3' 1628 14658 27621 1 3.3E-01 6753685 NT Mus musculus disintegrin 5 (Dt5gn5), mRNA Homo sapiens uridine monophosphate synthetase (orotate phosphoribosyl transferase and orotidine-5'- 2428 15432 4.56 3.3E-01 4507834 NT decarboxylase) (UMPS) mRNA 2991 16043 28947 1.96 3.3E-01 AJ251805 NT Bacterlophage phi-YeO3-12 complete genome INTERLEUKIN-12 ALPHA CHAIN PRECURSOR (IK-12A) (CYTOTOXIC LYMPHOCYTE MATURATION 3060 16112 0.72 3.3E-01 O02743 SWISSPROT FACTOR 35 KD SUBUNIT) (CLMF P35) 3103 16154 29050 0.99 3.3E-01 AJ007932.2 NT Streptomyces argillacaus mithramycin biosynthetic genes 3554 16592 29497 1.71 3.3E-01 AB012922.1 NT Homo sapiens MTA1-L1 gene, complete cds 3877 16906 29787 2.5 3.3E-01 O84645 SWISSPROT EXPDEOXYRIBONUCLEASE V BETA CHAIN GENOME POLYPROTEIN [CONTANS: N-TERMINAL PROTEIN(P1); HELPER COMPONENT 3889 16918 29795 1.01 3.3E-01 P22602 SWISSPROT PROTEINASE (HC-PRO); PROTEIN P3] 4048 17075 29961 1.57 3.3E-01 AL161498.2 NT Arabidopsis thalian DNA chromosome 4, contig fragment No. 10 4087 17112 29990 1.92 3.3E-01 AF200446.1 NT Hypoxylon fragiforme chitin synthase gene, partial cds 4389 17403 1.1 3.3E-01 4769025 NT Homo sapiens RAS protein activator like 1 (GAP 1 like) (RASAL1) mRNA 4474 17485 1.79 3.3E-01 D31662.1 NT Rattus norvegicue DNA for regucalcin, partial cds tp76b12.x1 NCI_CGAP_Ut3 Homo sapiens cDNA clone IMAGE:2205407 3' similar to gb.X57522 ANTIGEN 4800 17801 1.4 3.3E-01 AI539114.1 EST_HUMAN PEPTIDE TRANSPROTER 1 (HUMAN); 4952 17950 30808 1.12 3.3E-01 D64003.1 NT Synechocystis sp. PCC6803 complete genome, 223.3E-0127, 2755703-2868766 Page 72 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value Bacillus stearothermophilus beta-1,4-mannanase (manF), esterase (estA), transcription regulator (repA), and 5354 18337 0.97 3.3E-01 AF038547.2 NT slpha-galactosidase (galA) genes, complete cds 5507 18586 31434 2.28 3.3E-01 X89819.1 NT R.norvegicus mRNA for 3'UTR of ubiquitin-like protein 5507 18586 31435 2.28 3.3E-01 X89819.1 NT R.norvegicus mRNA for 3'UTR of ubiquitin-like protein 5777 18849 31954 0.97 3.3E-01 P39055 SWISSPROT DYNAMIN 5777 18849 31955 0.97 3.3E-01 P39055 SWISSPROT DYNAMIN 5997 19062 32190 0.64 3.3E-01 BF213873.1 EST_HUMAN 601848090F1 NIH_MGC_55 Homo sapiens cDNA clone IMAGE:4078823 5' 6171 19228 32373 1.45 3.3E-01 BE619650.1 EST_HUMAN 601472768T1 NIH_MGC_68 Homo sapiens cDNA clone IMAGE:3875753 3' 6171 19228 32374 1.45 3.3E-01 BE619650.1 EST_HUMAN 601472768T1 NIH_MGC_68 Homo sapiens cDNA clone IMAGE:3875753 3' 6271 19322 32487 49.51 3.3E-01 P05691 SWISSPROT CIRCUMSPOROZOITE PROTEIN (CS) 7101 20307 33566 0.69 3.3E-01 AB034233.1 NT Flexibacter Ittoralis gyrB gene for DNA gyrase B subunit, partial cds 7101 20307 33567 0.69 3.3E-01 AB034233.1 NT Flexibacter Ittoralis gyrB gene for DNA gyrase B subunit, partial cds ty84h01.x1 NCI_CGAP_Kid11 Homo sapiene cDNA clone IMAGE:2285809 3' similar to contains Alu 7216 20216 33462 4.71 3.3E-01 Al628131.1 EST_HUMAN repetitive element;contains element L1 repetitive element; ty84h01.x1 NCI_CGAP_Kid11 Homo sapiene cDNA clone IMAGE:2285809 3' similar to contains Alu 7216 20216 33462 4.71 3.3E-01 Al628131.1 EST_HUMAN repetitive element;contains element L1 repetitive element; 8256 21161 34494 1.95 3.3E-01 N85146.1 EST_HUMAN J2498F Human fetal heart, Lambda ZAP Express Homo sapiens cDAN clone J2498 5' similar to TEGT 9125 22053 35413 21.18 3.3E-01 BF683954.1 EST_HUMAN 602140372F1 NIH_MGC_46 Homo sapiens cDNA clone IMAGE:4301800 5' 9288 22216 35574 0.62 3.3E-01 BF210322.1 EST_HUMAN 601873281F1 NIH_MGC_64 Homo sapiens cDNA clone IMAGE:4097180 5' 9320 22248 35611 0.54 3.3E-01 AU126115.1 EST_HUMAN AU126115 NT2RP1 Homo sapiens cDNA clone NT2RP 1000130 5' 9320 22248 35612 0.54 3.3E-01 AU126115.1 EST_HUMAN AU126115 NT2RP1 Homo sapiens cDNA clone NT2RP 1000130 5' MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 1 (MAPK/ERK KINASE KINASE 1)(MEK 9658 22584 35955 0.86 3.3E-01 Q62925 SWISSPROT KINASE 1)(MEKK 1) 9917 22905 36293 1.28 3.3E-01 BE828461.1 EST_HUMAN CM3-ET0041-180500-187-d10 ET0041 Homo sapiens cDNA 9917 22905 36294 1.28 3.3E-01 BE828461.1 EST_HUMAN CM3-ET0041-180500-187-d10 ET0041 Homo sapiens cDNA 10042 22942 36330 3.15 3.3E-01 N69866.1 EST_HUMAN za67h01.s1 Soares_fetal_lung_NbHL19W Homo sapiens cDNA clone IMAGE:297649 3' 10061 22874 36262 2.52 3.3E-01 BF376745.1 EST_HUMAN RC4-TN0077-250800-011-g04 TN0077 Homo sapiens cDNA 10497 23385 1.56 3.3E-01 L41044.1 NT Homo sapiens high-mobility group phosphoprotein (HMGI-C) gene, exons 1-3, complete cds 11164 24092 37539 2.42 3.3E-01 X63953.1 NT D.mauritiana Adh gene 11164 24092 37540 2.42 3.3E-01 X63953.1 NT D.mauritiana Adh gene 11466 24379 2.27 3.3E-01 BF526499.1 EST_HUMAN 602070802F1 NCI_CGAP_Bm64 Homo sapiens cDNA clone IMAGE:4213585 5' 11680 24584 38061 8.39 3.3E-01 BE219351.1 EST_HUMAN hv51g02x1 NCI_CGAP_Lu24 Homo sapiens cDNA IMAGE:3176978 3' Page 73 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value CALECOTIN-3 (GALACTOSE-SPECIFIC LECTIN 3)(MAC-2 ANTIGEN)(IGE-BINDING PROTEIN)(35 KD LECTIN)(CARBOHYDRATE BINDING PROTEIN 35)(CBP 35)(LAMININ-BINDING PROTEIN)(LECTIN 11785 24707 38199 4.62 3.3E-01 P47953 SWISSPROT L-29)(CBP30) 12140 24980 3.98 3.3E-01 AA806621.1 EST_HUMAN ob71g02.s1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE:1336860 3' 12159 13130 26016 1.87 3.3E-01 X07990.1 NT Rhizobium leguminosarum sym plasmid pRL5JI nodX gene 12995 25549 25.89 3.3E-01 AP000002.1 NT Pyrococcus horikoshii OT3 genomic DNA, 287001-544000 nt.position (2/7) 479 13550 1.75 3.2E-01 AF018261.1 NT Rattus norvegious EH domain binding protein Epsin mRNA complete cds 741 13799 1.34 3.2E-01 AL161561.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 61 1189 14228 27167 15.88 3.2E-01 AF047013.1 NT Fusarium pose virus 1 RNA2 putative RNA dependent RNA polymerase gene, complete cds 1308 14341 27289 2.22 3.2E-01 Z50202.1 NT P.vulgaris arc5-1 gene 1417 14448 27402 5.57 3.2E-01 Q48624 SWISSPROT LACTOSE PERMEASE (LACTOSE-PROTON SYMPORT)(LACTOSE TRANSPORT PROTEIN) 1659 14689 0.98 3.2E-01 AF209730.1 NT Arabidopsis thaliana cultivar Columbia RPP13 (RPP13) gene, complete cds 1799 4825 27793 1.19 3.2E-01 Z36041.1 NT S.certevisiae chromosome Il reading freme ORF YBR172c 1808 14834 27804 4.71 3.2E-01 AW957194.1 EST_HUMAN EST369264 MAGE resequences, MAGD Homo sapiens cDNA 1808 14834 27805 4.71 3.2E-01 AW957194.1 EST_HUMAN EST369264 MAGE resequences, MAGD Homo sapiens cDNA 1866 14890 27870 1.33 3.2E-01 AL111655.1 NT Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation 2173 15185 28190 2.66 3.2E-01 BF203817.1 EST_HUMAN 601868804F1 NIH_MGC_17 Homo saplens cDNA clone IMAGE:4111512 5' 2572 15570 2.76 3.2E-01 7710079 NT Mus musculus Pbx/knotted 1 homeobox(Pknox1), mRNA 2759 15750 28746 1.72 3.2E-01 AF060568.1 NT Homo sapiens promyelocytic leukemia zinc finger protein (PLZF) gene, complete cds 3671 16704 1.03 3.2E-01 D10872.1 NT Human h NAT allele 3-2 gene for arylamina N-acetyltramsferase Rabbit beta-like globin gene cluster encoding the epsilon, gamma, delta (pseudogene) and beta globin 4501 17511 30377 1.77 3.2E-01 M18818.1 NT polypeplides, complete cds 4587 17595 30453 0.74 3.2E-01 AF111167.2 NT Homo sapiens jun dimerization protein gene, partial cds; cfos gene, complete cds; and unknown gene 4619 17627 30491 1.69 3.2E-01 Q10268 SWISSPROT HYPOTHETICAL 81.7 KD PROTEIN C13G7.04C IN CHROMOSOME I PRECURSOR 4850 17852 6.43 3.2E-01 BF693617.1 EST_HUMAN 602081972F1 NIH_MGC_81 Homo sapiens cDNA clone IMAGE:4246505 5' 4850 17852 6.44 3.2E-01 BF693617.1 EST_HUMAN 602081972F1 NIH_MGC_81 Homo sapiens cDNA clone IMAGE:4246505 5' 5454 16535 31377 3.04 3.2E-01 BE173964.1 EST_HUMAN CM0-HT0569-060300-269-f10 HT0569 Homo sapiens cDNA 6183 19240 32387 1.24 3.2E-01 L27221.1 NT Glardia intestinalis pyruvate:flavodoxin oxidoreductase and flanking genes 6477 19522 32699 0.52 3.2E-01 BE383518.1 EST_HUMAN 601297331F1 NIH_MGC_19 Homo sapiens cDNA clone IMAGE:3627462 5' 6477 19522 32700 0.52 3.2E-01 BE383518.1 EST_HUMAN 601297331F1 NIH_MGC_19 Homo sapiens cDNA clone IMAGE:3627462 5' Fugu rubripes gamma-aminobutyric acid receptor beta subunit gene, partial cds; 55kd erythrocyte membrane prolein (P55), synaptic vesicle-associated integral membrane protein (VAMP-1), procollagen C-proteinase 6558 19600 32786 0.76 3.2E-01 AF016494.1 NT enhancer protein (PCOLCE) genes, complete c> Page 74 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 6881 19911 33127 0.67 3.2E-01 AV718037.1 EST_HUMAN AV718037 FHTA Homo sapiens cDNA clone FHTAABH01 5' 7037 20063 1.44 3.2E-01 AB002359.1 NT Human mRNA for KIAA0361 gene, KIAA0361 protein 8439 21371 34712 0.57 3.2E-01 AJ277661.1 NT Homo sapiens partial LMO1 gene for lIM domain only 1 protein, exon 1 8750 21680 35023 1.69 3.2E-01 M60266.1 NT Rat ISO-atrial netriuretio factor gene, complete cds 8842 21772 35119 0.56 3.2E-01 AJ23100.1 NT Rattus norvegicus repeat; map NOS-D12ox1 8939 21869 35227 15.44 3.2E-01 X02508.1 NT H.sapiens gene fragment for acelycholine receptor (AChR) alpha subunit exons 8, 9 and 3' flanking region 8942 21872 35232 15.29 3.2E-01 BF311635.1 EST_HUMAN 601897107F1 NIH_MGC_19 Homo sapiens cDNA clone IMAGE:4126633 5' 9030 21959 1.7 3.2E-01 AL161574.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 70 9067 21996 35349 1.42 3.2E-01 BF246771.1 EST_HUMAN 601855580F1 NIH_MGC_57 Homo sapiens cDNA clone IMAGE:4075627 5' 9067 21996 35350 1.42 3.2E-01 BF246771.1 EST_HUMAN 601855580F1 NIH_MGC_57 Homo sapiens cDNA clone IMAGE:4075627 5' 9136 22064 35424 1.47 3.2E-01 AE0020151. NT Deinococcus radiodurans R1 section 152 of 229 of the complete chromosome 1 9229 22157 35510 0.85 3.2E-01 U51026.1 NT Oryctolagus cuniculus lg H-chain pseudogene, V-region (VH6-a2) gene, partial cds 9229 22157 35511 0.85 3.2E-01 U51026.1 NT Oryctolagus cuniculus lg H-chain pseudogene, V-region (VH6-a2) gene, partial cds 9619 22545 35916 0.62 3.2E-01 AL163204.2 NT Homo sapiens chromosome 21 segment HS21C004 9625 22551 2.39 3.2E-01 M86511.1 NT Human monocyte antigen CD14 (CD14)mRNA, complete cds 9693 22618 35995 0.62 3.2E-01 AF041829.1 NT Homo sapiens 6-phosphofructo-2-kinase/fruclose-2,6-bisophosphatase (PF2K) gene, exons 12 and 13 9693 22618 35996 0.62 3.2E-01 AF041829.1 NT Homo sapiens 6-phosphofructo-2-kinase/fruclose-2,6-bisophosphatase (PF2K) gene, exons 12 and 13 10499 23387 36797 3.21 2.9E-01 U44914.1 NT Borrelia burgdorferi plasmi cp32-2, erpC and erpD genes, complete cds; and unknwon genes 10695 23581 37011 0.68 3.2E-01 BE326230.1 EST_HUMAN hv99f05.x1 NCI_CGAP_Lu24 Homo sapiens cDNA clone IMAGE:3181569 3' 10800 23686 3.96 3.2E-01 AB011399.1 NT Homo sapiens gene for AF-6, complete cds 11112 24042 37487 3.28 3.2E-01 T06813.1 EST_HUMAN EST4702 Fetal brain, Stratagene (cat#936206) Homo sapiens cDNA clone HFBDZ21 12365 25872 4.58 3.2E-01 L07288.1 NT Drosophila melanogaster laminin A (Lam-A) mRNA, complete cds 12844 25456 3.57 3.2E-01 O83217 SWISSPROT ELONGATION FACTOR TU (EF-TU) 12934 25716 1.71 3.2E-01 AF157625.1 NT Bos taurus inositol 1,4,5-trisphosphate receptor type I mRNA, complete cds 12977 25537 1.49 3.2E-01 L39874.1 NT Homo sapiens deoxycytidylate deaminase gene, complete cds 13024 25904 31364 1.48 3.2E-01 BE385776.1 EST_HUMAN 601275480F1 NIH_MGC_20 Homo sapiens cDNA clone IMAGE:3616746 5' ye90h06.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:125051 5' similar to 2720 15713 28712 3.72 3.1E-01 R18051.1 EST_HUMAN gb:M64241 QM PROTEIN (HUMAN); 2748 15862 28733 3.75 3.1E-01 7661971 NT Homo sapiens KIAA0174 gene product (KIAA0174), mRNA 2748 15862 28734 3.75 3.1E-01 7661971 NT Homo sapiens KIAA0174 gene product (KIAA0174), mRNA 2900 15954 1.33 3.1E-01 AW629036.1 EST_HUMAN hi46h08.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA IMAGE:2975391 3' Page 75 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 3216 16264 4.39 3.1E-01 AB029069.1 NT Mus musculus gene for Ser/Thr kinase KKIAMRE, exon 6 3981 17009 29897 0.95 3.1E-01 AJ251586.1 NT Daucus carota mRNA for transcription factor E2F (E2F gene) 5034 18031 30888 0.99 3.1E-01 S68245.1 NT carbonic anhydrase IV [rats, Sprague-Dawley, lung, mRNA, 1205 nt] 5076 1873 30922 0.66 3.1E-01 AE003984.1 NT Xylelia fastidiosa, section 130 of 229 of the complete genome 5184 18176 31021 0.95 3.1E-01 AL161503.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No 15 5666 18740 31649 10.28 3.1E-01 AF176111.1 NT Homo sapiens hepatocyte nuclear tactor-3 alpha (HNF3A) gene, exon 1 5794 18866 31974 0.67 3.1E-01 P44132 SWISSPROT HYPOTHETICAL PROTEIN HI1236 5795 18867 31975 0.85 3.1E-01 Z74883.1 NT S.cerevisiae chromosome XV reading frame ORF YOL141W 5806 18878 0.89 3.1E-01 Y13278.1 NT Mus musculus mRNA for polycystin 5980 19045 32168 2.26 3.1E-01 AF184122.1 NT Homo sapiens filamin 2 (FLN2) gene, exons 10 through 22 6657 25650 327564 0.53 3.1E-01 R94322.1 EST_HUMAN yq41f04.r1 Soares fetal liver spieen 1NFLS Homo sapiens cDNA clone IMAGE:19836 5' 6739 19773 32984 1.41 3.1E-01 AW983549.1 EST_HUMAN RC3-HN0001-310300-011-b01 HN0001 Homo sapiens cDNA 6812 19845 33055 0.96 3.1E-01 Al264458.1 EST_HUMAN ql39d01.x1 NCI_CGAP_Co8 Homo sapiens cDNA clone IMAGE:1874689 3' 6979 20006 33238 0.52 3.1E-01 X71887.1 NT H.sapiens gene for immunoglobulin kappa light chain variable region A8 and A9 7071 20277 1.1 3.1E-01 AW377354.1 EST_HUMAN MR2-CT0222-281099-005-h05 CT0222 Homo sapiens cDNA 7307 25625 31297 2.34 3.1E-01 BE737392.1 EST_HUMAN 601306121F1 NIH_MGC_39 Homo sapiens cDNA clone IMAGE:3640420 5' 8132 21042 34372 0.71 3.1E-01 4885390 NT Homo sapiens hyaluronan synthase 2 (HAS2), mRNA Mus musculus neuronal apoptosis inhibitiory protein 6 (Naip6) gene, complete cds; and Naip3 gene, exons 2-9 8230 21135 34467 0.45 3.1E-01 AF242431.1 NT and 11-16 8408 21311 34642 0.5 3.1E-01 AW850168.1 EST_HUMAN IL3-CT0219-271099-022-E03 CT0219 Homo sapiens cDNA 8408 21311 34643 0.5 3.1E-01 AW850168.1 EST_HUMAN IL3-CT0219-271099-022-E03 CT0219 Homo sapiens cDNA 9207 22135 35492 0.91 3.1E-01 R45318.1 EST_HUMAN yg46f0.1s1 Soares infant brain 1NIB Homo sapiens cDNA clone IMAGE:35639 3' 10569 23455 36875 1.21 3.1E-01 BF696639.1 EST_HUMAN 602124743F1 NIH_MGC_56 Homo sapiens cDNA clone IMAGE:4281611 5' 10569 23455 36876 1.21 3.1E-01 BF696639.1 EST_HUMAN 602124743F1 NIH_MGC_56 Homo sapiens cDNA clone IMAGE:4281611 5' qi61e11.x1 NCI_CGAP_Kld3 Homo sapiens cDNA clone IMAGE:1863980 3' similar to gb:S55700 10628 23514 36947 2.28 3.1E-01 Al244001.1 EST_HUMAN HYDROXYMETHYLGLUTARYL-COA LYASE PRECURSOR (HUMAN); yb47h08.s1 Stratagene fetal spleen (#937205) Homo sapiens cDNA clone IMAGE:74367 3' similar to similar 10792 23678 0.54 3.1E-01 T55325.1 EST_HUMAN to gb:M91036_rna2 HEMOGLOBIN GAMMA-A AND GAMMA-G CHAINS (HUMAN) Mus musculus chromsome X contigA; putative Magea# gene, Caltractin, NAD(P) steroid dehydrogenase 11384 24300 37746 1.42 3.1E-01 AL021127.2 NT and Zinc finger protein 185 11967 24810 38305 2.2 3.1E-01 7662291 NT Homo sapiens KIAA0764 gene product (KIAA0764), mRNA 12503 25242 1.44 3.1E-01 AF304162.1 NT Stizostedion vitreum 40S ribosomal protein S11 mRNA, partial cds 12464 25322 4.24 3.1E-01 AF195953.1 NT Homo sapiens membrane-bound aminopeptidase P (XNPEF2) gene, complete cds Page 76 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value Homo sapiens transcription factor IGHM enhancer 3, JM11 protein, JM4 protein, JM5 protein, T54 protein, JM10 protein, A4 differentiation-dependent protein, triple LIM domain protein 6, and synaptophysin genes, 12983 25542 4.75 3.1E-01 AF196779.1 NT complete cds; and L-type calclum channel a> 13011 25900 1.53 3.1E-01 10946623 NT Mus musculus paptidoglycan recognition protein-like (Pglyrpl-pending), mRNA 75 15840 26100 7.93 3.0E-01 6755083 NT Mus musculus protein kinase C, epsilon (Pkce, mRNA 273 13368 26284 9.5 3.0E-01 AJ271735.1 NT Homo sapiens xQ pseudoautosomal region; segment 1/2 1251 14287 27230 1.77 3.0E-01 AW300400.1 EST_HUMAN xs63f06.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2774343 3' 1527 14558 27518 5.53 3.0E-01 AJ006755.1 NT Balaenoptera physalus gene encoding atrial naturetic peptide 2150 15162 28164 1.17 3.0E-01 AF237778.1 NT Rattus norvegicus Ca2+/calmodulin-dependent protein kinase II, alpha subunit mRNA, 3' untranslated region 3258 16306 1.65 3.0E-01 AB030481.1 NT Corynebacterium sp. ALY-1 alyPG gene for polyguluronats lyase, complete cds 3454 16495 29399 0.8 3.0E-01 P23825 SWISSPROT GATA BINDING FACTOR-3(TRANSCRIPTION FACTOR NF-E1C)(GATA-3) 3933 16961 29844 1.83 3.0E-01 AW817785.1 EST_HUMAN PM1-ST0262-261199-001-g1 ST0262 Homo sapiens cDNA 4634 17640 30503 2.9 3.1E-01 AJ006755.1 NT Balaenoptera physalus gene encoding atrial natriuretic peptide 4842 17843 1 3.0E-01 AF15735.1 NT Bacteriophage APSE-1, complete genome 5297 16495 29399 0.76 3.0E-01 P23826 SWISSPROT GATA BINDING FACTOR-3 (TRANSCRIPTION FACTOR NF-E1C)(GATA-3) 5536 18615 31465 5.08 3.0E-01 BE741629.1 EST_HUMAN 601594960F1 NIH_MGC_9 Homo sapiens cDNa clone IMAGE:3948734 5' Homo sapiens mannosidase, beta A, lysosomal (MANBA) gene, and ubiquitin-conjugating enzyme E2D 3 5617 18693 31589 0.48 3.0E-01 AF224669.1 NT (UBE2D3) genes, complete cds. 5621 18697 31594 0.92 3.0E-01 AF229247.1 NT Cantagalo orthopoxvirus hemaggiutinin gene, conplete cds 5694 18767 31691 3.73 3.0E-01 BE693575.1 EST_HUMAN RC3-BT0333-180700-111-a03 BT0333 Homo sapiens cDNA 5694 18767 31692 3.73 3.0E-01 BE693575.1 EST_HUMAN RC3-BT0333-180700-111-a03 BT0333 Homo sapiens cDNA 5731 18804 31898 5.41 3.0E-01 U01247.1 NT Mus musculus 129/sv Clara cell 10 kd protein (mCC10) gene, complete cds 7144 20262 33504 2.95 3.0E-01 D16313.1 NT Mouse cytokeratin 15 gene, complete cds 7182 18454 31324 0.82 3.0E-01 U02369.1 NT Strongylocentrotus purpuratus 34/67 kDa laminin-binding protein mRNA, partial cds 7255 20164 33403 1.03 3.0E-01 AF229247.1 NT Cantagalo orthopoxvirus hemagglutinin gene, complete cds 7343 20339 33606 0.56 3.0E-01 X63941.1 NT S Cerevislae GAC1 7480 20420 33699 0.68 3.0E-01 AL163206.2 NT Homo sapiens chromosome 21 segment HS21C006 7712 20644 33941 5.72 3.0E-01 10947007 NT Mus musculus midnolin (Midn-pending), mRNA 7923 20846 34151 2.35 3.0E-01 AF071810.1 NT Streptococcus pneumoniae strain DBL5 PspA (pspA) gene, partial cds 6505 21436 34777 1.19 3.0E-01 AE001755.1 NT Thermotoga maritima section 67 of 136 of the complete genome Mus musculus C-type (calcium dependent, carbohydrate recoognition domain) lectin, superfamily member 9 8945 21875 3.79 3.0E-01 9910161 NT (Clecsf9), mRNA 9032 21961 35321 0.54 3.0E-01 Z70200.1 NT H.saplens gene for U5 snRNP-specific 200kD protein Page 77 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 9045 21974 35332 1.63 3.0E-01 BE566083.1 EST_HUMAN 601339079F1 NIH_MGC_53 Homo sapiens cDNA clone IMAGE:3681594 5' 9388 22316 35678 0.69 3.0E-01 AF141576.1 NT Streptomyces sulfonofaciens isopenicillin N synthase (pcbC) gene, partial cds 9429 22357 0.92 3.0E-01 7661685 NT Homo sapiens DKFZP586M0122 protein (DKFZP586M0122), mRNA Anabeena PCC7120 cytosine-specific DNA methylitansferase (dmnB) gene, complete cds; putative 9759 22683 36069 1.14 3.0E-01 AF220507.1 NT enthrenilete phosphoribosyltransferase gene, partial cds; and unknown gene 10102 22993 36388 0.61 3.0E-01 P76389 SWISSPROT HYPOTHETICAL 59.5 KD PROTEIN IN WZA-ASMA INTERGENIC REGION 10474 23362 36776 0.86 3.0E-01 BF574612.1 EST_HUMAN 602133271F1 NIH_MGC_81 Homo sapiens cDNA clone IMAGE:4288336 5' 10882 23767 37192 2.27 3.0E-01 AB030231.1 NT Aspergillus oryzae bipA gene for ER chaperone BiP, complete cds 12183 25019 38520 2.77 3.0E-01 H51029.1 EST_HUMAN yp84b10.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:194107 5' 12183 25019 38521 2.77 3.0E-01 H51029.1 EST_HUMAN yp84b10.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:194107 5' 12522 25247 1.64 3.0E-01 P54660 SWISSPROT PONTICULIN PRECURSOR 12762 25857 2.68 3.0E-01 AJ297631.1 NT Rattus norvegicus mRNA for glyceraldehyde-3-phosphate dehydrogenase type 2 (gapdh-2 gene) 13005 25898 6.68 3.0E-01 8677766 NT Mus musculus ribose 5-phosphate isomerase A (Rpia), mRNA 2037 15054 28053 1.52 2.9E-01 AE000736.1 NT Aquifex aeolicus section 68 of 109 of the complete genome 2263 15273 28278 1.03 2.9E-01 AF22718.1 NT Chrysodidymus synuroideus mitochondrion, complete genome 3227 16275 29176 1.4 2.9E-01 AF078111.1 NT Xeropus laevis transcription factor E2F mRNA, complete cds 3296 16343 29246 1.16 2.9E-01 AW754239.1 EST_HUMAN PM1-CT0326-171299-001-f12 CT0326 Homo sapiens cDNA 3296 16343 29247 1.16 2.9E-01 AW754239.1 EST_HUMAN PM1-CT0326-171299-001-f12 CT0326 Homo sapiens cDNA tp21a11x1 NCI_CGAP_Gas4 Homo sapiens cDNA clone IMAGE:2188412 3' similar to gb:D15050 NIL-2-A 3966 16994 29878 0.92 2.9E-01 Al610836.1 EST_HUMAN ZINC FINGER PROTEIN (HUMAN);contains element L1 repetitive element; 4173 17194 0.71 2.9E-01 AW0029021. EST_HUMAN wr02f10.x1 NCI_CGAP_GC6 Homo sapiens cDNA clone IMAGE:2480395 3' zs57d12.r1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE:701591 5' similar to contains Au 4599 17607 30464 1.16 2.9E-01 AA284468.1 EST_HUMAN repetitive element; 4603 17611 30470 0.79 2.9E-01 AF134119.1 NT Mue musculus SKD1 (Skd1) gene, complete cds 4603 17611 30471 0.79 2.9E-01 AF134119.1 NT Mue musculus SKD1 (Skd1) gene, complete cds 5132 18128 30970 1.1 2.9E-01 7662169 NT Homo sapiens KIAA0537 gene product (KIAA0537), mRNA 5367 18349 1.11 2.9E-01 AL151585.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 81 5439 18521 1.63 2.9E-01 R37485.1 EST_HUMAN yf77e12.s1 Soares infant btain 1NIB Homo sapiens cDNA clone IMAGE:28291 3' 5580 20184 33428 0.82 2.9E-01 AF321001.1 NT Suaeda maritima subsp. salsa S-adenosylmethionine sythetase 2 mRNA, complete cds B.subtilis levanase operon levD, levE, levF, levG and secC (partial) genes for fructose phosphotransferase 5972 19038 32159 5.29 2.9E-01 X56098.1 NT system polypetides P16, 18,28,30 and levanase B.subtilis levanase operon levD, levE, levF, levG and secC (partial) genes for fructose phosphotransferase 5972 19038 32159 5.29 2.9E-01 X56098.1 NT system polypetides P16, 18,28,30 and levanase 5986 19050 32175 4.94 2.9E-01 6679662 NT Mus musculus Eph receptor A8 (EphaB), mRNA Page 78 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 6291 19342 32510 1.3 2.9E-01 AA418145.1 EST_HUMAN zv97b12.r1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:767711 5' we27c05.x1 NCI_CGAP_Lu24 Homo sapiens cDNA clone IMAGE:2342312 3' similar to contains L1.t1 L1 6533 19577 32759 0.93 2.9E-01 AI797128.1 EST_HUMAN repetitive element ; 6582 19623 32808 2.55 2.9E-01 U03420.1 NT Bos taurus myosin I mRNA, complete cds 6728 19764 32971 0.43 2.9E-01 R69194.1 EST_HUMAN yi39d08.r1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE:141615 5' 6728 19764 32972 0.43 2.9E-01 R69194.1 EST_HUMAN yi39d08.r1 Soares placenta Nb2Hp Homo sapiens cDNA clone IMAGE:141615 5' 7022 20048 0.53 2.9E-01 Z50156.1 NT D.discoideum gene for 34 kD actin binding protein 7184 20184 33428 0.59 2.9E-01 AF32101.1 NT Suaeda maritima subsp. salsa S-adenosylmethionine sythetase 2 mRNA, complete cds 7327 18495 31270 1.57 2.9E-01 AF1432329.1 NT Mus musculus Fliih protein (Fliih) gene, complete cds; and Llgih protein (Llgih) gene, partial cds 7455 20395 33666 2.87 2.9E-01 Q04399 SWISSPROT PUTATIVE MULTICOPPER OXIDASE YDR506C Mus musculus major histocompatibility locus class II region; Fas-binding protein Daxx (DAXX) gene, partial cds; Bign1 (BING1), tapasin (tapasin), RalGDS-like factor (RLF), KE2 (KE2), BING4 (BING4), beta1, 3- 7521 20460 33746 1.76 2.9E-01 AF100956.1 NT galactosyl transferase (beta1,3-galactosyl tr> 8498 21429 34769 1.78 2.9E-01 BE540422.1 EST_HUMAN 601065830F1 NIH_MGC_10 Homo sapiens cDNA clone IMAGE:3452287 5' 8498 21429 34770 1.78 2.9E-01 BE540422.1 EST_HUMAN 601065830F1 NIH_MGC_10 Homo sapiens cDNA clone IMAGE:3452287 5' 8728 21658 35004 0.55 2.9E-01 AJ237937.1 NT Bos taurus partial stat5A gene, exons 5-19 8728 21658 35005 0.55 2.9E-01 AJ237937.1 NT Bos taurus partial stat5A gene, exons 5-19 8740 21670 1.12 2.9E-01 BF217743.1 EST_HUMAN 601882570F1 NIH_MGC_57 Homo sapiens cDNA clone IMAGE:4095113 5' 9157 22085 35444 0.77 2.9E-01 AU150910.1 EST_HUMAN AU150910 NT2RP2 Homo sapiens cDNA clone NT2RP2003901 3' 9481 22409 35770 1.11 2.9E-01 AF225098.1 NT Arabidopsis thaliana sulfonylurea receptor-like protein mRNA, complete cds 9584 22511 35874 0.88 2.9E-01 M22452.1 NT Baboon lymphocyte homing/adhesion receptor mRNA, complete cds 9788 22752 36133 0.89 2.9E-01 AJ248287.1 NT Pyrococcus abyssi complete genome; segment 5/6 9788 22752 36134 0.89 2.9E-01 AJ248287.1 NT Pyrococcus abyssi complete genome; segment 5/6 11332 24251 37688 1.76 2.9E-01 AF128843.1 NT Trypanosoma cruzi stage-specific surface glycoprotein gp82 (gp82) mRNA, partial cds 11602 24511 37978 2.08 2.9E-01 V01394.1 NT Torpedo californica mRNA encoding acetylcholine receptor gamma subunit 11602 24511 37979 2.08 2.9E-01 V01394.1 NT Torpedo californica mRNA encoding acetylcholine receptor gamma subunit ny35h02.s1 NCI_CGAP_Pr12 Homo sapiens cDNA clone IMAGE:1273779 similar to contains LTR8.t2 LTR8 12013 24855 38355 1.9 2.9E-01 AA935373.1 EST_HUMAN repetitive element ; 12017 24859 38359 3.68 2.9E-01 AL139078.2 NT Campylobacter jejuni NCTC11168 complete genome; segment 5/6 12030 24872 38375 1.53 2.9E-01 U35025.1 NT Rattus norvegicus activin receptor-like kinase 7 (ALK7) mRNA, complete cds 12030 24872 38376 1.53 2.9E-01 U35025.1 NT Rattus norvegicus activin receptor-like kinase 7 (ALK7) mRNA, complete cds wz88f05.x1 NCI-CGAP_Brn25 Homo sapiens cDNA clone IMAGE:2565921 3' similar to contains element 12704 25359 31796 1.55 2.9E-01 AW005671.1 EST_HUMAN MER29 repetitive element ; 12785 25414 31787 2.61 2.9E-01 AF092453.1 NT Homo sapiens TNF-a-inducible RNA binding protein (TIRP) gene, complete cds Page 79 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 12823 25442 1.55 2.9E-01 BE788199.1 EST_HUMAN 601482059F1 NIH_MGC_68 Homo sapiens cDNA clone IMAGE:3884559 5' 590 13658 1.3 2.8E-01 U67136.1 NT Rattus norvegicus A-kinase anchoring protein AKAP150 mRNA, complete cds 595 13662 0.72 2.8E-01 L28145.1 NT Prune dwarf virus movement protein, complete cds; coat protein, complete cds 1110 14152 27093 2.47 2.8E-01 AF168050.1 NT Guira guira oocyte maturation factor Mos (c-mos) gene, partial cds 1303 14336 27283 1.41 2.8E-01 BE313442.1 EST_HUMAN 601148733F1 NIH_MGC_19 Homo sapiens cDNA clone IMAGE:3163688 5' 1303 14336 27284 1.41 2.8E-01 BE313442.1 EST_HUMAN 601148733F1 NIH_MGC_19 Homo sapiens cDNA clone IMAGE:3163688 5' 1317 14350 27296 0.91 2.8E-01 D86550.1 NT Human mRNA for serine/threonine protein kinase, complete cds 1757 14784 27755 1.69 2.8E-01 AW860020.1 EST_HUMAN QV1-CT0364-120200-065-b05 CT0364 Homo sapiens cDNA 2025 15043 28037 1.41 2.8E-01 AL047620.1 EST_HUMAN DKFZp586I2321_r1 586 (synonym: hute1) Homo sapiens cDNA clone DKFZ586I2321 2145 15158 28160 1.16 2.8E-01 AW511195.1 EST_HUMAN hd44b03.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2912333 3' 2494 15496 28496 2.51 2.8E-01 AE000494.1 NT Escherichia coll K-12 MG1655 section 384 of 400 of the complete genome 2494 15496 28497 2.51 2.8E-01 AE000494.1 NT Escherichia coli K-12 MG1655 section 384 of 400 of the complete genome 2578 15577 2.16 2.8E-01 AL161565.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 65 2714 15708 28703 1.07 2.8E-01 AB020975.1 NT Arabidopsis thaliana mRNA for lipoltransferase, complete cds 3011 16063 1.52 2.8E-01 AF179480.1 NT Toxoplasma gondii 90kDa heat-shock protein (HSP90) mRNA, partial cds 3012 16064 28967 2.41 2.8E-01 Z14037.1 NT B.taurus microsatellite (ETH121) 3012 16064 28968 2.41 2.8E-01 Z14037.1 NT B.taurus microsatellite (ETH121) 3436 16477 29383 0.98 2.8E-01 AP000004.1 NT Pyrococcus horikoshil OT3 genomic DNA, 777001-994000 nt. position (4/7) 4082 17107 29985 2.55 2.8E-01 AE001180.1 NT Borrelia burgdorferi (section 66 of 70) of the complete genome 4220 17236 0.68 2.8E-01 AE004450.1 NT Pseudomonas aeruginosa PA01, section 11 of 529 of the complete genome ov44g10.x1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1640226 3' similar to contains Alu 4294 17308 2.98 2.8E-01 AI090868.1 EST_HUMAN repetitive element;contains element MER22 repetitive element ; Mus musculus chromosome X contigA; putative Magea9 gene, Caltractin, NAD(P) steroid dehydrogenase 4566 17574 30437 1.22 2.8E-01 AL021127.2 NT and Zinc finger protein 185 4571 17579 30441 3 2.8E-01 P13615 SWISSPROT RNA POLYMERASE BETA SUBUNIT (LARGE STRUCTURAL PROTEIN) (L PROTEIN) 4936 17935 30792 1.11 2.8E-01 AF075238.1 NT Hepartitis G virus isolate 60 (SZNAE12) polyprotein precursor, gene, partial cds 4943 17942 30800 3.99 2.8E-01 AF030154.1 NT Bovine adenovirus 3 complete genome 4971 17969 30828 1.41 2.8E-01 BF528188.1 EST_HUMAN 602042601F1 NCI_CGAP_Brn67 Homo sapiens cDNA clone IMAGE:4180129 5' ql59c11.x1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:1876628 3' similar to contains Alu 4994 17993 30850 3.14 2.8E-01 AI272669.1 EST_HUMAN repetitive element;contains element LTR5 repetitive element ; te32c02.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2087618 3' similar to TR:O60392 5408 18339 31227 0.91 2.8E-01 AI805266.1 EST_HUMAN O60392 R32184_3. ; te32c02.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2087618 3' similar to TR:O60392 5408 18389 31228 0.91 2.8E-01 AI805266.1 EST_HUMAN O60392 R32184_3. ; Page 80 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 5494 25628 31419 23.22 2.8E-01 AA349997.1 EST_HUMAN EST57072 infant brain Homo sapiens cDNA 5' end 5800 18872 31980 2.53 2.8E-01 AB016625.1 NT Homo sapiens OCTN2 gene complete cds 6028 19090 0.85 2.8E-01 AW992583.1 EST_HUMAN CM1-BN0024-150200-118-g12 BN0024 Homo sapiens cDNA oa01d06.s1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE:1303691 3' similar to gb:M34539 FK506- 6143 19202 32339 0.54 2.8E-01 AA765296.1 EST_HUMAN BINDING PROTEIN (HUMAN); zt41f01.r1 Soares ovary tumor NbHOT Homo sapiens cDNA clone IMAGE:724921 5' similar to contains Alu 6163 19220 0.61 2.8E-01 AA404576.1 EST_HUMAN repetitive element; 6417 25976 0.83 2.8E-01 M36668.1 NT Bovine 680 bp repeated unit of 1.723 satellite DNA 6462 19507 32682 1.52 2.8E-01 AF003124.1 NT Mesembryanthemum crystallinum fructose-blphosphate aldolase mRNA, complete cds 6462 19507 32683 1.52 2.8E-01 AF003124.1 NT Mesembryanthemum crystallinum fructose-biphosphate aldolase mRNA, complete cds 7035 20061 33295 9.12 2.8E-01 BF511215.1 EST_HUMAN UI-H-BI4-soi-f-04-0-UI.s1 NCI_CGAP_Sub8 Homo sapiens cDNA clone IMAGE:3085182 3' Orthogenomys heterodus cytochrome b (cytb) gene, mitochondrial gene encoding mitochondrial protein, 7349 20345 33612 0.63 2.8E-01 U65300.1 NT complete cds 7745 20676 33974 0.47 2.8E-01 BE881455.1 EST_HUMAN 601490157F1 NIH_MGC_69 Homo sapiens cDNA clone IMAGE:3892142 5' Marsilea quadrifolia ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit (rbcL) gene, chloroplast 7845 20772 1.02 2.8E-01 U05633.1 NT gene encoding chlorplast protein, partial cds zt41f01.r1 Soares ovary tumor NbHOT Homo sapiens cDNA clone IMAGE:724921 5' similar to contains Alu 8412 19220 0.53 2.8E-01 AA404576.1 EST_HUMAN repetitive element; qp48h01.x1 NCI_CGAP_Co8 Homo sapiens cDNA clone IMAGE:1926289 3' similar to gb:X06323_cds1 8671 21602 34941 1.53 2.8E-01 AI346126.1 EST_HUMAN MITOCHONDRIAL 60S RIBOSOMAL PROTEIN L3 (HUMAN); qp48h01.x1 NCI_CGAP_Co8 Homo sapiens cDNA clone IMAGE:1926289 3' similar to gb:X06323_cds1 8671 21602 34942 1.53 2.8E-01 AI346126.1 EST_HUMAN MITOCHONDRIAL 60S RIBOSOMAL PROTEIN L3 (HUMAN); 8787 21717 35065 2.55 2.8E-01 U51688.1 NT Homo sapiens lanosterol 14-alpha demethylase cytochrome P450 (CYP51) gene, exon 5 of02h05.s1 NCI_CGAP_Co12 Homo sapiens cDNA clone IMAGE:1419993 3' similar to gb:M87789 IG 9080 22009 35365 0.63 2.8E-01 AA911629.1 EST_HUMAN GAMMA-1 CHAIN C REGION (HUMAN); 9151 22079 9.22 2.8E-01 BF347847.1 EST_HUMAN 602022987F1 NCI-CGAP_Brn67 Homo sapiens cDNA clone IMAGE:4158525 5' 9999 22816 36205 1.29 2.8E-01 U17251.1 NT Neurospora crassa negative regulator sulfur controller-2 (scon-2) gene, complete cds 10233 23124 1.24 2.8E-01 L13654.1 NT Lycopersicon esculentum peroxidase (TPX1) mRNA, complete cds 10400 23289 36711 1.44 2.8E-01 AF132728.1 NT Escherichia coli translocated intimin receptor Tir (tir) gene, complete cds 10400 23289 36712 1.44 2.8E-01 AF132728.1 NT Escherichia coli translocated intimin receptor Tir (tir) gene, complete cds Rattus norvegicus glycerol-3-phosphate clehydrogenase gene, promoters A and B and exons 1a and 1b; 10457 23345 36762 0.71 2.8E-01 AF294393.1 NT nuclear gene for mitochondrial product 10562 23448 36870 5.21 2.8E-01 7706163 NT Homo sapiens hypothetical protein 9LOC51319), mRNA 10802 23688 1.17 2.8E-01 9626154 Nt Fujinami sarcoma virus, complete genome Page 81 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 11184 24110 37557 2.61 2.8E-01 BF241062.1 EST_HUMAN 601880794F1 NIH_MGC-55 Homo sapiens cDNA clone IMAGE:4109350 5' 11184 24110 37558 2.61 2.8E-01 BF241062.1 EST_HUMAN 601880794F1 NIH_MGC_55 Homo sapiens cDNA clone IMAGE:4109350 5' 11211 24137 37587 2.96 2.8E-01 BF695970.1 EST_HUMAN 601852148F1 NIH_MGC_56 Homo sapiens cDNA clone IMAGE:4076026 5' Drosophila heteroneura fruitless (fru), gene, alternative splice products, 5' flanking region, exons 1 through 7 11317 24236 37681 2.21 2.8E-01 AF051662.1 NT and complete cds 11724 24626 3.63 2.8E-01 BF674023.1 EST_HUMAN 602137418F1 NIH_MGC_83 Homo sapiens cDNA clone IMAGE:4273853 5' yh21h11.r1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE:130437 5' similar to contains LTR3 12222 25056 38556 2.52 2.8E-01 R22890.1 EST_HUMAN repetitive element ; 12738 25378 12.34 2.8E-01 D83329.1 NT Mus musculus DNA for prostaglandin D2 synthase, complete cds 12834 25449 31776 6.3 2.8E-01 BE178699.1 EST_HUMAN PM4-HT0606-030400-001-a07 HT0606 Homo sapiens cDNA 499 13569 26487 4.49 2.7E-01 Y17324.1 NT Rattus norvegicus CDK104 mRNA zx39b10.s1 Soares_total_fetus_Nb2HF8_9w Homo sapiens cDNA clone IMAGE:788827 3' similar to 636 13697 26602 2.7 2.7E-01 AA450061.1 EST_HUMAN contains Alu repetitive element; 1288 14321 27267 1.38 2.7E-01 AB004906.1 NT Ipomoea purpurea transponsable element Tip100 gene for transposase, complete cds 1644 14675 1.92 2.7E-01 X79815.1 NT G.lamblia SR2 gene 1759 14786 27756 2.77 2.7E-01 W58067.1 EST_HUMAN zd22h10.r1 Soares_fetaL-heart_NbHH19W Homo sapiens cDNA clone IMAGE:341443 5' GAG POLYPROTEIN [CONTAINS: INNER COAT PROTEIN P12; CORE PROTEIN P15; CORE SHELL 1801 14827 27795 1.34 2.7E-01 P03341 SWISSPROT PROTEIN P30; NUCLEOPROTEIN P10] 2149 15917 2.21 2.7E-01 AF047575.1 NT Rattus norvegicus vesicular monoamine transporter type 2, promoter region and exon 1 2390 15395 28397 6.89 2.7E-01 Y13868.1 NT Feline immunodeficiency virus env gene, isolate ITTO088PIU (M88), partial te43c11.x2 NCI_CGAP_Lu25 Homo sapiens cDNA clone IMAGE:2046836 3' similar to contains element L1 2479 15481 28482 3.93 2.7E-01 AI310858.1 EST_HUMAN repetitive element ; 2941 15994 28896 1.32 2.7E-01 AF251276.1 NT Mus musculus serine prolease inhibitor 14 (Spi14) mRNA, complete cds 3026 16078 0.81 2.7E-01 BF088284.1 EST_HUMAN CM1-HT0875-060900-385-e05 HT0875 Homo sapiens cDNA 3899 16928 29806 0.86 2.7E-01 AJ290443.1 NT Corynebacterium glutamicum metK gene, ORF1 (partial) and ORF2 (partial) 4097 17122 29999 2.56 2.7E-01 AI928015.1 EST_HUMAN wo92e11.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2462828 3' 4108 17132 30006 0.78 2.7E-01 AF216214.1 NT Drosophila buzzatii alpha-esterase 6 (aE6) gene, partial cds 4108 17132 30007 0.78 2.7E-01 AF216214.1 NT Drosophila buzzatii alpha-esterase 6 (aE6) gene, partial cds 4113 17136 30010 2.67 2.7E-01 L77569.1 NT Homo sapiens DiGeorge syndrome critical region, telomeric end we29f05.x1 NCI_CGAP_Lu24 Homo sapiens cDNA clone IMAGE:2342529 3' similar to TR:Q13538 Q13538 4177 17191 30067 1.06 2.7E-01 AI701406.1 EST_HUMAN ORF2: FUNCTION UNKNOWN. ; 5000 17999 30856 3.23 2.7E-01 L27516.1 NT Trificum aestivum (Wcs66) gene, complete cds 5171 18163 4.27 2.7E-01 AW856131.1 EST_HUMAN RC1-CT0286-230200-016-e03 CT0286 Homo sapiens cDNA 5191 18183 31026 0.92 2.7E-01 AI827753.1 EST_HUMAN wf11g03.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2350324 3' Page 82 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 5448 18530 31256 2.42 2.7E-01 P17277 SWISSPROT HOMEOBOXPROTEIN HOX-A4 (CHOX-1.4) 5678 18752 1.39 2.7E-01 AB033171.1 NT Astreopora myrlophthalma mitochondrial cytb gene for cytochrome b, partial cds LATENT TRANSFORMING GROWTH FACTOR BETA BINDING PROTEIN 1 PRECURSOR (TRANSFORMING GROWTH FACTOR BETA-1 BINDING PROTEIN 1) (TGF-BETA1-BP-1) 6599 19640 32820 0.71 2.7E-01 Q00918 SWISSPROT (TRANSFORMING GROWTH FACTOR BETA-1 MASKING PROTEIN, LARGE SUBUNIT) LATENT TRANSFORMING GROWTH FACTOR BETA BINDING PROTEIN 1 PRECURSOR (TRANSFORMING GROWTH FACTOR BETA-1 BINDING PROTEIN 1) (TGF-BETA1-BP-1) 6599 19640 32821 0.71 2.7E-01 Q00918 SWISSPROT (TRANSFORMING GROWTH FACTOR BETA-1 MASKING PROTEIN, LARGE SUBUNIT) 6897 19927 33143 1.08 2.7E-01 AE001094.1 NT Archaeoglobus fulgldus section 13 of 172 of the complete genome 6897 19927 33144 1.08 2.7E-01 AE001094.1 NT Archaeoglobus fulgidus section 13 of 172 of the complete genome 7086 20292 33552 1.99 2.7E-01 Q61554 SWISSPROT FIBRILLIN 1 PRECURSOR Drosophila melanogaster rfc40 protein, Rop protein (Rop), and small GTP binding protein (DRas2) genes, 7361 20356 33625 0.5 2.7E-01 U15967.1 NT complete cds 7405 20104 0.46 2.7E-01 AI540070.1 EST_HUMAN td08h08.x1 NCI_CGAP_CLL1 Homo sapiens cDNA clone IMAGE:2075103 3' 7746 20677 33975 0.76 2.7E-01 Q11079 SWISSPROT HYPOTHETICAL 20.9 KD PROTEIN B0563.3 IN CHROMOSOME X 7994 20912 34227 0.94 2.7E-01 Q01168 SWISSPROT NITROGEN REGULATORY PROTEIN NUT1 7994 20912 34228 0.94 2.7E-01 Q01168 SWISSPROT NITROGEN REGULATORY PROTEIN NUT1 8141 21050 34381 2.24 2.7E-01 AF248054.1 NT Bos taurus micromolar calcium activated neutral protease 1 (CAPN1) gene, exons 11-20, and partial cds 8141 21050 34382 2.24 2.7E-01 AF248054.1 NT Bos taurus micromolar calcium activated neutral protease 1 (CAPN1) gene, exons 11-20, and partial cds 8203 21109 34439 0.9 2.7E-01 AA351121.1 EST_HUMAN EST58740 Infant brain Homo sapiens cDNA 5' end similar to similar to myosin-binding protein H 8203 21109 34440 0.9 2.7E-01 AA351121.1 EST_HUMAN EST58740 Infant brain Homo sapiens cDNA 5' end similar to similar to myosin-binding protein H 8283 21188 34526 0.51 2.7E-01 L01081.1 NT Cryctolagus cuniculus UDP-glucuronosyltransferase (UGT2B13) mRNA, complete cds ze35b11.s1 Soares retina N2b4HR Homo sapiens cDNA clone IMAGE:360957 3' similar to contains Alu 8445 21377 34718 0.71 2.7E-01 AA013147.1 EST_HUMAN repetitive element; Carassius auratus pituitary adenylate cyclase activating polypeptide type 1 receptor precursor mRNA, 8604 21535 0.63 2.7E-01 AF048820.1 NT complete cds 8714 21645 34991 0.57 2.7E-01 AW868503.1 EST_HUMAN MR1-SN0062-100500-002-d09 SN0062 Homo sapiens cDNA 8764 21694 35036 0.64 2.7E-01 R39257.1 EST_HUMAN yc91h06.s1 Soares infant brain 1NIB Homo sapiens cDNA clone IMAGE:23511 3' 8867 21797 35151 0.86 2.7E-01 AL161552.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 52 9318 22246 35608 0.76 2.7E-01 Q14764 SWISSPROT MAJOR VALUT PROTEIN (MVP) (LUNG RESISTANCE-RELATED PROTEIN) 9578 22505 35869 0.59 2.7E-01 X03216.1 NT Staphylococcus aureus transposon Tn554 9873 22788 36178 9.77 2.7E-01 O83809 SWISSPROT THREONYL-TRNA SYNTHETASE (THREONINE-TRNA LIGASE) (THRRS) Page 83 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (ToP)Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source value 9873 22786 36179 9.77 2.7ER-01 O83809 SWISSPROT THREONYL-TRNA SYNTHETASE (THREONNE-TRNA LIGASE) (THRRS) 9875 22790 2.78 2.7E-01 P37928 SWISSPROT FIMBRIAE W PROTEIN Raluts norvegicus DNA for peroxisome assembly factor-2, exon 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17 10317 28206 36617 0.8 2.7E-01 D89660.1 NT and complete cds 10583 23469 36895 1.14 2.7E-01 AF091848.1 NT Oryctolagus cuniculus calgranulin C mRNA, partial cds 10618 23504 36938 0.86 2.7E-01 AF087434.1 NT Mus musculus transcription factor NF-ATc isoform a (NF-ATca) mRNA, complete cds 10743 23629 37060 1.07 2.7E-01 AF156539.1 NT Homo saplens xeroderms pigmentosum complemntation group C (XPC) gene, intron 9 10743 23629 37061 1.07 2.7E-01 AF156539.1 NT Homo saplens xeroderms pigmentosum complemntation group C (XPC) gene, intron 9 11010 23894 0.52 2.7E-01 AB011679.1 NT Ratius norveglucus mRNA for class I beta-tubulin, complete cds 11251 24175 37622 1.55 2.7E-01 AV705043.1 EST_HUMAN AV705043 ADB Homo sapiens cDNA clons ADBCOD05 5' 11251 24175 37623 1.55 2.7E-01 AV705043.1 EST_HUMAN AV705043 ADB Homo sapiens cDNA clons ADBCOD05 5' Homo sapiens caveolin-1/-2 locus, contig1, D7S522, genes CAV2(exons 1, 2a, and 2b), CAV1 (exons 1 and 11261 24184 37633 3.26 2.7E-01 AJ133269.1 NT 2) 12987 25545 2.8 2.7E-01 AF217491.1 NT Homo sapiens fragile 16D oxico reductase (FOR) gene, exon 6 492 15876 26480 1.46 2.6E-01 P78411 SWISSPROT IROQUOIS-CLASS HOMEODOMAIN PROTEIN IRX-2 503 13574 1.31 2.6E-01 D1649.1 NT Bos taurus mRNA for mb-1, complete cds 1420 14451 27405 1.41 2.6E-01 BE885087.1 EST_HUMAN 601510838F1 NIH_MGC_71 Homo sapiens cDNA clone IMAGe:3912345 5' 1456 14488 27448 0.9 2.6E-01 AB013290.1 NT Glycine max pseudogene for Bd 30K 1914 14936 27911 4.79 2.8E-01 AL161472.2 NT Arbidopsis thalians DNA chromosome 4, contig 4, contig fragment No. 2 1914 14936 27912 4.79 2.8E-01 AL161472.2 NT Arbidopsis thalians DNA chromosome 4, contig 4, contig fragment No. 2 bb04d10.x1 NIH_MGC_14 Homo sapiens cDNA clone IMAGE:2958451 3' similar to gb:M36072 60S RIBOSOMAL PROTEIN L7A (HUMAN); gb:M14689_cds1 Mouse surfeit locus surfeit 3 protein gene 2105 15119 9.35 2.6E-01 AW7331521 EST_HUMAN (MOUSE); 2167 15179 28185 1.13 2.6E-01 M11844.1 NT Human prealbumin gene, complete cds 2577 15576 11.59 2.6E-01 BE272440.1 EST_HUMAN 601126016F1 NIH_MGC_9 Homo saplens cDNA clone IMAGE:299043 5' 3641 16677 29575 1.02 2.6E-01 M22342.1 NT Baoteriphage T2 DNA-(adenine-N6)methyltransferase(dam) gene, complete cds 3711 16743 29633 2.18 2.6E-01 AF229118.1 NT Homo saplens acetylcholineswterase collagen-like tall subunit (COLO) gene, exons 1A, 2, 3, 4, and 5 4190 17210 30076 0.71 2.6E-01 AW959510.1 EST_HUMAN EST371580 MAGE resequences, MAGF Homo sapiens cDNA 4252 17268 30137 17.02 2.6E-01 BE080598.1 EST_HUMAN QV1-BT0630-040400-132-e03 BT0630 Homo sapiens cDNA Enterococcus faecium strain N97-330 vanD glycopeptide resistances gene cluster, complete cds; and 4466 17477 30336 1.42 2.6E-01 AF175293.1 NT unknown gene 4611 17619 30481 0.72 2.6E-01 AB021180.1 NT Gallus gallus mRNA for skeletal myosin heavy chain, complete cds 4611 17619 30482 0.72 2.6E-01 AB021180.1 NT Gallus gallus mRNA for skeletal myosin heavy chain, complete cds Page 84 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (ToP)Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source value 4664 17669 30539 1.47 2.6E-01 AA457617.1 EST_HUMAN aa89d07.r1 Stratagene fetal relina 937202 Homo sapiens cDNA clone IMAGE:838477 5' 4757 17762 30624 1.03 2.6E-01 U01103.1 NT Arabidopsis thaliana PSI type III chlorophyll a/b-binding protein (Lhca3*1) mRNA, complete cds 4128 17829 30697 1.22 2.6E-01 AF142703.1 NT Ophrestia radicosa maturase-like protein (matK) gene, complete cds; chloroplast gene for chloroplast product 5092 18089 30939 4.99 2.6E-01 H04858.1 EST_HUMAN yj51e05.r1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE: 1552288 5' 5258 18244 31095 1 2.6E-01 P08503 SWISSPROT ACYL-COA DEHYDROGENASE, MEDIUM-CHAIN SPECIFIC, MITOCHONDRIAL PRECURSOR (MCAD) 5525 18604 1.14 2.6E-01 AB035972.1 NT Paramecium caudatum gene for PAP, complete cds 5634 18710 31610 0.68 2.6E-01 M96060.1 NT Acetobacter xylinum callulose synthase (bcsA) gne, partial cds, CMCax and CcpAx genes, complete cds td16a03.x1 NCI_CGAP_Co16 Homo sapiens cDNA clone IMAGE:2075788 3' simliar to contains element 5763 18836 0.81 2.6E-01 AI862398.1 EST_HUMAN MER35 repetitive element; Homo sapiens protein translocase, JM26protein, UDP-galactose translocator, pim-2 protooncogene homolog pim-2h, and shal-type potassium channel genes, complete cds; JM12 protein and transcription factor factor IGHM 5983 19048 32172 0.67 2.6E-01 AF207550.1 NT enhancer 3 genes, partial cds; and unknown g> 6306 26975 2.34 2.6E-01 AE001811.1 NT Therrnotoga maritima section 123 of 136 of the complete genome ts02e12.x1 NCI_CGAP_Pan1 Homo sapines cDNA clone IMAGE:2227438 3' similar to SW:NDF1_RAT 6442 19488 32665 2.01 2.6E-01 AI582557.1 EST_HUMAN Q64289 NEUROGENIC DIFFERENTITION FACTOR 1 ;contains element LTR1 repetitive element; ts02e12.x1 NCI_CGAP_Pan1 Homo sapines cDNA clone IMAGE:2227438 3' similar to SW:NDF1_RAT 6442 19488 32666 2.01 2.6E-01 AI582557.1 EST_HUMAN Q64289 NEUROGENIC DIFFERENTITION FACTOR 1 ;contains element LTR1 repetitive element; 6689 19725 32925 1.01 2.6E-01 AL162757.2 NT Neisseria meningitidis serogroup A strain Z2491 complete genome; segment 6/7 6964 19992 33219 0.65 2.6E-01 BE792052.1 EST_HUMAN 6015816754F1 NIH_MGC_7 Homo sapiens cDNA cione IMAGE:3936156 5' 6964 19992 33220 0.65 2.6E-01 BE792052.1 EST_HUMAN 6015816754F1 NIH_MGC_7 Homo sapiens cDNA cione IMAGE:3936156 5' wd48c04.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA cione IMAG:2331366 3' similar to gb:M37721 7389 20382 33651 1.07 2.6E-01 AI914380.1 EST_HUMAN PEPTIDYL-GLYCINE ALPHA-AMIDATING MONOOXYGENASE PRECURSOR (HUMAN); 7787 20716 34019 0.74 2.6E-01 BE148961.1 EST_HUMAN CM0-HT0245-011199-085-f04 HT0245 Homo sapiens cDNA 7833 25677 1.75 2.6E-01 AL139077.2 NT Campylobacter jejuni NCTC11168 complete genome; segment 4/5 7875 70802 0.62 2.6E-01 AA196149.1 EST_HUMAN zp92e01.r1 Stratagene HeLa cell s3 937216 Homo sapens cDNA cione IMAGE:627672 5' yf37a03.s1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:129004 3' similar to 8204 21110 34441 1.63 2.6E-01 R10365.1 EST_HUMAN gb:X1217 U1 SMALL NUCLEAR RIBONUCLEOPROTEING C (HUMAN); 8265 21170 34504 0.5 2.6E-01 Q09855 GWISSPROT HYPOTHETICAL TRP-ASP REPEATS CONTAINNG PROTEIN C29E6.01 IN CHROMOSOME I 8346 21251 0.48 2.6E-0 AF314149.1 NT Mus musculus telokin mRNA, complete cds 8432 21364 34703 1.41 2.6E-01 R02411.1 EST_HUMAN ye82a07.r1 Soares fetal liver spieen 1NFLS Homo sapiens cDNA clone iMAGE:124212 5' Page 85 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (ToP)Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 8483 21414 34751 1.35 2.6E-01 BE144331.1 EST_HUMAN MR)-HT0166-181199-003-d12 HT0166 Homo sapiens cDNA 8719 21650 34996 0.63 2.6E-01 XB2641.1 NT D.melanogaster mRNA for alpha 1,2mannosidase (Berlin) 8719 21650 34997 0.63 2.6E-01 XB2641.1 NT D.melanogaster mRNA for alpha 1,2mannosidase (Berlin) 8909 21839 35194 3.16 2.6E-01 BF343588.1 EST_HUMAn 602014422F1 NCI_CGAP_Brn64 Homo sapiens cDNA clone IMAGE:4150396 5' 8981 21911 35266 2.35 2.6E-01 ?Q10199 SWISSPROT HYPOTHETICAL 75.2 KD PROTEIN C11C11.02 IN CHROMOSOME II 9252 22180 35533 4.07 2.6E-01 BE830339.1 EST_HUMAN RC5-ET0082-310500-021-f10 ET0082 Homo sapiens cDNA 9252 22180 35534 4.07 2.6E-01 BE830339.1 EST_HUMAN RC5-ET0082-310500-021-f10 ET0082 Homo sapiens cDNA 10000 22817 36206 1.09 2.6E-01 X17604.1 NT S. occidentalis INV gene for inveriase (EC 3.2.1.26) Lontra canadensis cytochrome b (cytb) gene, mitochondrial gene encoding mitochoncrial protein, complete 10259 23149 0.56 2.6E-01 AF057121.1 NT cds 10381 23270 36692 1.28 26E-01 P87366 SWISSPROT GREEN-SENSITIVE OPSIN (GREEN CONE PHOTORECEPTOR PIGMENT) (KFH-G) 10381 23270 36693 1.28 26E-01 P87366 SWISSPROT GREEN-SENSITIVE OPSIN (GREEN CONE PHOTORECEPTOR PIGMENT) (KFH-G) 10687 23573 0.71 2.6E-01 Q28295 SWISSPROT VON WILLEBRAND FACTOR PRECURSOR (VWF) 10987 23871 1.16 2.6E-01 Y10196.1 NT Homo sapiens PHEX gene 11074 23958 0.56 2.6E-01 Y15874.2 NT Canio rerio mRNA for RPTP-alpha protein 11855 24705 38196 1.81 2.6E-01 P48280 SWISSPROT CELL DIVISION PROTEIN FTSW HOMCLOG 11956 24799 53.33 2.6E-01 X51755.1 NT Human lambda-immunoglobulin constant reglen complex (germline) 12350 25142 1.61 2.6E-01 10190555 NT Mus musculus jerky (Jrk), mRNA 12520 25863 3.66 2.6E-01 BE883491.1 EST_HUMAn 601511052F1 NIH_MGC_71 Homo sapiens cDNA clone IMAGE:3912612 5' 12580 25282 31841 3.08 2.6E-01 AF316896.1 NT Homo sapiens Na/K-ATPase gemma subunit (FXYD2) gene, complete c ds, alternatively spliced 12894 25484 1.79 2.6E-01 D88425.1 NT Cavia co bya mRNA for serine/threoine kinase, complete cds 12966 25531 1.95 2.6E-01 AE001713.1 NT Thermotoga maritima section 25 of 136 of the complete genome 13038 25575 2.47 2.6E-01 P47285 SEISSPROT HYPOTHETICAL PROTEIN MG039 Homo sapiens ATP synthase, H+ trensporting, mitochondrial F1 complex, data subunit (ATP5D), nuclear 260 13357 26272 2.76 2.5E-01 4502296 NT gene encoding mitochondriel protein, mRNA Homo sapiens ATP synthase, H+ trensporting, mitochondrial F1 complex, data subunit (ATP5D), nuclear 260 13357 26272 1.71 2.5E-01 4502296 NT gene encoding mitochondriel protein, mRNA 274 13369 3.59 2.5E-01 M26501.1 NT Starfish (p.ochracsus) cytopiasmic actin gene, complete cds 857 13911 26854 1.33 2.5E-01 U09964.1 NT Mus musculus ICR/Swiss glyceraldehyde 3-phosphate dehydrogenase (Gapd-S) gene, complete cds 1087 14131 1.24 2.5E-01 AE002156.1 NT Ureaplasma urealytioum section 57 of 59 of the complete genome 1448 14190 27129 7.22 2.5E-01 T89837.1 EST_HUMAn ye11g07.r1 Stratagene lung (#937210) Homo sapiens cDNA clone IMAGE:117468 5' 1405 14436 0.93 2.5E-01 AB025343.1 NT Olea europaea OEW mRNA for lupeol sythase, complete cds 1540 14570 27529 1.51 2.5E-01 AL115624.1 NT Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation Pag 86 of 545<BR> Table 4<BR> Singlo Exon Probes Exprcssed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (ToP)Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source value 1758 14785 4.13 2.5E-01 4885406 NT Homo sapiens hyperpolarization activated cyclic cyclic nucleotide-gated potasslum channel 4 (HCN4) mRNA 2431 15435 9.17 2.5E-01 AE00675.1 NT Aquifex seolicus section 7 of 109 of the complete genome 2518 15519 1.96 2.5E-01 AA251987.1 EST_HUMAN zs11a12.r1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE;684862 5' 2683 15677 28676 1.69 2.5E-01 x95310.1 NT B.taurus mRNA for D-aspartate oxldase 3473 16513 4.87 2.5E-01 AW973471.1 EST_HUMAn EST386464 MAGE resequences, MAGM Homo sapiens cDNA 3608 16645 2544 8.3 2.5E-01 AL161517.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment no. 29 4156 17177 1.54 2.5E-01 P32323 SWISSPROT A-AGGLUTININ ATTACHMENT SUBUNIT PRECURSOR 4423 17434 0.91 2.5E-01 Q03314 SWISSPROT HHIB PROTEIN Mus musculus neuronal apoptosis inhibitory protein 6 (Naip6) gene, complete cds; and Naip3 gene, exons 2-9 4728 17733 30595 0.77 2.5E-01 AF242431.1 NT and 11-16 4863 17865 1.6 2.5E-01 Q27225 SWISSPROT MOLT-INHIBITING HORMONE PRECURSOR (MIH) 4869 17869 30733 4.63 2.5E-01 AT007763.1 NT Choristoneura fumiferana dispause associated protein 2 (DAP2) mRNA, complete cds 4895 17894 30760 2.58 2.5E-01 AE004416.1 NT Vibrio cholerae chromosome II, section 73 of 93 of the complete chromosome Mus musulus annexin V gene, intron 4 segment containing 5' LTR and geg portion fo MuERV-L (murine 4918 17917 3.27 2.5E-01 AJ230113.1 NT endogenous retrovirus )element 4947 17946 30804 0.78 2.5E-01 BE896785.1 EST_HUMASN 601437468F1 NIH_MGC_72 Homo sapiens cDNA clone IMAGE:3922600 5' ho62f11.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE;3041997 3' similer to 5178 18170 31015 1.06 2.5E-01 AW873586.1 EST_HUMAN WP:Y71F9A_294.D CE22858; 5242 18229 31078 0.94 2.5-E-01 P27023 SWISSPROT MAJOR SURFACE GLYCOPROTEIN G (ATTACHMENT GLYCOPROTEIN G) 5242 18229 31079 0.94 2.5-E-01 P27023 SWISSPROT MAJOR SURFACE GLYCOPROTEIN G (ATTACHMENT GLYCOPROTEIN G) 5509 18588 31437 10.94 2.5E-01 S83390.1 NT T3 receptor-associating cofactor-1 [human, fetal liver, mRNA, 2930 nt] 6185 19242 32389 0.59 2.5E-01 AJ006345.1 NT Homo sapiens KVLQT1 gene 6186 19243 0.75 2.5E-01 AL163207.2 NT Homo sapiens chromosome 21 segment HS21C007 6649 19688 32880 0.68 2.5E-01 P2219 SWISSPROT PROTEIN KINSE VPS15 6915 19945 33164 0.89 2.5E-01 AJ251973.1 NT Homo sapiens partial steerin-1 gene 7396 20095 33329 0.71 2.5E-01 8394138 NT Rattue norvegious rabin 3 (RABIN3), mRNA Feline calicivirus CFI/68 RNA helicase/cysteine protease/RNA-dependent RNA polymerase polyprotein 7740 20671 33969 0.81 2.5E-01 U13992.1 NT precursor and capsid protein precursor, genes, complete cds; and unknown gene 7771 20701 1.49 2.5E-01 AF134119.1 NT Mus musculus SKD1 (Skd1) gene, complete cds 8037 20952 34267 0.63 2.5E-01 AL161506.2 NT Arebldopsis thaliana DNA chromsome 4, contig fragment No. 18 8085 20997 34317 4.95 2.5E-01 AL163282.2 NT Homo sapiens chromosome 21 segment HS21C082 8427 21359 34699 1.71 2.5E-01 BF109040.1 EST_HUMAN 7157a03.x1 Soares_NSF_F8_9W_OT_PA_P_S1 Homo sapiens cDNA clone IMAGE:3525369 3' 8438 21370 34711 0.79 2.5E-01 BE960712.1 EST_HUMAN 601653391R2 NIH_MGC_58 Homo sapiens cDNA clone IMAGE:3826198 3' Page 87 of 545<BR> Table 4<BR> Single Exon Proges Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (ToP)Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 8804 21734 35083 2.25 2.5E-01 BF038595.1 EST_HUMAN 601459238F1 NIH_MGC_66 Homo sapiene cDNA clone IMAGE:3862809 5' 9195 22123 35479 4.58 2.5E-01 H53236.1 EST_HUMAN yq84f07.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:202501 5' 9433 22351 35724 1.03 2.5E-01 M88626.1 NT Mouse testis-spacific protein (TPX-1) gene, exon 10 10047 22963 36351 22.51 2.5E-01 U8965.1 NT Homo sapiens matrix metallooprobeinase MMP Rasi-1 gene, promotor region 10047 22963 36352 22.51 2.5E-01 U8965.1 NT Homo sapiens matrix metallooprobeinase MMP Rasi-1 gene, promotor region 10101 22950 36339 1.58 2.5E-01 AF085164.1 NT Hordeum vulgare receptor-like kinase LRK10 gene, partial cds 10101 22950 36340 1.58 2.5E-01 AF085164.1 NT Hordeum vulgare receptor-like kinase LRK10 gene, partial cds 10600 23486 36915 1.69 2.5E-01 AW581997.1 EST_HUMAN RC3-ST0186-130100-015-a07 ST0186 Homo sapiens cDNA 10830 23716 37141 0.52 2.5E-01 11466652 NT Porphyra purpurea chloroplast, complete genome xg40c10.x1 NCI_CGAP_Ut1 Homo sapiens cDNA clone IMAGE:2630034 3' similer to contains Alu repetitive 11020 23904 37343 1.77 2.5E-01 AW152246.1 EST_HUMAN element; contains element MSR1 repetitive element; 11023 23907 37347 1.81 2.5E-01 X58491.1 NT MOuse L1Md LINE DNA 11516 24426 37884 4.42 2.5E-01 D50914.1 NT Human mRNA for KIAA0124 gene, partial cds 12075 24916 1.61 2.5E-01 AF027153.1 NT Homo saplens sodium/myo-inositol cotransporter (SLC5A3) gene, complste cds 12290 25101 28575 6.59 2.5E-01 AF200528.1 NT Zea mays cellulose synthase-4 (CssA-4) mRNA, complete cds 12316 25936 4.23 2.5E-01 AL161541.2 NT Arebidopsis thaliana DNA chromosme 4, contig fragment No. 41 575 13643 26550 1.43 2.4E-01 AA936314.1 EST_HUMAN on70d04.s1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:1562023 3' 873 13926 26874 2.48 2.4E-01 BF576124.1 EST_HUMAN 602132442F1 NIH_MGC_81 Homo sapiens cDNA clone IMAGE:4271578 5' 1330 14364 27312 12.06 2.4E-01 AJ289880.1 NT Homo sapiens KIAA0851 gene (partial), XT3 gene and LZTFL1 gene 1330 14364 27313 12.06 2.4E-01 AJ289880.1 NT Homo sapiens KIAA0851 gene (partial), XT3 gene and LZTFL1 gene 1411 14442 27395 1.04 2.4E-01 Y17293.1 NT Homo saplens FLI-1 gene, partial 1875 14896 17.09 2.4E-01 AF267753.1 NT Mesembryanthemum crystallinum pulative potassium channel protein Mkt1p mRNA, complete cds 1918 14939 27916 1.12 2.4E-01 AF251708.1 NT Zaocys dhumnades fructose-1,6-bisphosphatase mRNA, complete cds 2152 15164 28166 1.03 2.4E-01 AF111168.2 NT Homo sapiens serine palmitoyl transferase, subunit II gene, complete cds; and unknown genes 2181 15192 1.15 2.4E-01 P45384 SWISSPROT IMMUNOGLOBULIN A1 PROTEASE PRECURSOR (IGA1 PROTEASE) 2279 15288 28296 1.94 2.4E-01 AE000680.1 NT Aquifex aeolicus section 12 of 109 of the complete genome 7h23d04.x1 NCI_CGAP_Co16 Homo sapiens cDNA clone IMAGE:3316807 3' simllar to SW:PRSB_XENLA 2407 15412 28415 1.44 2.4E-01 BF002171.1 EST_HUMAN O42586 26S PROTEASE REGULATORY SUBUNIT 6A; 2556 15565 28565 1.9 2.4E-01 Z36534.1 NT D.discoideum (Ax3-K) ponA gene 2812 15801 28800 2.72 2.4E-01 X71783.1 NT S.pombe swi6 gene 2834 15823 28819 4.96 2.4E-01 AF030154.1 NT bovine adenovirus 3 complete genome 3177 16227 3.83 2.4E-01 U72726.1 NT Oryza lonistaminata receptor kinase-lide protein, family member D, and retroflt (gag/pol) genes, complete cds 3824 16854 29738 0.87 2.4E-01 AE000312.1 NT Escherichla coli K-12 MG1655 section 202 of 400 of the complete genome Page 88 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 5049 18046 1.32 2.4E-01 AL161589.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 85 5205 18196 31038 0.67 2.4E-01 AW078596.1 EST_HUMAN xb18e02.x1 NCI_CGAP_Kid13 Homo sapiens cDNA clone IMAGE:2576618 3' 5205 18196 31039 0.67 2.4E-01 AW078596.1 EST_HUMAN xb18e02.x1 NCI_CGAP_Kid13 Homo sapiens cDNA clone IMAGE:2576618 3' 5648 18722 31627 0.84 2.4E-01 AI925707.1 EST_HUMAN wo33d05.x1 NCI_CGAP_Gas4 Homo sapiens cDNA clone IMAGE:2457129 3' 5648 18722 31628 0.84 2.4E-01 AI925707.1 EST_HUMAN wo33d05.x1 NCI_CGAP_Gas4 Homo sapiens cDNA clone IMAGE:2457129 3' 5673 18747 31658 0.66 2.4E-01 D50871.1 NT Glycine max mRNA for mitotic cyclin b1-type, complete cds 5852 18923 32038 13.04 2.4E-01 AF091216.1 NT Mus musculus Wrn protein (Wrn) gene, complete cds 5852 18923 32039 13.04 2.4E-01 AF091216.1 NT Mus musculus Wrn protein (Wrn) gene, complete cds 5880 18949 0.67 2.4E-01 M83377.1 NT Galius galuis brain-derived neurotrophic fector (BDNF) gene, 5' end 6106 25639 0.98 2.4E-01 AJ133836.2 NT Branchiostoma floridas mRNA for calmodulin 2 (caM2 gene) 7i54d04.x1 NCI_CGAP_Br18 Homo sapiens cDNA clone IMAGE:3338503 3' similar to SW:SFR4_HUMAN Q08170 SPLIGING FRCTOR, ARGININE/SERINE-RICH 4;contains element TAR1 TAR1 repetitive lement 6113 19173 32305 2.65 2.4E-01 BF592336.1 EST_HUMAN ; 6215 19270 32423 2.36 2.4E-01 AF035546.1 NT Drosophila melanogaster p38a MAP kinase gene, complete cds 6327 19377 32544 2.06 2.4E-01 7661801 NT Homo sapiens HSPC142 protein (HSPC142), mRNA 6381 19430 32598 1.07 2.4E-01 AV733787.1 EST_HUMAN AV733787 cdA Homo sapiens cDNA clone cdAADE11 5' 6647 19686 32877 0.56 2.4E-01 AA3986721 EST_HUMAN zt70d02.s1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:727683 3' wc62c11.x1 NCI_CGAP_Pan1 Homo sapiens cDNA clone IMAGE:2323220 3' similar to gb:J03464 6814 19847 33058 3.19 2.4E-01 AI698989.1 EST_HUMAN PROCOLLAGEN ALPHA 2(I) CHAIN PRECURSOR (HUMAN); 7398 20097 33331 0.47 2.4E-01 AF163863.1 NT Mustela vison tyrosine aminotransferase gene, complete cds 7729 20661 33959 10.49 2.4E-01 L43001.1 NT Bos taurus guanylyl cyclase-ectivating protein 2 (guca2) mRNA, complete cds 7927 20849 34155 0.46 2.4E-01 N48732.1 EST_HUMAN yy55c11.r1 Soares_multiple_sclerosis_2NbHMSP Homo sapiens cDNA clone IMAGE:277460 5' 8185 21092 0.43 2.4E-01 U05013.1 NT Raltus norvegicus Sprague-Dewley heme oxygenese-2 non-reducing isoform gene, complete cds 8187 21094 34425 0.96 2.4E-01 AF229644.1 NT Mus musculus DXImx48e protein (DXImx48e) mRNA, complete cds 8658 21589 34925 0.56 2.4E-01 X97252.1 NT M.musculus pah gene and promotor 8658 21589 34926 0.56 2.4E-01 X97252.1 NT M.musculus pah gene and promotor 8776 21706 35051 0.66 2.4E-01 AJ006397.1 NT Streptococcus pneumoinae rr08 and hk08 genes; two component system 08 8776 21706 35052 0.66 2.4E-01 AJ006397.1 NT Streptococcus pneumoinae rr08 and hk08 genes; two component system 08 8923 21853 35208 1.8 2.4E-01 AJ012585.1 NT Tetrahymena thermophila macronuclear gene encoding ribosomal protein L3, exons 1-2 9161 22089 35448 1.27 2.4E-01 BF242794.1 EST_HUMAN 601877679F1 NIN_MGC_55 Homo sapiens cDNA clone IMAGE:4106298 5' 9676 22602 35975 0.59 2.4E-01 AL139077.2 NT Campoylobacter jejuni NCTC11168 complete genome; segment 4/6 9676 22602 35976 0.59 2.4E-01 AL139077.2 NT Campoylobacter jejuni NCTC11168 complete genome; segment 4/6 Page 89 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value wd43e02x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2330906 3' similar to contains 10992 22885 36269 6.68 2.4E-01 AI693515.1 EST_HUMAN MER22.b1 TAR1 repetitive element; 10226 23117 36518 0.68 2.4E-01 AF220067.1 NT Drosophila melanogaster SKPB gene, complete cds 10226 23117 36519 0.68 2.4E-01 AF220067.1 NT Drosophila melanogaster SKPB gene, complete cds 10919 23804 37231 1.74 2.4E-01 Q03692 SWISSPORT COLLAGEN ALPHA 1(X) CHAIN PRECURSOR 11026 24132 37580 2.55 22.4E-01 AL161494.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 6 11275 24197 37650 2.16 2.4E-01 AF030199.1 NT Mus musculus type 1 sigma receptor gene, complete cds 11615 24523 37991 1.63 2.4E-01 BE296917.1 EST_HUMAN 60116415F1 NIH_MGC_17 Homo sapiens cDNA clone IMAGE:3531843 5' 11615 24523 37992 1.63 2.4E-01 BE296917.1 EST_HUMAN 60116415F1 NIH_MGC_17 Homo sapiens cDNA clone IMAGE:3531843 5' 11647 24553 2.11 2.4E-01 721647.1 NT P.asiatica mosaic virus genomio RNA 12373 25747 1.94 2.4E-01 AF004213.1 nT arabidopsis thaliana ethylene-insensitive3-like1 (EIL1) mRNA, complete cds 13034 25572 5.21 2.4E-01 AL163281.2 NT Homo sapiens chromosome 21 segment HS21C081 410 13483 26403 1.54 2.3E-01 S75898.1 NT arometace [Poephila guttata=zebra finches, ovary, mRNA, 3188 nt] 660 13722 297 2.3E-01 U39713.1 NT Mycoplasma genitalium section 35 of 51 of the complete genome 690 13751 26666 21.44 2.3E-01 U67596.1 NT Methanoccoccus jannaschil section 138 of 150 of the complete genome 962 14012 26954 3.47 2.3E-01 BE311893.1 EST_HUMAN 601142073F1 NIH_MGC_14 Homo sapiens cDNA clone IMAGE:3505818 5' 1630 14560 27520 1.07 2.3E-01 6677980 NT Mus musculus vacuoler protein sorting 4b (yeast) (Vps4b), mRNA 1656 14686 27649 2.08 2.3E-01 Y10887.2 NT Mus musculus cdh5 gene. exon 1, partial 2059 15075 1.13 2.3E-01 AJ235353.1 NT Homo sapiens partial intron 3 of the wild type AF-4/FEL gene 2470 15473 28472 1.69 2.3E-01 BE297716.1 EST_HUMAN 601175562F1 NIH_MGC_17 Homo sapiens cDNA clone IMAGE:3531015 5' 2700 15694 28688 1.34 2.3E-01 M11319.1 NT Human erythropoietin gene, complete cds 2872 14445 27399 2.23 2.3E-01 AB015033.1 NT Marinilabilia agarovorans gryB gene for DNA gyrase subunit B, partiel cds, strain:IFO 14957 no16d06.c1 NCI_CGAP_Phe1 Homo sapiens cDNA clone IMAGE:1100843 3' similar to contains Alu 3003 16056 28960 1.3 2.3E-01 AA601379.1 EST_HUMAN repetitive element, contains element THR repetitive element; 3133 16183 7.86 2.3E-01 R21732.1 EST_HUMAN yh21b07.s1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE:130357 3' 3428 16469 29378 1.45 2.3E-01 H69836.1 EST_HUMAN yr97h10.r1 Soares fetal liver spieen 1nFLS Homo sapiens cDNA clone IMAGE:213283 5' GSTA5=gluathlone S-transferase Yc2 subunit {5' region, intron 1} [rats, Morris hepatoma cell line, Genomic, 3912 16941 29820 0.99 2.3E-01 S82821.1 NT 2212 nt, segment 1 of 3] 4011 17038 6.59 2.3E-01 7662133 NT Homo sapiens KIAA0450 gene product (KIAA0450), mRNA 4459 17470 30327 0.91 2.3E-01 R82252.1 EST_HUMAN yi17f01.r1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE:149017 5' 4506 17516 2.08 2.3E-01 L78789.1 NT Mus musculus renin (Ren-1c) gene, promoter region 4561 17569 30431 1.04 2.3E-01 D90899.1 NT Syrechocystis sp. PGG6803 comlete genome, 1/27, 1-133859 4601 17609 30467 2.01 2.3E-01 AF092536.1 NT Homo sapiens mitogen-activated protein kinase p38delta (PPKM13) mRNA, complete cds 4669 17674 30544 8.59 2.3E-01 5031984 NT Homo sapiens nuclear transport factor 2 (lacental protein 15) (PP15) mRNA Page 90 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Livor Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 5179 18171 31016 0.8 2.3E-01 AB032400.1 NT Mus musculus tulip 1 mRNA, complete cds 5299 18283 31134 0.69 2.3E-01 BF674804.1 EST_HUMAN 602132210F1 NIH_MGC_81 Homo sapiens cDNA clone IMAGE:4271547 5' 5487 18567 31413 2.37 2.3E-01 AB040945.1 NT Homo sapiens mRNA for KIAA1512 protein, partial cds 7k30b06.x1 NCI_CGAP_Ov18 Homo sapiens cDNA clone IMAGE:3476699 3' similar to SW:GAG_SMSAV P03330 GAG POL YPROTEIN [CONTAINS: CORE PROTEIN P15; INNER COAT PROTEIN P12; CORE 5614 18690 31585 208 2.3E-01 BF058381.1 EST_HUMAN SHELL PROTEIN P30; NUCLEOPROTEIN P10].; 5720 18793 31885 4.78 2.3E-01 X96587.1 NT C.familiaris rom1 gene 5846 18917 1.14 2.3E-01 L39112.1 NT Vittaforma corneum small subunit ribosomal RNA gene 5958 19025 32145 3.24 2.3E-01 S60371.1 NT 23S rRNA [Leuconostoc carnosum, Genomic, 2866 nt] as27e12.x1 Barstead acrta HPLRB6 Homo sapiens cDNA clone IMAGE:2318446 3' similar to gb:X13238 6166 19223 32366 1.896 2.3E-01 AI708840.1 EST_HUMAN CYTOCHROME C OXIDASE POLYPEPTIDE VIC PRECURSOR (HUMAN); as27e12.x1 Barstead acrta HPLRB6 Homo sapiens cDNA clone IMAGE:2318446 3' similar to gb:X13238 6166 19223 32367 1.896 2.3E-01 AI708840.1 EST_HUMAN CYTOCHROME C OXIDASE POLYPEPTIDE VIC PRECURSOR (HUMAN); Oryctolagus cuniculus cytochrome oxidase subunit Via (coxVia2) mRNA, complete cds nuclear gene for 6949 19978 33201 0.75 2.3E-01 AF198089.1 NT mitochondrial product as42f12.x1 Barstead aorta HPLRB6 Homo sapiens cDNA clone IMAGE:2319887 3' similar to contains Alu 7204 20204 33449 4.52 2.3E-01 AI718148.1 EST_HUMAN repetitive element; 7470 20410 33688 0.65 2.3E-01 8923323 NT Homo sapiens hypothetical protein FLJ20345 (FLJ20345), mRNA 7667 20601 33899 0.75 2.3E-01 AF000227.1 NT Secale cereale omega secalin gene, complete cds 7816 20745 34050 2.81 2.3E-01 AF175389.1 NT Glycine max resistance protein LM17 precursor RNA, partial cds 7819 20748 34052 2.15 2.3E-01 AV719681.1 EST_HUMAN AV719681 GLC Homo sapiens cDNA clone GLCDGB08 5' 7819 20748 34053 2.15 2.3E-01 AV719681.1 EST_HUMAN AV719681 GLC Homo sapiens cDNA clone GLCDGB08 5' 8052 20965 3.54 2.3E-01 6754779 NT Mus musculus myosin XV (Myo15), mRNA 8057 20970 34286 1.56 2.3E-01 BE888071.1 EST_HUMAN 601511573F1 NIH_MGC_71 Homo sapiens cDNA clone IMAGE:3912859 5' 8219 21124 268 2.3E-01 N80983.1 EST_HUMAN za12e08.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:292358 5' 8267 21172 34506 0.64 2.3E-01 11416821 NT Homo sapiens prolocadherin alpha cluster (LOC63960), mRNA 8267 21172 34507 0.64 2.3E-01 11416821 NT Homo sapiens prolocadherin alpha cluster (LOC63960), mRNA 8410 21313 34645 0.55 2.3E-01 AF177946.1 NT Streptomyces coellcolor A3(2) phosphoenolpyruvate carboxyiase (ppc) gene, complete cds 8434 21366 34706 0.72 2.3E-01 AL161558.2 NT Arabidopsis thaliana DNA chromosome 4, conting fragment No. 58 Oxytricha nova macronuclear telomere-binding protein alpha subuni (tel-alpha elenine version) gene, 8573 21504 34848 1.85 2.3E-01 M68931.1 NT complete cds 9332 22260 35624 0.57 2.3E-01 AW090541.1 EST_HUMAN xc90e06.x1 NCI_CGAP_Brn35 Homo sapiens cDNA clone IMAGE:2591554 3' 9445 22373 35738 0.55 2.3E-01 AW964460.1 EST_HUMAN EST376533 MAGE resequences, MAGH Homo sapiens cDNA 9683 22609 35982 0.63 2.3E-01 AA372164.1 EST_HUMAN EST84061 Rhabdomyosarcoma Homo sapiens cDNA 5' end similar to DnaJ homolog (GB:X63368) Page 91 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Aduit Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 9683 22609 35983 0.63 2.3E-01 AA372164.1 EST_HUMAN EST84061 Rhabdomyosarcoma Homo sapiens cDNA t' end similar to DnaJ homolog (GB:X63368) 10110 23001 36397 0.74 2.3E-01 6679318 NT Mus musculus phosphatidylinositol 3-kinase catalytic subunit delta (Pik3cd), mRNA 10249 23140 36546 0.61 2.3E-01 BE277860.1 EST_HUMAN 601120110F1 NIH_MGC_20 Homo sapiens cDNA clone IMAGE:2966739 5' 10301 23191 36602 0.94 2.3E-01 AW964460. EST_HUMAN EST376533 MAGE resequences, MAGH Homo sapiens cDNA Haemophilus influenzae genes for Hincil restriction-modification system (Hincil methyltransferase (EC 10347 23236 36654 1.53 2.3E-01 X52124.1 NT 2.1.1.72) and Hincil endonuclease (EC3.1.21.4)) 10380 23269 36691 0.69 2.3-01 AW364633.1 EST_HUMAN PM2-DT0036-281299-001-f04 DT0036 Homo sapiens cDNA 10443 23332 36749 3.13 2.3E-01 BE17306.1 EST_HUMAN MR0-HT0559-240400-014-g11 HT0559 Homo sapiens cDNA 10498 23386 36796 2.6 2.3E-01 AJ293261.1 NT Rhizobium leguminosarum partiel genomic DNA for exopdysaccharide boisynthesis genes 10923 23808 37236 0.95 2.3E-01 AF201929.1 NT Murine hepatitis virus strain 2, complete genome 10933 23818 6.03 2.3E-01 BF133577.1 EST_HUMAN 601646155R2 NIH_MGC_59 Homo sapiens cDNA clone IMAGE:4102092 3' 11453 24369 37818 1.7 2.3E-01 AF004833.1 NT Mus musculus tissue factor pathway inhibitor (TFPI) mRNA, complete cds 11453 24369 37819 1.7 2.3E-01 AF004833.1 NT Mus musculus tissue factor pathway inhibitor (TFPI) mRNA, complete cds 11634 24540 38012 2.07 2.3E-01 AJ250189.1 NT Mus musculus partial mRNA for muscle protein 534 (mg534 gene) 11634 24540 38013 2.07 2.3E-01 AJ250189.1 NT Mus musculus partial mRNA for muscle protein 534 (mg534 gene) 11790 24712 38203 3.1 2.3E-01 AE002167.2 NT Chlamydophile pneumoniae AR39, section 4 of 94 of the complete genome 12206 25041 1.55 2.3E-01 AV709736.1 EST_HUMAN AV709736 ADC Homo sapiens cDNA clone ADCAGH01 5' 12359 25148 3.55 2.3E-01 U45426.1 NT Borrelia burgdorferi 2.9-6 locus, ORF-A-D genes, complete cds and REP+ gene, partial cds 12436 25194 42.5 2.3E-01 T27231.1 EST_HUMAN HCOEST44 HT29M6 Homo sapiens cDNA clone HCoE44 5' xv21d07.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2813773 3' similar to TR:Q9Z175 12516 25875 31474 3.19 2.3E-01 AW303623.1 EST_HUMAN Q9Z175 LYSYL OXIDASE-RELATED PROTEIN 2, ;contains PTR5.b2 TAR1 repettive element; 12552 25916 31370 9.63 2.3E-01 BE882464.1 EST_HUMAN 601507202F1 NIH_MGC_71 Homo sapiens cDNA clone IMAGE:3908689 5' 12597 25293 1.91 2.3E-01 BF663319.1 EST_HUMAN 602144459F1 NIH_MGC_48 Homo sapiens cDNA clone IMAGE:4297719 5' 12645 25321 1.9 2.3E-01 AJ006519.1 NT Ratiu snorvegicus mRNA for acid gated ion channel 12736 25321 1.6 2.3E-01 AJ006519.1 NT Rattus norvegicus mRNA for acid gated ion channel nac39h12.x1 Lupsld-sclatic_nerve Homo saptens cDNA clone IMAGE:33959950 3' similar to contains element 12968 25533 1.91 2.3E-01 BF475611.1 EST_HUMAN MER38 repetitive element; qz14a10.x1 Soares_fetal_liver_splean_1NFLS_S1 Homo sapiens cDNA colne IMAGE;1675290 3' similar to 92 13205 26118 0.78 2.2E-01 AI052190.1 EST_HUMAN TR:Q13040 Q13040 ATP-BINDING CASSETTE PROTEIN; 1585 14616 27579 2 2.2E-01 AF187850.1 NT Homo sapiens PPAR delta gene, promoter region 2101 15115 28120 2.24 2.2E-01 M34640.1 NT Fresh-water sponge Emf1 alpha collagen (COLF1) gene 2426 15429 28430 5.5 2.2E-01 BF677538.1 EST_HUMAN 602085608F1 NIH_MGC_83 Homo sapiens cDNA clone IMAGE:4249969 5' 2627 15625 28618 1.92 2.2E-01 BE618259.1 EST_HUMAN 601462629F1 NIH_MGC_67 Homo sapiens cDNA clone IMAGE:3866190 5' Page 92 of 454<BR> Table 4<BR> Single Exon Probes Expressed in Aduit Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 2627 16625 28619 1.92 2.2E-01 BE618258.1 EST_HUMAN 601462629F1 NIH_MGC_67 Homo sapiens cDNA clon eiMAGE:3866190 5' 2924 15977 28875 5.61 2.2E-01 BE155625.1 EST_HUMAN PM2-HT0353-2812299-003-a12 HT0353 Homo sapisn cDNA 2924 15977 28876 5.61 2.2E-01 BE155625.1 EST_HUMAN PM2-HT0353-2812299-003-a12 HT0353 Homo sapisn cDNA 2963 16015 2.07 2.2E-01 AF020503.1 NT Homo sapiens FRA3B common fragile region, diadenosine triphosphate hydrolase (FHIT) gene, exon 5 3451 16492 3.7 2.2E-01 AL1615622 NT Arabidopsis thaliana dNA chromosome 4, contig fragment No. 62 3816 16846 29731 0.66 2.2E-01 AL163285.2 NT Homo sapiens chromosome 21 segment HS21C085 3884 16913 1.11 2.2E-01 AF155728.1 NT Xiphophorus maculatus truncaled Rex1 retrotransposon reverse transcriptase (RT) pseudogene 4308 17322 1.03 2.2E-01 AF119102.1 NT Drosophila melanogaster UNC-119 (unc-119) gene complets cds Mus musculus mixed lineage kinase 3 (Mik3) and two pore domain K+ channel subunit (Kcnk6) genes, 4316 17330 30194 6.07 2.2E-01 AF155142.1 NT complete cds 4363 17377 30240 2.9 2.2E-01 AF117340.1 NT Mus musculus MAP kinase kinase kinase 1 (Mekk1) mRNA, complete cds 4363 17377 30241 2.9 2.2E-01 AF117340.1 NT Mus musculus MAP kinase kinase kinase 1 (Mekk1) mRNA, complete cds 4465 17476 30334 1.18 2.2E-01 U01307.1 NT Human scRNA (BC200 beta) pseudogene 4465 17476 30335 1.18 2.2E-01 U01307.1 NT Human scRNA (BC200 beta) pseudogene 4939 17938 1.66 2.2E-01 D50604.1 NT Human bata-cytoptasmle actin (ACTBP9) pseudogene 4945 17944 30802 1.72 2.2E-01 AA211216.1 EST_HUMAN zq87c05.r1 Stratagene hNT neuron (#937233) Homo sapiens cDNA clone IMAGE:648968 5' 5088 18085 30936 1.06 2.2E-01 M86524.1 NT Human dystrophin gene 5173 18165 1.2 2.2E-01 L13299.1 NT Mus musculus vinculin gene, exon 3 yr42h09.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:208001 5' similar to 5283 18269 31117 1.18 2.2E-01 H60548.1 EST_HUMAN gl@:Z14116_rna1 CD59 GLYCOPROTEIN PRECURSOR (HUMAN); 5402 18384 31224 1.59 2.2E-01 5835974 NT Viclua chalybeala mitochondrion, complete genome 5403 18385 31225 1.32 2.2E-01 AL163300.2 NT Homo sapiens chromosome 21 segment HS21C100 5951 19018 32138 1.79 2.2E-01 5803002 NT Homo sapiens diaphanous (Drosophila, homolog) 2 (DIAPH2), transcript variant 156, mRNA 5962 19029 3.45 2.2E-01 D64000.1 NT Synechocystis sp. PCC6803 complete genome, 19/27, 2392729-2538999 6231 19285 32443 0.76 2.2E-01 U67087.1 NT Galius gailus T-box containing protein (Ch-TbxT) mRNA, complete cds 6231 19285 32444 0.76 2.2E-01 U67087.1 NT Galius gailus T-box containing protein (Ch-TbxT) mRNA, complete cds 7003 20030 33261 0.59 2.2E-01 AB038490.1 NT Homo sapiens gene for fukutin, complete cds 7105 20311 33572 0.45 2.2E-01 AA490106.1 EST_HUMAN ab02e09.s1 Stratagene fetal retina 937202 Homo sapiens cDNA clone IMAGE:839656 3' 7105 20311 33573 0.45 2.2E-01 AA490106.1 EST_HUMAN ab02e09.s1 Stratagene fetal retina 937202 Homo sapiens cDNA clone IMAGE:839656 3' 7372 20366 33635 8.36 2.2E-01 AV756238.1 EST_HUMAN AV756238 BM Homo sapiens cDNA clone BMFAHC06 5' Streptococcus pyogenes phosphotidylglycerophosphate synthase (ppsA) and ABC transporter ATP-binding 7489 20429 33708 1.58 2.2E-01 AF082738.1 NT protein (stpA) genes, complete cds; and unknown genes Page 93 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Aduit Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value Streptococcus pyogenes phosphotidylglycerophosphate synthase (pgsA) and ABC transporter ATP-binding 7489 20429 33709 1.58 2.2E-01 AF082738.1 NT protein (stpA) genes, complete cds; and unknown genes 7671 20605 33903 1.87 2.2E-01 M24136.1 NT Human glycophorin B gene, exon 4 7671 20605 33904 1.87 2.2E-01 M24136.1 NT Human glycophorin B gene, exon 4 7906 20831 34134 0.66 2.2E-01 AE000035.2 NT Mycoplasma pneumoniae M129 section 45 of 63 of the complets genome Homo sapiens homaobox B7(HOXB7) gene, partial cds; ans homeobox B6 (HOXB6), homeobox B5 8155 21062 34393 0.61 2.2E-01 AF287967.1 NT (HOXB5), homeobox B4 (HOXB40, and homechox B3 (HOXB3) genes, complete cds 8191 21098 34428 0.62 2.2E-01 AB024553.1 NT Bacillus haiodurans DNA, complete and partial cds, strain:C-125 8599 21530 2.43 2.2E-01 AF155143.1 NT Mus musculus nm23-M1 gene, promoter region 8667 21598 34938 0.75 2.2E-01 Z49933.1 NT E.col sepA and sepB genes 9115 22043 35399 0.63 2.2E-01 AJ132918.1 NT pan troglodytes MeCP2 gene 3"JTR 9439 22367 35728 0.57 2.2E-01 L23312.1 NT Mouse HD protein mRNA, complete cds 9439 22367 35729 0.57 2.2E-01 L23312.1 NT Mouse HD protein mRNA, complete cds 9453 22381 35743 4.62 2.2E-01 AE001713.1 NT Thermotoga maritima section 25 of 136 of the complete genome 9473 22401 35763 0.6 2.2E-01 U09964.1 NT Mus musculus ICR/Swiss glyceraldehyde 3-phosphate dehydrogenase (Gapd-S) gene, complete cds 9573 22500 2.97 2.2E-01 AW855039.1 EST_HUMAN PM3-CT0263-241299-009-b07 CT0263 Homo sapiens cDNA 9659 22585 35956 2.61 2.2E-01 8393247 NT Mus musculus deformed apidermal autoregulator factor 1 (Drosophila) (Deaf1), mRNA 9740 22664 36049 1.46 2.2E-01 BF376354.1 EST_HUMAN MR1-TN0045-110900-006-c02 TN0045 Homo sapiens cDNA 9829 22735 36117 1.49 2.2E-01 W02988.1 EST_HUMAN za04f08.r1 Soares melanocyte 2NbHM Homo sapiens cDNA clone IMAGE:291591 5' 9847 22955 36345 17.3 2.2E-01 P48634 SWISSPROT LARGE PROLINE-RICH PROTEIN BAT2 (HLA-B-ASSOCIATED TRANSCRIPT 2) 9890 22805 36193 0.81 2.2E-01 AJ009839.1 NT Xenopus laevis mRNA for kinesin-like protein 3 (xkip3) 9901 22889 36273 0.95 2.2E-01 7657428 NT Mus musculus osteoblast specific factor 2 (OSF-2), mRNA 9915 22903 36290 4.25 2.2E-01 M89643.1 NT Brachydanio rerio ependymin beta and gemma chains (Epd) gene, complete cds CYCLIC NUCLEOTIDE GATED CHANNEL, ROD PHOTORECEPTOR, ALPHA SUBUNIT (GNG 10147 23038 36437 0.66 2.2E-01 Q90980 SWISSPORT CHANNEL 3) (CNG-3) (CNG3) Funaira hygrometrioe chloroplst-looalized small heat chook protein (CPsHSP21) mRNA, complete cds; 10331 23220 36634 3.89 2.2E-01 AF197941.1 NT nuclear gene for chloroplast product 10460 23348 36765 2.15 2.2E-01 BF206507.1 EST_HUMAN 60186972F1 NIH_MGC_19 Homo sapiens cDNA clone IMAGE:4100189 5' 10673 23559 36691 1.18 2.2E-01 9625671 NT Human herpesvirus 5, complete genome Pseudomonas aeruginosa quinoprotein ethanol dehydrogenase (exaA) gene, partial cds; cytochrome c550 precursor (exaB), NAD+ dependent acetaldehyde dehydrogenease (exaC), and pyrroloquinoline quinone 10857 23743 37166 0.54 2.2E-01 AF068264.1 NT synthesis A (pqqA) genes, complete cds; and pyrroloquin> 10924 23809 0.7 2.2E-01 AF071001.1 NT Mus musculus PHR1 (Phr1) gene, patial cds Page 94 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Aduit Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 10968 23852 37277 0.59 2.2E-01 AE001562.1 NT Helicobacter pylori, strain J99 section 123 of 132 of the complete genome 10968 23852 37278 0.59 2.2E-01 AE001562.1 NT Helicobacter pylori, strain J99 section 123 of 132 of the complete genome 11652 24558 38028 1.46 2.2E-01 AB021083.1 NT TT virus ORF1 gene isolete TS4-II, partial cds 11854 24704 38195 5.43 2.2E-01 X01918.1 NT Drosophila 68C glue gene cluster 11893 23993 37432 3.94 2.2E-01 7706215 NT Homo sapiens H-2K binding factor-2(LOC51580), mRNA 12293 25104 2.1 2.2E-01 BE870959.1 EST_HUMAN 601446957F1 NIH_MGC_65 Homo sapiens cDNA clone IMAGE:3850670 5' Homo sapiens chromosome Xq28 melanoma antigen family A2a (MAGEA2A), melanoma antigen family A12 (MAGEA12), melanoma antigen family A2b (MAGEA2B),melanoma antigen family A3 (MAGEA3), caltractin 12392 26926 4.39 2.2E-01 U82671.2 NT (CALT), NAD(P)H dehydrogenase-like protein (NSDHL), and LI> 12468 25214 3.94 2.2E-01 AF188843.1 NT Vitis vinifera cultivar Pinot Noir plasma membrane aquapcrin (PIP1a)mRNA, complete cds 12567 18428 31352 3.91 2.2E-01 AW361098.1 EST_HUMAN RC1-CT0249-141199-021-g04 CT0249 Homo sapiens cDNA 12618 25305 31815 1.89 2.2E-01 11426873 NT Homo sapiens zinc finger protein 220 (ZNF220), mRNA 13042 25921 2.36 2.2E-01 Av694801.1 EST)HUMAN AV694801 GKC Homo sapiens cDNA clone GKCAGHB02 5' 997 14047 26991 1.65 2.2E-01 AA569289.1 EST_HUMAN nm31e11.s1 NCI_CGAP_Lip2 Homo sapiesn cDNA clone IMAGE:1061804 1000 14049 26933 1.18 2.2E-01 AL161504.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 16 1151 14192 2.58 2.2E-01 AE002314.2 NT Chiamydia muridarum, section 45 of 85 of the complete genome 1226 14263 27205 1.16 2.1E-01 6754299 NT Mus musculus interferon(alpha and beta) receptor 2 (infar2), mRNA 1226 14263 27206 1.16 2.1E-01 6754299 NT Mus musculus interferon(alpha and beta) receptor 2 (infar2), mRNA Mus musculus mas proto-oncogena and Igf2r gene for insulin-like growth factor type 2 and L41ps and Au76 1531 14561 27521 1.32 2.2E-01 AJ249895.1 NT pseudogenes ok73e02.s1 NCI_CGAP_CG4 Homo sapiens cDNA clone IMAGE:1519610 3' similar to gb:K02765 1930 14951 27927 1.7 2.2E-01 AA906824.1 EST_HUMAN COMPLEMENT C3 PRECURSOR (HUMAN); 2170 15182 28188 2.31 2.2E-01 BF695073.1 EST_HUMAN 602083129F1 NIH_MGC_81 Homo sapiens cDNA clone IMAGE:4247503 5' 2503 15925 28505 1.01 2.2E-01 H73968.1 EST_HUMAN yu04f07.s1 Soeres fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:232837 3' 2503 15925 28506 1.01 2.2E-01 H73968.1 EST_HUMAN yu04f07.s1 Soeres fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:232837 3' 2586 15584 28578 0.96 2.2E-01 AF022814.1 NT Fugu rubripes transcription factor (SLP-1) and heme-oxygenase genes, complete cds 2967 16019 28916 2.34 2.2E-01 6912445 NT Homo sapiens potassium voltage-gated channel, subfamily H (eag-related), member 4 (KCNH4), mRNA 3874 16903 7.46 2.2E-01 9838361 NT Beta vulgaris mitochondrion, complete genome 4139 17160 30036 1.04 2.2E-01 P11675 SWISSPROT IMMEDIATE-EARLY PROTEIN IE180 4139 17160 30037 1.04 2.2E-01 P11675 SWISSPROT IMMEDIATE-EARLY PROTEIN IE180 4348 17362 1.11 2.2E-01 AF124526.1 NT Prchestia cavimana calcium-binding proteim BP23 precursor (BP23) gene, complete cds 4483 1794 1.74 2.2E-01 AB033041.1 NT Homo sapiens mRNA for KIAA1215 protein, partial cds 4691 17696 30562 2.64 2.2E-01 AB010273.1 NT Homo saiens pshsp47 gene, complete cds Page 95 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Aduit Liver Probe Exon Most Similar Top Hit SEQ ID SEQ ID ORF SEQ Expression (Top) Hit Top Hit Acession Database Top Hit Descriptor NO: NO: ID NO: Signal BLASTE No. Source Value 4746 17751 30609 0.66 2.1E-01 X93161 NT P.falciparum mRNA for small GTPase rab11 5156 18149 30995 1.7 2.1E-01 D13557.1 NT Lampetra japonica mRNA for alpha-2-macroglobulin, complete cds 5395 18377 31219 1.12 2.1E-01 4557484 NT Homo sapiens ceruloplasmin (ferroxidase) (CP) mRNA 5414 18395 31232 0.76 2.1E-01 BE157936.1 ETS_HUMAN MR2-HT0377-070100-011-g08 HT0377 Homo sapiens cDNA 5464 18565 31409 6.2 2.1E-01 BF672595.1 ETS_HUMAN 602152001F1 NIH_MGC_81 Homo sapiens cDNA clone IMAGE: 4293001 5' 7214 20214 33461 1.1 2.1E-01 AJ223392.1 NT Doto fragilis mitochondrial 16S rRNA gene, partial 7226 20135 33375 2.05 2.1E-01 U04642.1 NT Human olfactory recaptor (OR1702) gene, partial cds 7805 20734 34036 0.67 2.1E-01 Q01956 SWISSPROT VOLTAGE-GATED POTASSIUM CHANNEL PROTEIN KV3.3 (KSHIIID) 7805 20734 34037 0.67 2.1E-01 Q01956 SWISSPROT VOLTAGE-GATED POTASSIUM CHANNEL PROTEIN KV3.3 (KSHIIID) 7818 20747 2.13 2.1E-01 AE000972.1 NT Archaeoglobus fulgidus section 135 of 172 of the complete genorne 8165 21072 34402 1.75 2.1E-01 AF000949.1 NT Canis familiaris keratin (KRT9) gene, complete cds 8218 21123 3455 1.3 2.1E-01 AF068687.1 NT Glycine max malate dehydrogenase (Mdh-2) gene, nuclear gene encoding mitochondrial protein, partial cds 8218 21123 3456 1.3 2.1E-01 AF068687.1 NT Glycine max malate dehydrogenase (Mdh-2) gene, nuclear gene encoding mitochondrial protein, partial cds 8285 2189 0.45 2.1E-01 T87354.1 ETS_HUMAN yd83b01.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:114793 5' 8650 21581 1.26 2.1E-01 7305030 NT Mus musculus erythrocyte protein band 4.1-like 3 (Epb4.1l3), mRNA Haemophilus influenzae hmcD, putative hasmocin processing protein (hmcC), putative ABC transporter (hmcB), putative haemocin structural protein (hmcA), and haemocin immunity protein (hmcl) genes, complete 9069 21998 35352 3.85 2.1E-01 U68399.1 NT cds 9355 2283 35644 0.94 2.1E-01 AL040537.1 ETS_HUMAN DKFZp434H0614_r1 434 (synonym: htes3) Homo sapiens cDNA clone DKFZp43H0614 5' 9355 2283 35645 0.94 2.1E-01 AL040537.1 ETS_HUMAN DKFZp434H0614_r1 434 (synonym: htes3) Homo sapiens cDNA clone DKFZp43H0614 5' 9589 22515 35877 6.8 2.1E-001 Z35786.1 NT S.cerevisiae chromosome II reading frame ORF YBL025w 10035 22935 36323 0.7 2.1E-01 N42536.1 ETS_HUMAN yy11e10.r1 Soares melanocyte 2NbHM Homo sapiens cDNA clone IMAGE:270964 5' 10035 22935 36324 0.7 2.1E-01 N42536.1 ETS_HUMAN yy11e10.r1 Soares melanocyte 2NbHM Homo sapiens cDNA clone IMAGE:270964 5' 10044 22960 36348 2.89 2.1E-01 X97378.1 NT A.thaliana mRNA for AtRanBP 1b protein 10144 23035 36433 0.97 2.1E-01 AB036529.1 NT Homo copiens p53R2 gene for ribonucleotide reductase, exon 6 10818 23704 37132 1.48 2.1E-01 Z97067.1 NT Beta vulgaris mRNA for elongation factor 1-beta DIACYLGLYCEROL KINASE, DELTA (DIGLYCERIDE KINASE) (DGK-DELTA) (DAG KINASE DELTA) 10846 23732 37155 2.12 2.1E-01 P52824 SWISSPROT (80 KD DIACYLGLYCEROL KINASE) 10853 23739 32162 0.84 2.1E-01 BF574254.1 ETS_HUMAN 602131427F1 NIH_MGC_81 Homo sapiens cDNA clone image:420831 5' 11918 24765 1.7 2.1E-01 AI141875.1 ETS_HUMAN qa66f08.x1 Soares_fetai_heart_NbHH19W Homo sapiens cDNA clone IMAGE: 1691751 3' 11996 24838 2.83 2.1E-01 11036647 NT Homo sapiens pancreatic polypeptide 2 (PPY2), mRNA 12011 24853 38354 2.01 2.1E-01 BE180422.1 ETS_HUMAN RC3-HT0622-040500-013-B11 HT0622 Homo sapiens cDNA Page 96 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Probe Exon Most Similar Top Hit SEQ ID SEQ ID ORF SEQ Expression (Top) Hit Top Hit Acession Database Top Hit Descriptor NO: NO: ID NO: Signal BLASTE No. Source Value 12230 25524 2.08 2.1E-01 X57624.1 NT Drosophila melanogaster ALA-E6 DNA, repeat region 12713 25364 1.45 2.1E-01 AF217490.1 NT Homo sapiens fragile 16D oxido reductase (FOR) gene, exons 8, 9, and partial cds 12956 25517 1.97 2.1E-01 BE622149.1 ETS_HUMAN 601440712F1 NIH_MGC_72 Homo sapiens cDNA clone IMAGE:3915675 5' 13067 25593 31725 1.51 2.1E-01 BE672330.1 ETS_HUMAN 7a59e02.x1 NCI_CGAP_GC6 Homo sapiens cDNA clone IMAGE:3223034 3' 213 13312 26230 1.93 2.0E-01 AB017437.1 NT Gallus gallus mRNA for avena, complete cds 557 13626 234 2.0E-01 7705601 NT Homo sapiens CGI-18 protein (LOC51008), mRNA 723 13781 26703 0.98 2.0E-01 M77085.1 NT O.cunniculus germline IgH heavy chain V-H pseudogene, allotype VHa2 836 13891 26828 1.97 2.0E-01 AF027865.1 NT Mus musculus Major Histocompatibility Locus class II region 1039 14085 27024 0.79 2.0E-01 D90905.1 NT Synechocystis sp. PCC8803 complete genome, 7/27, 781449-920915 1152 14193 27131 2.56 2.0E-01 AL163213.2 NT Homo sapiens chromosome 21 segment HS21C013 1282 14315 27264 1.45 2.0E-01 AJ32695.5 NT Homo sapiens rac1 gene 1334 14368 27318 1.4 2.0E-01 AW384937.1 ETS_HUMAN PM1-HT0422-291299-002-c06 HT0422 Homo sapiens cDNA 1479 14510 1.16 2.0E-01 AJ243957.1 NT Plum pox virus strain M. complete genome, isolate PS 1505 14536 E27499 9.31 2.0E-01 4503408 NT Homo sapiens dystrobrevin, alpha (DTNA), mRNA 1574 14604 27564 1.95 2.0E-01 AB007974.1 NT omo sapiens mRNA, chromosome 1 specific transcript KIAA0505 1579 14609 27570 1.13 2.0E-01 AF260700.1 NT Homo sapiens sodium/iodide symporter mRNA, partial cds 1723 14751 27719 1.33 2.0E-01 U22346.1 NT Human bradykinin B1 recepto (bradyb1) gene, complete cds 1746 14773 1.69 2.0E-01 AF111170.3 NT Homo sapiens 14q32 Jagged2 gene, complete cds; and unknown gene 1782 14808 2.69 2.0E-01 U67525.1 NT Methanococcus jannaschii section 67 of 150 of the complete genome 2370 15376 1.69 2.0E-01 X82877.1 NT H.sapiens Na+-D-glucose cotransport regulator gene 2932 15985 1.05 2.0E-01 AF074990.1 NT Homo sapiens full length insert cDNA YH85A11 HOMEOBOX PROTEIN GLABRA2 (HOMEOBOX-LEUCINE ZIPPER PROTEIN ATHB-10) (HD-ZIP 3546 16584 29489 0.86 2.0E-01 P46607 SWISSPROT PROTEIN ATHB-10) xp15b02.x1 NCI_CGAP_HN9 Homo sapiens cDNA clone IMAGE:2740395 3' similar to contains element 3628 16664 1.19 2.0E-01 AW238005.1 ETS_HUMAN MER21 repetitive element; 3770 16802 29689 0.84 2.0E-01 P34641 SWISSPROT CED-11 PROTEIN 4038 17065 29955 0.98 2.0E-01 Z46906.1 NT Sus scrofa 4114 17137 30011 0.85 2.0E-01 X83997.1 NT C.parasitica eapC gene Mus musouius neuronal apoptosis inhibitory protein 6 (Naip6) gene, complete cds; and Naip3 gene, exons 2-9 4538 17547 30408 0.66 2.0E-01 AF24243.1 NT and 11-16 4681 17686 7.99 2.0E-01 BE826165.1 ETS_HUMAN QV4-EN0032-190500-223-e03 EN0032 Homo sapiens cDNA 5154 18147 30992 0.81 2.0E-01 AA861824.1 ETS_HUMAN ak35h06.s1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1407995 3' 5154 18147 30993 0.81 2.0E-01 AA861824.1 ETS_HUMAN ak35h06.s1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1407995 3' 5170 18162 31010 8.09 2.0E-01 8922080 NT Homo sapiens hypothetical protein ASH1 (ASH1), mRNA Page 97 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Probe Exon Most Similar Top Hit SEQ ID SEQ ID ORF SEQ Expression (Top) Hit Top Hit Acession Database Top Hit Descriptor NO: NO: ID NO: Signal BLASTE No. Source Value HOMEOBOX PROTEIN GLABRA2 (HOMEOBOX-LEUCINE ZIPPER PROTEIN ATHE-10) (HD-ZIP 5201 16584 29489 0.66 2.0E-01 P46607 SWISSPROT PROTEIN ATHB-10) 6244 1823 31081 0.95 2.0E-01 Y19216.1 NT Homo sapiens putative psihHbD pseudogene for hair keratin, exons 1 to 9 qv10e02x1 NCI_CGAP_KidB Homo sapiens cDNA clone IMAGE:1981178 3' similar to glo:M16967 6358 18341 1.34 2.0E-01 AI274530.1 ETS_HUMAN COAGULATION FACTORV PRECURSOR (HUMAN); 5630 18706 31605 2.4 2.0E-01 X56600.1 NT Rat SOD-2 gene for manganese-containing superoxide dismtase 6944 19011 32130 2.06 2.0E-01 11432540 NT Homo sapiens dual oxidase-like domains 2 (DUOX2), mRNA 6054 19116 32245 0.78 2.0E-01 X91856.1 NT F.rubripes DNA encoding for valyl-tRNA synthetase 6295 19346 32514 6.15 2.0E-01 U15300.1 NT Saccharomyces cerevisiae Hal5p (HAL5) mRNA, complete cds 6415 19463 0.61 2.0E-01 M75967.1 NT Human hepatocyte growth factor gene, exon 1 6538 19581 32765 0.59 2.0E-01 P02467 SWISSPROT COLLAGEN ALPHA 2(I) CHAIN PRECURSOR 6697 19733 32934 4.07 2.0E-01 X61033.1 NT M.auratus mu class glutathione transferase gene 6808 19841 33052 3.82 2.0E-01 AW360865.1 ETS_HUMAN PM1-CT0247-141099-001-g06CT0247 Homo sapiens cDNA 7565 20502 33791 0.54 2.0E-01 U39724.1 NT Mycoplasma genitalium section 46 of 51 of the complete genome 7674 20608 33907 1.19 2.0E-01 AF250371.1 NT Mus musculus phosphofructokinase-1 C isozyme (Pfkc) gene, exons 3 through 7 7849 20776 34077 0.77 2.0E-01 P54422 SWISSPROT GAMMA-GLUTAMYLTRANSPEPTIDASE PRECURSOR 8248 21153 34488 0.64 2.0E-01 V00726.1 NT Mouse germ line gene coding for beta-globin (Y2 8369 21273 34606 5.19 2.0E-01 AK024427.1 NT Homo sapiens mRNA for FLJ00016 protein, partial cds 8531 21462 7.24 2.0E-01 AF028026.1 NT Andes virus strain OI23133 glycoprotein G1 and G2 precursor, gene, partial cds 8779 21709 35055 3.52 2.0E-01 X91151.1 NT M.musculus scp2 gene exon 14 9889 22804 36192 1.26 2.0E-01 U82511.1 NT Diclyostelium discoideum randorn slug cDNA19 prolein (rsc19) mRNA, partial cds 9927 22832 36219 0.69 2.0E-01 U71122.1 NT Arabidopsis pyruvate decarboxyfase-2 (Pdc2) gene, complete cds 10085 22878 6.64 2.0E-01 AE001278.1 NT Chlamydia trachomatis saction 5 of 87 of the complete genome 10266 23156 36566 0.53 2.0E-01 P11420 SWISSPROT DAUGHTERLESS PROTEIN 10266 23156 36567 0.53 2.0E-01 P11420 SWISSPROT DAUGHTERLESS PROTEIN 10403 23292 2.26 2.0E-01 AF146692.1 NT Homo sapiens filamin 2 (FLN2) mRNA, complete cds 10544 23430 36850 2.07 2.0E-01 AF086907.1 NT Arabiodopsis thaliana root gravitropism control protein (PIN2) gene, complete cds 10544 23430 36851 2.07 2.0E-01 AF086907.1 NT Arabiodopsis thaliana root gravitropism control protein (PIN2) gene, complete cds 10664 23550 36983 08 2.0E-01 AF157814.1 NT Homo sapiens cAMP specific phosphodiesterase (PDE4C) gene, exons 2 through 12 10664 23550 36984 08 2.0E-01 AF157814.1 NT Homo sapiens cAMP specific phosphodiesterase (PDE4C) gene, exons 2 through 12 10710 23596 0.85 2.0E-01 X78388.1 NT D.melanogaster DNA mobile element (hoppel) 10890 23775 37201 1.03 2.0E-01 X97121.1 NT R. norvegicus mRNA for NTR2 receptor 11278 24200 37652 2.76 2.0E-01 D89088.1 NT Salvelinus luvius mRNA for transferrin, complete cds 11278 24200 37653 2.76 2.0E-01 D89088.1 NT Salvelinus luvius mRNA for transferrin, complete cds Page 98 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Probe Exon Most Similar Top Hit SEQ ID SEQ ID ORF SEQ Expression (Top) Hit Top Hit Acession Database Top Hit Descriptor NO: NO: ID NO: Signal BLASTE No. Source Value 12213 25047 1.44 2.0E-01 P24873 SWISSPROT NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 6 nl68c12.s1 NCI_CGAP_Pr4.1 Homo sapiens cDNA clone IMAGE:1045846 similar to gb:M81105 MYOSIN 12223 25057 38556 45.65 2.0E-01 AA55919.1 ETS_HUMAN HEAVY CHAIN, NONMUSCLE TYPE A (HUMAN); 12691 25348 1.92 2.0E-01 AF206637.2 NT Pimephales promelas liver glucose-6-phosphate-1-dehydrogenase mRNA, partial cds 12872 25773 1.86 2.0E-01 AF302773.1 NT Homo sapiens ninein-Lm isoform (ninein) mRNA, complete cds 12885 25704 31661 2.56 2.0E-01 AW975297.1 ETS_HUMAN EST387405 MAGE resequences, MAGN Homo sapiens cDNA 12920 25530 31748 3.46 2.0E-01 AI023592.1 ETS_HUMAN ov80a10.s1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1643610 3' 12941 2550 15.98 2.0E-01 AF078164.2 NT Homo sapiens Ku70-binding protein (KUB3) mRNA, partial cds 114 13222 5.83 1.9E-01 7549743 NT Rattus norvegicus Aryl hydrocarbon receptor nuclear trans ocator 1 (Arnt1), mRNA 372 13459 26374 5.6 1.9E-01 AF004353.1 NT Mus musculus pale ear (ep) gene, wild type allele, 3' region, partial cds 679 13741 26655 1.15 1.9E-01 U32581.2 NT Homo sapiens lambda/ita protein kinase C-interacting protein mRNA, complete cds 679 13741 26656 1.15 1.9E-01 U32581.2 NT Homo sapiens lambda/ita protein kinase C-interacting protein mRNA, complete cds 686 13748 26663 4.55 1.9E-01 BE070801.1 ETS_HUMAN RC3-BT0502-251 199-011-d01 BT0502 Homo sapiens cDNA 687 13748 26663 6.39 1.9E-01 BE070801.1 ETS_HUMAN RC3-BT0502-251 199-011-d01 BT0502 Homo sapiens cDNA 1013 14062 3.84 1.9E-01 7305180 NT Mus musculus interleukin 2 receptor, gamma chain (112rg), mRNA 1131 14173 2711 5.97 1.9E-01 AA358813.1 ETS_HUMAN EST67784 Fetal lung II Homo sapiens cDNA 5' end 1397 14428 27382 1.72 1.9E-01 AF061282.1 NT Sorghum bicolor 22 kDa kafirin cluster 1455 14487 3.57 1.9E-01 AF184623.1 NT Plasmodium vivax reticulocyte binding protein-2 (rbp-2) gene, complete cds 2404 16409 28412 5.5 1.9E-01 8922533 NT Homo sapiens hypothetical protein FLJ10581 (FLJ10581), mRNA 2965 16017 28914 4.62 1.9E-01 U66066.1 NT Sigmodon hispidus p53 gene, partial cds 2980 16031 8.17 1.9E-01 J00922.1 NT Gallus gallus ovalbumin (Y) gene, complete cds 3045 16097 29000 0.97 1.9E-01 U25148.1 NT Rattus norvegicus brush border myosin-1 (BBMI) mRNA, partial cds Homo sapiens leukocyte immunoglobulin-like receptor, subfamily A (with TM domein), member 1 (LILRA1), 3441 16482 29390 0.82 1.9E-01 5803065 NT mRNA 3455 16496 29400 8.52 1.9E-01 D13197.1 NT Mouse gene for immunoglobulin diversity region D1 3539 16577 29481 6.95 1.9E-01 R16467.1 ETS_HUMAN yf42f10.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:129547 5' 3872 16901 29784 0.75 1.9E-01 AF264017.1 Rattus norvegicus arylacetamide deacetylase gene, complete cds 4078 17104 29983 4.85 1.9E-01 AB006784.1 NT Schlzosaccharomyces pombe DNA for cytoplasmic dynein heavy chain, complete cds 4171 17192 30064 2.05 1.9E-01 AW754106.1 ETS_HUMAN CM3-CT0315-271199-D45-b11 CT0315 Homo sapiens cDNA 4231 17247 0.98 1.9E-01 AE001912.1 NT Deinococcus radiodurans R1 section 49 of 229 of the complete chromosome 1 4331 17345 30210 1.12 1.9E-01 BE834943.1 ETS_HUMAN MR1-FN0010-290700-007-d04 FN0010 Homo sapiens cDNA 4581 17589 30450 0.76 1.9E-01 AL161493.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 5 4885 17884 30750 0.84 1.9E-01 Z93780.1 NT Fugu rubripes genes encoding carbamoyl phosphate synthetase III, myosin light chaln, MAP2 5134 18130 1.22 1.9E-01 AF223642.1 NT Rattus norvegicus chemokine receptor CXCR3 mRNA, complete cds Page 99 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Probe Exon Most Similar Top Hit SEQ ID SEQ ID ORF SEQ Expression (Top) Hit Top Hit Acession Database Top Hit Descriptor NO: NO: ID NO: Signal BLASTE No. Source Value xf29a07.x1 NCI_CGAP_Ut1 Homo sapiens cDNA clone IMAGE:2619444 3' similar to gb:M73779 RETINOIC 5798 18870 4.81 1.9E-01 AW130149.1 ETS_HUMAN ACID RECEPTOR ALPHA-1 (HUMAN); 5841 18912 32028 6.81 1.9E-01 AF127937.1 NT Homo sapiens DNA polymerase epsilon catalytic subunit protein (POLE1) gene, exon 1a 6053 19115 32244 0.63 1.9E-01 AF091216.1 NT Mus musculus Wrn protein (Wrn) gene, complete cds 6102 19163 2.78 1.9E-01 AU133116.1 ETS_HUMAN AU133116 NT2RP4 Homo sapiens cDNA clone NT2RP4001328 5' 6187 19244 0.57 1.9E-01 AE001299.1 NT Chlamydia trachomatis section 26 of 87 of the complete genome 6584 19625 32809 0.94 1.9E-01 AI762391.1 ETS_HUMAN wi54h02.x1 NCI_CGAP_Co16 Homo sapiens cDNA clone IMAGE:2394099 3' xf14c08.x1 NCI_CGAP_Kid8 Homo sapiens cDNA clone IMAGE:2618030 3' simllar to gb:X03559 ATP 6551 19690 32883 0.88 1.9E-01 AW148452.1 ETS_HUMAN SYNTHASE BETA CHAIN, MITOCHONDRIAL PRECURSOR (HUMAN); yg09a12.s1 Soares infant brain 1NIB Homo sapiens cDNA clone IMAGE:31663 3' similar to contains MER13 7311 18479 31302 1.77 1.9E-01 R43212.1 ETS_HUMAN repetitive element; 7315 18483 31307 0.57 1.9E-01 X68216.1 NT P. sativum PS-IAA4/5 gene 7341 20337 33602 0.83 1.9E-01 AF034920.1 NT Homo sapiens tubby like protein 1 (TULP1) gene, exons 9-11 7341 20337 33603 0.83 1.9E-01 AF034920.1 NT Homo sapiens tubby like protein 1 (TULP1) gene, exons 9-11 7633 20566 33863 0.59 1.9E-01 U73846.1 NT Drosophila melanogaster testis-specific RNA-binding protein (bruno) mRNA, complete cds Staphylococcus aureus toxic shock syndrome toxin-1 (tst), enterotoxin (ent), and integrase (int) genes, 7888 20814 34120 0.54 1.9E-01 U93688.1 NT complete cds 7913 20837 34140 1.13 1.9E-01 U80922.1 NT Arabidopsis thaliana serine/threchine protein phosphatase type one (TOPP8) gene, complete cds 7966 20888 34199 2.71 1.9E-01 AF072724.1 NT Zaa mays starch branching enzyme I (sbe1) gene, complete cds 8565 21496 34839 1.72 1.9E-01 AL161557.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 57 9244 22172 35526 13.86 1.9E-01 AB033024.1 NT Homo sapiens mRNA for KIAA1 198 protein, partial cds 9500 22428 35790 1.56 1.9E-01 M14568.1 NT Marsuplal cat beta-globin GENE mRNA, partial cds 9500 22428 35791 1.56 1.9E-01 M14568.1 NT Marsupial cat beta-globin gene mRNA, partial cds ol96g10.s1 NCI_CGAP_PNS1 Homo sapiens cDNA clone IMAGE:1537506 3' similar to contains Alu 10387 23276 36697 0.93 1.9E-01 AA912486.1 ETS_HUMAN repetitive element; 10736 23622 37053 0.91 1.9E-01 BE830353.1 ETS_HUMAN RC5-ET0082-060700-022-A02 ET0082 Homo sapiens cDNA 10736 23622 37054 0.91 1.9E-01 BE830353.1 ETS_HUMAN RC5-ET0082-060700-022-A02 ET0082 Homo sapiens cDNA 11088 24020 37461 2 1.9E-01 AL161503.2 NT Arabidopsie thaliana DNA chromosome 4, contig fragment No. 15 11088 24020 37462 2 1.9E-01 AL161503.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 15 Homo sapiens oslcium ohannel alpha1E subunit (CACNA1E) gene, exons 7-49, and partial cds, alternatively 11195 24121 37567 2.99 1.9E-01 AF223391.1 NT opliocd 11936 24780 38276 1.55 1.9E-01 M22253.1 NT Rattus norvegicus sodium channel mRNA, complete cds 12147 24987 38488 2.14 1.9E-01 AJ243213.1 NT Homo saplens partial 5-HT4 receptor gene, exons 2 to 5 12169 25005 38508 1.58 1.9E-01 L07344.1 NT Influenza A/Guangdong/243/72 nucleoprotein (seg 5) gene, 5' end Page 100 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLASTE No. NO: NO: Source Value 33 13149 26038 2.65 1.8E-01 U73200.1 NT Mus musculus p116Rip mRNA, complete cds 279 15871 26288 1.29 1.8E-01 AB022090.1 NT Mus musculus Cctg gene for chaperonin containing TCP-1 gamma subunit, partial cds Homo sapiens calcium channel, voltage-dependent, beta 2 subunit (CACNB2) mRNA, and translated 391 13475 26395 1.58 1.8E-01 4502532 NT products 770 13827 26758 0.81 1.8E-01 AB021490.2 NT Oryzias latipes gene for membrane guanylyl cyclase OIGC1, complete ods 1009 14058 27000 0.8 1.8E-01 AI912212.1 EST_HUMAN wd71f02.x1 NCI_CGAP_Lu24 Homo sapiens cDNA clone IMAGE:2337051 3' 1118 14159 27097 1.46 1.8E-01 AF000580.1 NT Dictyostelium discoideum plasmid Ddp5, complete genome 1315 14348 27295 7.91 1.8E-01 AL117189.1 NT Yersinia pestis plasmid pCD1 qg22d10.x5 NCI_CGAP_Kid3 Homo sapiens cDNA clone IMAGE:1761811 3' similar to TR:O75936 O75936 1889 14910 1.15 1.8E-01 AI733708.1 EST_HUMAN GAMMA BUTYROBETAINE HYDROXYLASE; Mus musculus Scya6, Scya9, Scya16-ps, Scya5 genes for small inducible cytokine A6 precursor, small 1931 14952 27028 1.54 1.8E-01 AB061897.1 NT inducible cytokine A9 precursor, Scya16 pseudogene, small inducible cytokine A5 precursor, complete cds 2742 15735 2.61 1.8E-01 AW935728.1 EST_HUMAN QV3-DT0018-081299-036-g04DT0018 Homo sapiens cDNA 2940 15993 1.86 1.8E-01 AF184589.1 NT Jonopsidium acalue LEAFY protein (LEAFYZ) gene, partial cds 2947 15999 28901 1.18 1.8E-01 AW182300.1 EST_HUMAN xj41a03.x1 Soeres_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2659756 3' 3169 16219 29109 1.07 1.8E-01 AW995178.1 EST_HUMAN QV0-BN0041-070300-147-c04 BN0041 Homo sapiens cDNA 3423 16464 29371 0.99 1.8E-01 BF183582.1 EST_HUMAN 6D1809723R1 NIH_MGC_18 Homo sapiens cDNA clone IMAGE:4040621 3' yj45e01.s1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE:151704 3' similar to contains Alu 3687 16720 29612 0.86 1.8E-01 H03369.1 EST_HUMAN repetitive element; yj45e01.s1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE:151704 3' smiliar to contains Alu 3687 16720 29613 0.86 1.8E-01 H03369.1 EST_HUMAN repetitive element; 4345 17359 30224 1.01 1.8E-01 AJ271735.1 NT Homo sapiens Xq pseudoautosomal region; segment 1/2 4441 17452 0.99 1.8E-01 D37954.1 NT Bovine NB25 mRNA for MHC ciass II (BoLA-DQB), complete cds 4671 17676 30545 6.57 1.8E-01 AL161556.2 NT Arabldopsis thallana DNA chromosome 4, contig fragment No. 56 Mus musculus Scya6, Scya9, Scya16-ps, Scya5 genes for small inducible cytokine A6 precursor, small 4886 17885 30751 2.43 1.8E-01 AB051897.1 NT inducible cytokine A9 precursor, Scya16 pseudogene, small inducible cytokine A5 precursor, complete cds 5177 18169 31014 1.77 1.8E-01 AW814270.1 EST_HUMAN MR3-ST0203-151299-112-g06 ST0203 Homo sapiens cDNA 5230 18218 31065 1.04 1.8E-01 AF181258.1 NT Mesocrietus auratuc Na-taurocholate cotranoporting polypeptide mRNA, partial ods 5259 18245 31096 1.16 1.8E-01 AI439881.1 EST_HUMAN tif57e04.x1 NCI_CGAP_Lym12 Homo sapiens cDNA clone IMAGE:2134590 3' 5324 18308 31158 0.71 1.8E-01 AL161559.2 NT Arabidopsis thaliana DNA chromosome 4, conting fragment No. 59 5481 18562 31406 0.56 1.8E-01 BE082626.1 EST_HUMAN RC6-BT0-0641-300300-011-H03 BT0641 Homo sapiens cDNA 6019 19081 32207 1.05 1.8E-01 AL161594.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 90 Page 101 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLASTE No. NO: NO: Source Value 6149 19208 32347 0.88 1.8E-01 N28629.1 EST_HUMAN yx38h08.r1 Soares melanocyte 2NBHM Homo sapiens cDNA clone IMAGE:264063 5' 6368 19417 32582 1.05 1.8E-01 6678428 NT Mus musculus Tnf receptor-associated factor 6 (Traf6), mRNA 6368 19417 32583 1.05 1.8E-01 6678428 NT Mus musculus Tnf receptor-associated factor 6 (Traf6), mRNA 6790 19823 33035 1.39 1.8E-01 Q9QY14 SWISSPROT FORKHEAD BOX PROTEIN E3 6839 19871 2.26 1.8E-01 N94853.1 EST_HUMAN yy62h02r1 Soares_multiple_sclerosis_2NbHMSP Homo sapiens cDNA clone IMAGE:278163 5' 7186 20186 0.48 1.8E-01 11430157 NT Homo sapiens KIAA0173 gene product (KIAA0173), mRNA 7350 20345 33613 1.04 1.8E-01 AB018561.1 NT Citrullus lanatus mRNA for wsus, complete cds 7350 20346 33614 1.04 1.8E-01 AB018561.1 NT Citrullus lanatus mRNA for wsus, complete cds 7410 20109 33343 0.67 1.8E-01 BE961353.1 EST_HUMAN 601648361R2 NIH_MGC_62 Homo sapiens cDNA clone IMAGE:3932247 3' 7850 20777 34078 0.67 1.8E-01 AP001511.1 NT Basllius halodurans genomic DNA, section 5/14 9881 22796 36182 1.18 1.8E-01 M73258.1 NT Human cellular DNA/Human papillomavirus proviral DNA 9913 22901 36288 1.76 1.8E-01 9626232 NT Bacteriophage lke, complete genome nh02a05.s1 NCI_CGAP_Thy1 Homo sapiens cDNA clone IMAGE:943088 similer to containe L1.13 L1 10024 22924 0.63 1.8E-01 AA493751.1 EST_HUMAN repetitive element; 10103 22994 36389 1.07 1.8E-01 P15272 SWISSPROT AMP NUCLEOSIDASE 10103 22994 36390 1.07 1.8E-01 P15272 SWISSPROT AMP NUCLEOSIDASE 10141 23032 36428 0.96 1.8E-01 M26019.1 NT S.ccmmune orotidine-5'-phosphate decarboxylase (URA1) gene, complete cds 10141 23032 36429 0.96 1.8E-01 M26019.1 NT S.ccmmune orotidine-5'-phosphate decarboxylase (URA1) gene, complete cds 10298 23188 36599 0.76 1.8E-01 P08123 SWISSPROT COLLAGEN ALPHA 2(I) CHAIN PRECURSOR 10302 23192 36603 0.76 1.8E-01 U67548,.1 NT Methanoccoccus jannaschii section 90 fo 150 of the complete genome Aquarius amplus cytochrome oxidase subunit I (COI) gene, partial cds; mitochondrial gene for mitochondrial 10632 23518 0.84 1.8E-01 AF200252.1 NT product 10855 23741 37164 1.52 1.8E-01 X63440.1 NT M.musculus mRNA for P19-protein tyrosine phosphatase 11082 24014 37456 3.41 1.8E-01 X77336.1 NT A.thaliena mRNA for ribonucleotide reductase R2 11121 24051 37496 5.92 1.8E-01 U38906.1 NT Basteriophage r1t integrase, repressor protein (rro), dUTPase, holin and lysin genes, complete cds 11177 20346 33613 3.11 1.8E-01 AB018561.1 NT Citrullus lanatus mRNA for wsus, complete cds 11177 20346 33614 3.11 1.8E-01 AB018561.1 NT Citrullus lanatus mRNA for wsus, complete cds 11178 24104 37551 5.51 1.8E-01 AF019107.1 NT Dictyostelium discoideum unknow (DG1041) gene, complete cds 11457 24372 37820 3.47 1.8E-01 M59257.1 NT Human carcinoembryonic antigen (CEA) gene, exon 4 11894 23994 37433 3.87 1.8E-01 X57033.1 NT B.laurus mRNA for potassium channel 12178 25014 38519 2.19 1.8E-01 8394421 NT Ratt.is norvegicus Thromboxane receptor (Tbxa2r), mRNA 12322 25123 2.09 1.8E-01 10086561 NT Bovine sphemeral fever virus, complete genome 12804 25428 4.9 1.8E-01 Q96682 SWISSPROT DNA TERMINAL PROTEIN (BELLETTPROTEIN)(PTP PROTEIN) Page 102 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLASTE No. NO: NO: Source Value 12912 25495 20.38 1.8E-01 R24494.1 EST_HUMAN yh48h10.r1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE:133027 5' 12951 25514 2.7 1.8E-01 Y11114.1 NT E.dispar mRNA for hexokinase (hxk1) 599 13666 26668 2.03 1.7E-01 BE385164.1 EST_HUMAN 601274604F1 NIH_MGC_20 Homo sapiens cDNA clone IMAGE:3615768 5' 831 13886 26824 2.18 1.7E-01 X53330.1 NT P.dumerllil histone gene cluster for core histones H2A, H2B, H3 and H4 987 14038 1.61 1.7E-01 P35616 SWISSPROT NEUROFILAMENT TRIPLET LPROTEIN (NEUROFILAMENT LIGHT POLYPEP TIDS)(NF-L) 1085 14129 27066 0.82 1.7E-01 AF081810.1 NT Lymantria dispar nucleopolyhedrovirus, complete genome 1085 14129 27067 0.82 1.7E-01 AF081810.1 NT Lymantria dispar nucleopolyhedrovirus, complete genome 1839 14862 27844 0.92 1.7E-01 AL161573.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 69 1998 15016 2.77 1.7E-01 AF255051.1 NT Homo sapiens BNIP3H (BNIP3H) gene, complete cds; nuclear gene for mitochondrial product Vibrio cholerae hypoxanthine phosphoribosyltransferase (hpt) gene, partial cds, hemagglutinin/protease 2902 15956 28855 2.06 1.7E-01 AF000716.1 NT regulatory protein (hapR) gene, complete cds, and YRAL VIBCO gene, partial cds Vibrio cholerae hypoxanthine phosphoribosyltransferase (hpt) gene, partial, cds, hemagglutinin/protease 2902 15956 28856 2.06 1.7E-01 AF000716.1 NT regulatory protein (hapR) gene, complete cds, and YRAL VIBCO gene, partial cds 2969 16021 28919 1.83 1.7E-01 AA336909.1 EST_HUMAN EST41651 Endometrial tumor Homo sapiens cDNA 5' end 3040 16092 28994 1.2 1.7E-01 AJ238736.1 NT Naja naja atra ctx-1 gene, exons 1-3 3040 16092 28995 1.2 1.7E-01 AJ238736.1 NT Naja naja atra ctx-1 gene, exons 1-3 3152 16202 29093 2.18 1.7E-01 AF081514.1 NT Taxus canadensis geranylgeranyl diphosphate synthase mRNA, complete cds 3422 16463 29370 0.78 1.7E-01 N55763.1 EST_HUMAN J2346F Human fetal heart, Larnbda ZAP Express Homo sapiens cDNA clone J2346 5' Anabaena sp. ORF4 (partial), ORF3, ORF2, ORF1, acipA gene, adpB gene, adpC gene, adpD gene, adpE 3507 16545 29445 2.08 1.7E-01 AJ269505.1 NT gene and adpF gene 3672 16705 29697 1.11 1.7E-01 AJ224877.1 NT Homo sapiens hap1 gene, complete CDS 3692 16725 1.11 1.7E-01 5031886 NT Homo sapiens LIM domain-containing preferred translocation pertner in lipoma (LPP) mRNA Homo sapiens derivative 11 breakpoint fragment; partial intorn 10 of the ALL-1/MLL/HRX gene fused to intron 4015 17042 29932 6.66 1.7E-01 AJ235377.1 NT 5 of the AF-4/FEL gen 4675 17680 1.86 1.7E-01 X52936.1 NT Schistocerca gregaria alpha repetive DNA qh57e09.x1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:1848808 3' similar to 4953 17951 30809 1.75 1.7E-01 AI247635.1 EST_HUMAN contains OFR.b1 OFR repetitive element; 5298 18282 31132 1.57 1.7E-01 X17012.1 NT Rat IGFII gene for insulin-like growth factor II 5298 18282 31133 1.57 1.7E-01 X17012.1 NT Rat IGFII gene for insulin-like growth factor II 5313 18297 31150 0.7 1.7E-01 BF030010.1 EST_HUMAN 601557256F1 NIH_MGC_58 Homo sapiens cDNA clone IMAGE:3827197 5' ne13a02.s1 NCI_CGAP_Co3 Homo sapiens cDNA clone IMAGE:881066 3' simiklar to gb:M17886 60S 5593 18669 31547 1.9 1.7E-01 AA470686.1 EST_HUMAN ACIDIC RIBOSOMAL PROTEIN P1 (HUMAN); Page 103 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLASTE No. NO: NO: Source Value ne13a02.s1 NCIP_CGAP_Co3 Homo sapiens cDNA clone IMAGE:881066 3' similar to gb:M17886 60S 5593 18669 31548 1.9 1.7E-01 AA470686.1 EST_HUMAN ACIDIC RIBOSOMAL PROTEIN P1 (HUMAN); 5787 18859 31967 0.75 1.7E-01 U43599.1 NT Brugiapahangi microfilarial sheath protein SHP3 (shp3) gene, complete cds 6586 19627 32810 15.24 1.7E-01 H72118.1 EST_HUMAN ys02g06.s1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:213658 3' 6615 19656 0.49 1.7E-01 AJ235270.1 NT Rickettsia prowazekii strain Madrid E, complete genome; segment 1/4 6650 19689 32881 0.69 1.7E-01 AI370976.1 EST_HUMAN ta29c11.x1 Soares_fetal_lung_NbHL19W Homo sapiens cDNA clone IMAGE:2045492 3' 6650 19689 32882 0.69 1.7E-01 AI370976.1 EST_HUMAN ta29c11.x1 Soares_fetal_lung_NbHL19W Homo sapiens cDNA clone IMAGE:2045492 3' 7172 18444 31313 0.61 1.7E-01 BE300286.1 EST_HUMAN 600944067T1 NIH_MGC_17 Homo sapiens cDNA clone IMAGE:2960248 3' 7206 20206 2.1 1.7E-01 AF026552.3 NT Mesocricetus auratus oviductin precursor (OVI) gene, complete cds 7344 20340 0.63 1.7E-01 Z92910.1 NT Homo sapiens HFE gene 7589 20525 33814 1.46 1.7E-01 AP000422.1 NT Escherichia coli O157:H7 genomic DNA, Sakai-VT2 prophage inserted region 7677 20611 33910 10.98 1.7E-01 BE734179.1 EST_HUMAN 601559022F1 NIH MGC 21 Homo sapiens cDNA clone IMAGE:3843964 5' 7900 20826 34130 1.25 1.7E-01 P16724 SWISSPROT PROBABLE PROCESSING AND TRANSPORT PROTEIN UL56 (HFLF0 PROTEIN) 7918 25679 34144 0.68 1.7E-01 Q01955 SWISSPORT COLLAGEN ALPHA 3(IV) CHAIN PRECURSOR 8341 21246 34580 0.41 1.7E-01 BF326962.1 EST_HUMAN QV3-BN0047-020800-284-d08 BN0047 Homo sapiens cDNA 8341 21246 34581 0.41 1.7E-01 BF326962.1 EST_HUMAN QV3-BN0047-020800-284-d08 BN0047 Homo sapiens cDNA 8367 21271 34605 0.44 1.7E-01 AL114656.1 NT Botrytic cinerea strain T4 cDNA library under conditions of nitrogen deprivation 8443 21375 34715 1.47 1.7E-01 AF000573.1 NT Homo sapiens homogentisate 1,2-dioxygenase gene, complete cds 8541 21472 34813 0.84 1.7E-01 AF150669.1 NT Pseudomonas putida long-chain-fatty-acid-CoA ligase (fadD) gene, complete cds 8853 21783 35130 6.01 1.7E-01 7706426 NT Homo sapiens cleavage and polyadenylation specificity factor 3, 73kD subunit (CPSF3), mRNA 8853 21783 35131 6.01 1.7E-01 7706426 NT Homo sapiens cleavage and polyadenylation specificity factor 3, 73kD subunit (CPSF3), mRNA 9255 22183 35538 0.54 1.7E-01 AW992873.1 EST_HUMAN RC2-BN0032-120200-011-a10 BN0032 Homo sapiens cDNA 9287 22215 35573 2.31 1.7E-01 D00384.1 NT Rat (SHR strain) SX1 gene 9403 22331 35693 1 1.7E-01 AF217413.1 NT Homo sapiens neuroligin 3 isoform gene, complete cds, alternatively spliced 9403 22331 35694 1 1.7E-01 AF217413.1 NT Homo sapiens neuroligin 3 isoform gene, complete cds, alternatively spliced 9549 22476 35834 0.56 1.7E-01 R77002.1 EST_HUMAN yi66g02.r1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE:144242 5' 10118 23009 36405 10.51 1.7E-01 AP001508.1 NT Bacillus halodurane genomic DNA, section 2/14 10220 23111 36512 0.54 1.7E-01 AW977455.1 EST_HUMAN EST389564 MAGE resequences, MAGO Homo sapiens cDNA 10220 23111 36513 0.54 1.7E-01 AW977455.1 EST_HUMAN EST389564 MAGE resequences, MAGO Homo sapiens cDNA 10237 23128 36531 2.6 1.7E-01 U16288.1 NT Human class IV alcohol dehydrogenase (ADH7) gene, exon 3 10324 23213 36625 0.92 1.7E-01 AJ251749.1 NT Drosophila melanogaster mRNA for serine protease inhibitor (serpin-6),(sp6 gene) 10728 23614 2.47 1.7E-01 AL163284.2 NT Homo sapiens chromosome 21 segment HS21C084 Homo sapiens soulte carrier family 7 (cationic amino acid transporter, y+ system), member 2 (SLC7A2), 10880 23765 37190 1.28 1.7E-01 11427203 NT mRNA Page 104 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLASTE No. NO: NO: Source Value nq60e07.s1 NCI_CGAP_Co9 Homo sapiens cDNA clone IMAGE:1148292 3' similar to gb:L25081 10881 23766 37191 1.66 1.7E-01 AA627972.1 EST_HUMAN TRANSFORMING PROTEIN RHOC (HUMAN); 11123 24053 37499 7.92 1.7E-01 BE390835.1 EST_HUMAN 601286547F1 NIH_MGC_44 Homo sapiens cDNA clone IMAGE:3613258 5' 11245 24169 37616 2.42 1.7E-01 AA814617.1 EST_HUMAN gf43a03.e1 NCI_CGAP_CNS1 Homo sapiens cDNA clone IMAGE:426924 3' 11552 24461 37924 9.7 1.7E-01 7106300 NT Mus musculus adenomatosis polyosis coli binding protein Eb1 (Eb1), mRNA 11552 24461 37925 9.7 1.7E-01 7108300 NT Mus musculus adenomatosis polyosis coll binding protein Eb1 (Eb1), mRNA 11636 24542 98016 2.25 1.7E-01 Y08391.1 NT S.pombe pop1+ gene 11814 24735 38226 2.11 1.7E-01 AA883375.1 EST_HUMAN al45f09.s1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:1460297 3' 12134 24975 1.42 1.7E-01 P15272 SWISSPROT AMP NUCLEOSIDASE IGG RECEPTOR FCRN LARGE SUBUNIT P51 PRECURSOR (FCRN)(NEONATAL FC RECEPTOR) 12166 25002 38503 1.49 1.7E-01 P55899 SWISSPROT (IGG FC FRAGMENT RECEPTOR TRANSPORTEN, ALPHA CHAIN) IGG RECEPTOR FCRN LARGE SUBUNIT P51 PRECURSOR (FCRN)(NEONATAL FC RECEPTOR) 12166 25002 38504 1.49 1.7E-01 P55899 SWISSPROT (IGG FC FRAGMENT RECEPTOR TRANSPORTEN, ALPHA CHAIN) 12235 25064 38566 3.57 1.7E-01 11418157 NT Homo sapiens calcium channel, voltage-dependent, alpha 1I subunit (CACNA1I), mRNA. tx69g05.x1 NCI_CGAP_Ut1 Homo sapiens cDNA clone IMAGE:2274872 3' ismilar to gb:M73779 RETINOIC 12607 25737 1.47 1.7E-01 AI824404.1 EST_HUMAN ACID RECEPTOR ALPHA-1 (HUMAN); 12280 25477 31763 8.17 1.7E-01 U01317.1 NT Human beta globin region on chromosome 11 13097 25850 1.48 1.7E-01 AJ011763.1 NT Bos taurus prostayclin receptor gene, 5'UTR 130 13234 26151 1.48 1.6E-01 Af217532.1 NT Homo sapiens mevalonate kinase gene, exon 6 and 7 703 15846 26679 1.14 1.6E-01 R31497.1 EST_HUMAN hy75f12.r1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE:135599 5' 1523 14554 27515 1.52 1.6E-01 AA548863.1 EST_HUMAN nk28d12.s1 NCI_CGAP_Co11 Homo sapiens cDNA clone IMAGE:1014839 3' 1544 14574 27534 3.98 1.6E-01 AF298117.1 NT Homo sapiens homeobox protein OTX2 gene, complete cds 1939 14960 27938 1.56 1.6E-01 P22063 SWISSPROT AXONIN-1 PRECURSOR (AXONAL GLYCOPROTEIN TAG-1) 2001 15019 1.11 1.6E-01 U10334.1 NT Crassostrea gigas RNA polymerase II largest subunit mRNA, partial cds 2408 15923 28416 1.13 1.6E-01 X94232.1 NT H.sapiens mRNA for novel T-cell activation protein 2516 15517 28521 1.85 1.6E-01 AB037729.1 NT Homo sapiens mRNA for KIAA1308 protein, partial cds 2934 15987 28886 16.49 1.6E-01 AF185589.1 NT Homo sapiens cytochrome P450 3A4 (CYP3A4) gene, promoter region 2934 15987 28887 16.49 1.6E-01 AF185589.1 NT Homo sapiens cytochrome P450 3A4 (CYP3A4) gene, promoter region 3408 16450 29357 0.98 1.6E-01 AF062643.1 NT Danio rerio Pim 1 mRNA, complete cds 3657 15019 1.22 1.6E-01 U10334.1 NT Crassostrea gigas RNA polymcrase II largest subunit mRNA, partial cds 3700 16732 29622 1.11 1.6E-01 AJ003165.1 NT Populus trichocarpa cv. Trichobel ABI3 gene 3700 16732 29623 1.11 1.6E-01 AJ003165.1 NT Populus trichocarpa cv. Trichobel ABI3 gene 3840 16869 29753 1.5 1.6E-01 AE000962.1 NT Archaeoglobus fulgidus section 145 of 172 of the complete genome 4086 17111 2.69 1.6E-01 AG004413.1 NT Vibrio cholerae chromosome II, section 70 of 93 of the complete chromosome Page 105 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 4117 17140 30013 0.98 1.6E-01 AF084466.1 NT Crithidia fasciculata tryparedocin I (txnl) gene, complete cds 4396 17409 1.11 1.6E-01 U62771.1 NT Lymnaea stagnalis octopamine receptor type 1 (Lym oa1) mRNA, complete cds 4436 17447 30307 15.13 1.6E-01 AF179680.1 NT Homo sapiens apelin gene, complete cds 4567 17575 3.62 1.8E-01 AW968601.1 EST_HUMAN EST380677 MAGE resequences, MAGJ Homo sapiens cDNA 4575 17583 5.22 1.6E-01 6753319 NT Mus musculus chaperonin subunit 3 (gamma) (Cd3), mRNA 4816 17817 30684 0.74 1.6E-01 AF100154.1 NT Raltus norvegicus kynurenine aminotransferase/glutamine transaminase K (Kat) gene, complete cds 4816 17817 30685 0.74 1.6E-01 AF100154.1 NT Raltus norvegicus kynurenine aminotransferase/glutamine transaminase K (Kat) gene, complete cds MICRONUCLEAR LINKER HISTONE POLYPROTEIN (MIC LH) [CONTAINS: LINKER HISTONE 5035 18032 30889 0.74 1.6E-01 P40631 SWISSPROT PROTEINS ALPHA, BETA, DELTA AND GAMMA] zi84h09.s1 Stratagene colon (#937204) Homo sapiens cDNA clone IMAGE:511361 3' similar to TR:E221955 5059 18056 30908 1.69 1.6E-01 AA088343.1 EST_HUMAN E221955 38,855 BP SEGMENT OF CHROMOSOME XIV.; 5086 18083 30933 1.39 1.6E-01 AJ006356.1 NT Lycopersion esculentum Rsal fregment 2, setellits region 5086 18083 30934 1.39 1.6E-01 AJ006356.1 NT Lycopersion esculentum Rsal fregment 2, setellits region bb83h08.y1 NIH_MGC_10 Homo sapiens cDNA clone IMAGE:3049023 5' similar to gb:M61715 5161 18154 31001 0.95 1.6E-01 BE018707.1 EST_HUMAN TRYPTOPHANYL-TRNA SYNTHETASE (HUMAN); gh:X69657 M.musculus (MOUSE); 5192 18184 31027 1.02 1.6E-01 AI017141.1 EST_HUMAN ov34c05.x1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE: 1639208 3' 5572 18650 31529 0.88 1.6E-01 L40608.1 NT Plasmodium falciparum (strain Dd2) variant-specific surface protein (var-1) gene, complete cds xm43f01.x1 NCI_CGAP_GC6 Homo sapiens cDNA clone IMAGE:2686969 3' similar to TR:O75984 O75984 5712 18785 31715 2.52 1.6E-01 AW197498.1 EST_HUMAN HYPOTHETICAL 127.6 KD PROTEIN; xm43f01.x1 NCI_CGAP_GC6 Homo sapiens cDNA clone IMAGE:2686969 3' similar to TR:O75984 O75984 5712 18785 31716 2.52 1.6E-01 AW197498.1 EST_HUMAN HYPOTHETICAL 127.6 KD PROTEIN; 5724 18797 31889 2.17 1.6E-01 AF034716.1 NT Rattus norvegicus CCAAT/enhancer binding protein epsilon (cebpe) gene, complete cds 6261 19312 32477 0.86 1.6E-01 BE925803.1 EST_HUMAN RC3-BN0034-310800-113-h01 BN0034 Homo sapiens cDNA 6505 19549 32728 0.55 1.6E-01 BF183584.1 EST_HUMAN 601809725R1 NIH_MGC_18 Homo sapiens cDNA clone IMAGE:4040335 3' 6505 19549 32729 0.55 1.6E-01 BF183584.1 EST_HUMAN 601809725R1 NIH_MGC_18 Homo sapiens cDNA clone IMAGE:4040335 3' 6696 19732 32932 1.77 1.6E-01 AL161588.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 84 6696 19732 32933 1.77 1.6E-01 AL161588.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 84 7090 20296 33556 0.57 1.6E-01 AA398047.1 EST_HUMAN zi89d04.r1 Soarcs_testis_NHT Homo sapiens cDNA clone IMAGE:729511 5' 7110 20314 33577 0.7 1.6E-01 AB046786.1 NT Homo sapiens mRNA for KIAA1566 protein, partiel cds 7162 20269 0.54 1.6E-01 BF683630.1 EST_HUMAN 602139855F1 NIH_MGC_45 Homo sapiens cDNA clone IMAGE:4301004 5' 7300 18469 31291 4.25 1.6E-01 AW291215.1 EST_HUMAN UI-H-BI2-agi-b-06-0-UI.s1 NCI_CGAP_Sub4 Homo sapiens cDNA clone IMAGE:2724418 3' 7680 20614 33913 0.57 1.6E-01 Z49632.1 NT S.cerevisiae chromosome X reading frame ORF YJR132w Page 106 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 8250 21155 34489 1.28 1.6E-01 AW246359.1 EST_HUMAN 2822248.5prime NIH_MGC_7 Homo sapiens cDNA clone IMAGE:2822248 5' 8296 21200 34536 0.55 1.6E-01 6753237 NT Mus musculus Ca<2+>dependent activator protein for secretion (Cadps), mRNA 8311 21215 0.45 1.6E-01 AU136525.1 EST_HUMAN AU136525 PLACE1 Homo sapiens cDNA clone PLACE1004466 5' 8450 21382 34724 1.68 1.6E-01 L49349.1 NT Gorilla gorilla androgen receptor gene, partial exon TCBAP1E0607 Pediatric pre-B cell acute lymphoblastic leukemia Baylor-HGSC project=TCBA Homo sapiens 8603 21534 0.75 1.6E-01 BE244087.1 EST_HUMAN cDNA clone TCBAP0607 Bacteroides vulgatus beta-lactamase (cfxA) gene, complete cds and mobilization protein (mobA) gene, 8696 21627 34971 0.75 1.6E-01 U38243.1 NT complete cds 9191 22119 35475 1.12 1.6E-01 Z99119.1 NT Bacilus subtilis complete genome (section 16 of 21); from 2997771 to 3213410 9385 22313 35675 1.03 1.6E-01 R13673.1 EST_HUMAN yf60h08.r1 Soares infant brain 1NIB Homo sapiens cDNA clone IMAGE:26873 5' 9488 22416 0.78 1.6E-01 L36861.1 NT Homo sapiens guanylate cyclase activating protein (GCAP) gene exons 1-4, complete cds 9523 22450 35813 2.14 1.6E-01 Z49501.1 NT S.cerevisiae chromosome X reading frame ORF YJR001W 9655 22581 0.77 1.6E-01 AF111167.2 NT Homo sapiens jun dimerizetion protein gene, partiel cds; cfoe gene, complete cds; and unknown gene 10177 23068 2.24 1.6E-01 BF375171.1 EST_HUMAN RC3-ST0200-041199-011-h01 ST0200 Homo sapiens cDNA 10179 23070 36469 2.25 1.6E-01 Z49501.1 NT S.cerevisiae chromosome X reading frame ORF YJR001w 10213 23104 1.17 1.6E-01 BE155664.1 EST_HUMAN PM2-HT0363-270100-004-f11 HT0353 Homo sapiens cDNA 11100 24031 37476 3.05 1.6E-01 AW850853.1 EST_HUMAN IL3-CT0220-111199-028-G01 CT0220 Homo sapiens cDNA 11434 24350 37796 8.89 1.6E-01 O14647 SWISSPROT CHROMODOMAIN-HELICASE-DNA-BINDING PROTEIN 2 (CHD-2) 11434 24350 37797 8.89 1.6E-01 O14647 SWISSPROT CHROMODOMAIN-HELICASE-DNA-BINDING PROTEIN 2 (CHD-2) 11439 24355 37803 1.52 1.6E-01 BE259649.1 EST_HUMAN 601145793F1 NIH_MGC_19 Homo sapiens cDNA clone IMAGE:316183 5' 11555 24464 3.89 1.6E-01 AF106064.1 NT Plasmodium falciparum calcium-depandent protein kinase-3 (cdpk3) gene, complete cds 11847 24697 38188 8.03 1.6E-01 6671552 NT Mus muscuius adaptor-related protein complex AP-1, beta 1 subunit (Ap1b1), mRNA 12086 24927 38431 2.17 1.6E-01 X07471.1 NT Human small polydisperse circuiar DNA (Hspc-64) 12086 24927 38432 2.17 1.6E-01 X07471.1 NT Human small polydisperse circuiar DNA (Hspc-64) 12130 24971 1.56 1.6E-01 BF527237.1 EST_HUMAN 602039465F2 NCI_CGAP_Brn67 Homo sapiens cDNA clone IMAGE:4177073 5' 12355 25145 38169 5.34 1.6E-01 AV719585.1 EST_HUMAN AV719585 GLC Homo sapiens cDNA clone GLCEMF07 5' 12634 25315 31818 1.58 1.6E-01 L14933.1 NT Rat convertase PC5 mRNA, 5' end 12661 25332 1.97 1.6E-01 AW839711.1 EST_HUMAN RC1-LT0074-120200-014-h01_1 LT0074 Homo sapiens cDNA 12754 25718 9.25 1.6E-01 AB045310.1 NT Cucumis sativus KS mRNA for ent-kaurene synthase, complete cds 12903 25490 2.43 1.6E-01 AK024496.1 NT Homo sapiens mRNA for FLJ00104 protein, partial cds Fuchsia hybrid cultivar Qiu 94208 ribosomal protein S10 gene, partial cds; nuclear gene for mitochondrial 12984 25543 4.75 1.6E-01 AF287344.1 NT product 13000 25552 31756 2.07 1.6E-01 9506522 NT Rattus norvegicus chondroitin sulfate proteoglycan 5 (neuroglycan C) (Cspg5), mRNA Page 107 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 267 13362 26277 1.36 1.5E-01 BE710087.1 EST_HUMAN IL3-HT0619-040700-197-E05 HT0619 Homo sapiens cDNA 267 13362 26278 1.36 1.5E-01 BE710087.1 EST_HUMAN IL3-HT0619-040700-197-E05 HT0619 Homo sapiens cDNA 608 15845 2.06 1.5E-01 AV711696.1 EST_HUMAN AV711696 DCA Homo sapiens cDNA clone DCAADH06 5' 809 13865 26800 1.13 1.5E-01 AL163284.2 NT Homo sapiens chromosome 21 segment HS21C084 1119 14161 27099 2.41 1.5E-01 AJ009735.1 NT Cyprinus carpio mRNA for EGGS22 myosin heavy chain, 3UTR 1124 14166 27103 1.83 1.5E-01 AJ251885.1 NT Homo sapiens partial SLC22A2 gene for organic cadion transporter (OCT2), exon 1 1140 14182 1.54 1.5E-01 L36125.1 NT Rattus norvegicus insulin-responsive glucose transporter (GLUT4) gene, 5' end 1244 14280 27222 0.68 1.5E-01 AW195516.1 EST_HUMAN xn39d11.x1 NCI_CGAP_Kjd11 Homo sapiens cDNA clone IMAGE:2696085 3' 1302 14335 27281 2.86 1.5E-01 D26535.1 NT Human gene for dihydrollpoamide succinyltransferase, complete cds (exon 1-15) 1302 14335 27282 2.86 1.5E-01 D26535.1 NT Human gene for dihydrollpoamide succinyltransferase, complete cds (exon 1-15) 1500 14531 27496 1.54 1.5E-01 AF117340.1 NT Mus musculus MAP kinase kinase kinase 1 (Mekk1) mRNA, complete cds xw56a02.x2 NCI_CGAP_Pan1 Homo sapiens cDNA clone IMAGE:283 1978 3' similar to gb:X55072_mat 2956 16008 1.21 1.5E-01 AW572516.1 EST_HUMAN THYROID HORMONE RECEPTOR ALPHA-1 (HUMAN); 3082 16133 29029 4.75 1.5E-01 M81441.1 NT Bos taurus factor V variant 2 (facotr V) mRNA, complete cds 3100 16151 29047 0.68 1.5E-01 O78687 SWISSPROT NADH-UBIQUINONE OXIDOREDUCTASE CHAIN 4 oo68d05.s1 NCI_CGAP_GC4 Homo sapiens cDNA clone IMAGE:1571337 3' similar to glo:M11433 3401 16443 29350 5.96 1.5E-01 AA935049.1 EST_HUMAN RETINOL-BINDING PROTEIN I, CELLULAR (HUMAN); 3426 16467 29375 0.79 1.5E-01 Z23104.1 NT L.stagnalis mRNA for G protein-coupled receptor 3426 16467 29376 0.79 1.5E-01 Z23104.1 NT L.stagnalis mRNA for G protein-coupled receptor hh29f02.x1 NCI_CGAP_Lu24 Homo sapiens cDNA clone IMAGE:2956539 3' similar to contains element 3488 16527 29426 1.01 1.5E-01 AW612237.1 EST_HUMAN MER16 repetitive element; 3819 16849 29733 2.52 1.5E-01 U09964.1 NT Mus musculus ICR/Swiss glyceraldehyde 3-phosphate dehydrogenase (Gapd-S) gene, complete cds Homo sapiens pyruvate dehydrogenase kinase, iscenzyme 1 (PDK1), nuclear gene encoding mitochondrial 3835 16864 29747 0.77 1.5E-01 7108358 NT protein, mRNA 3935 16963 29846 2.77 1.5E-01 AW665983.1 EST_HUMAN hj10f06.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2981411 3' 4134 17155 30033 0.95 1.5E-01 AW366659.1 EST_HUMAN RC2-HT0149-191099-012-c09 HT0149 Homo sapiens cDNA 4186 17206 30073 0.72 1.5E-01 Z12628.1 NT B.nspus mitochondrion DNA for ORF158 4279 17293 30159 12.39 1.5E-01 AL163284.2 NT Homo sapiens chromosome 21 segment HS21C084 4838 17839 30709 1.6 1.5E-01 BF687665.1 EST_HUMAN 602067192F1 NIH_MGC_57 Homo sapiens cDNA clone IMAGE:4066223 5' 4864 15752 28748 2.4 1.5E-01 BF695381.1 EST_HUMAN 602083269F1 NIH_MGC_81 Homo sapiens cDNA clone IMAGE:4247537 5' 4903 17902 30770 1.13 1.5E-01 BE173796.1 EST_HUMAN CM0-HT0565-280200-245-b10 HT0565 Homo sapiens cDNA 4903 17902 30771 1.13 1.5E-01 BE173796.1 EST_HUMAN CM0-HT0565-280200-245-b10 HT0565 Homo sapiens cDNA 5120 18117 30959 2.4 1.5E-01 AL161560.2 NT Arabldopsis thallana DNA chromosome 4, contig fragment No. 60 Page 108 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 5437 18519 31244 2.14 1.5E-01 P07996 SWISSPROT THROMBOSPONDIN 1 PRECURSOR 5467 18548 31388 0.72 1.5E-01 AF256652.1 NT Caiman crocodillus MHC class II beta chain (hcllbeta) gene, complete cds SEX HORMONE-BINDING GLOBULIN PRECURSOR (SHBG) (SEX STEROID-BINDING PROTEIN) 5511 18590 5.58 1.5E-01 P15196 SWISSPROT (SBP) (TESTIS-SPECIFIC ANDROGEN-BINDING PROTEIN) (ABP) 5728 18801 31894 4.9 1.5E-01 AW850754.1 EST_HUMAN IL3-CT0219-160200-054-F10 CT0219 Homo sapiens cDNA 5771 18844 31946 6.93 1.5E-01 U65016.1 NT Mus musculus transforming growth factor alpha (TGFa) mRNA, complete cds 5771 18844 31947 6.93 1.5E-01 U65016.1 NT Mus musculus transforming growth factor alpha (TGFa) mRNA, complete cds 6127 19186 32321 0.57 1.5E-01 4506810 NT Homo sapiens sodium channel, voltage-gated, type VI, alpha polypeptide (SCN6A) mRNA 6237 19291 32450 1.69 1.5E-01 6753659 NT Mus musculus DNA methyltransferase 2 (Dnmt2), mRNA 6237 19291 32451 1.69 1.5E-01 6753659 NT Mus musculus DNA methyltransferase 2 (Dnmt2), mRNA 6278 19329 32495 2.15 1.5E-01 AJ276505.1 NT Mus musculus genomic fragrnent, 279 Kb, chromosoms 7 6436 19483 32658 3.09 1.5E-01 BE727658.1 EST_HUMAN 601564322F1 NIH_MGC_20 Homo sapiens cDNA clone IMAGE:3833981 5' 6495 19539 2.03 1.5E-01 4506396 NT Homo sapiens RAD54 (S.cerevisiae)-like (RAD54L) mRNA 6601 19642 32824 1.74 1.5E-01 AF134907.1 NT Influenza B virus (B/Nanchang/480/94) NB protein gene, complete cds; and neuraminidase gene, partial cds 6779 25654 33024 1.7 1.5E-01 AE001039.1 NT Archaeoglobus fulgidus fulgidus section 68 of 172 of the complete genome 6810 19843 33053 5.41 1.5E-01 11417236 NT Homo sapiens chromosome 5 open reading frame 3 (C5ORF3), mRNA GLUTAMATE-CYSTEINE LIGASE REGULATORY SUBUNIT (GAMMA-GLUTAWYLCYSTEINE 6821 19854 33066 1.87 1.5E-01 P48508 SWISSPROT SYNTHETASE) (GAMMA-ECS) (GCS LIGHT CHAIN) 6871 19902 33117 2.03 1.5E-01 Q28462 SWISSPROT AMELOGENIN 6981 20008 33239 1 1.5E-01 AA714760.1 EST_HUMAN nw30d10.s1 NCI_CGAP_GCB0 Homo sapiens cDNA clone IMAGE:1241971 3' 7010 20037 33270 1.67 1.5E-01 P30143 SWISSPROT HYPOTHETICAL 51.7 KD PROTEIN IN THRC-TALB INTERGENIC REGION (ORF8) 7319 18487 31310 6.54 1.5E-01 AW970295.1 EST_HUMAN EST382376 MAGE resequences, MAGK Homo sapiens cDNA ob73f02.s1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE:1337019 3' similar to contains element 7363 25669 0.71 1.5E-01 AA811545.1 EST_HUMAN LTR2 repetitive element; 7583 20519 2.21 1.5E-01 AF210842.1 NT Homo sapiens HARP (HARP) gene, exon 17 and complete cds 7743 20674 33972 0.51 1.5E-01 AJ223966.1 NT Leucophaea maderae mRNA for lipocalin, Lma-P22 7788 20717 34020 1.69 1.5E-01 AI973157.1 EST_HUMAN wr52c08.x1 NCI-CGAP_Ut1 Homo sapiens cDNA clone IMAGE:2491310 3' 8030 20946 34262 1 1.5E-01 AF299073.1 NT Bos taurus Niemann-Pick type C1 disease protein (NPC1) mRNA, complete cds 8030 20946 34263 1 1.5E-01 AF299073.1 NT Bos taurus Niemann-Pick type C1 disease protein (NPC1) mRNA, complete cds 8042 20956 34270 1.48 1.5E-01 AW500611.1 EST_HUMAN UI-HF-BN0-akk-d-05-0-UI.r1 NIH_MGC_50 Homo sapiens cDNA clone IMAGE:3077409 5' 8042 20956 34271 1.48 1.5E-01 AW500611.1 EST_HUMAN UI-HF-BN0-akk-d-05-0-UI.r1 NIH_MGC_50 Homo sapiens cDNA clone IMAGE:3077409 5' 8205 21111 3442 0.64 1.5E-01 U46560.1 NT Saccharomyces carevisiae weak multicopy suppressor of lcs1-1 (SOL3) gene, complete cds 8636 21567 34904 1.1 1.5E-01 P21303 SWISSPROT MEROZOITE RECEPTOR PK66 PRECURSOR (66 KD PRO TECTIVE MINOR SURFACE ANTIGEN) Page 109 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value oo85g12.s1 NCI_CGAP_Kid5 Homo sapiens cDNA clone IMAGE:1573030 3' similar to gb:M26062 8798 21728 35077 1.24 1.5E-01 AA970317.1 EST_HUMAN INTERLEUKIN-2 RECEPTOR BETA CHAIN PRECURSOR (HUMAN); 8887 21817 0.97 1.5E-01 BE884799.1 EST_HUMAN 601510523F1 NIH_MGC_71 Homo sapiens cDNA clone IMAGE:3912004 5' 8970 21900 16.06 1.5E-01 C16800.1 EST_HUMAN C16800 Clontech human aorta polyA+ mRNA (#6572) Homo sapiens cDNA clone GEN-529H09 5' 9002 21931 35287 1.58 1.5E-01 L27835.1 NT Pangasianodon gigas growth hormone (GH) mRNA, complete cds 9155 22083 35441 1.73 1.5E-01 D84476.1 NT Homo sapiens mRNA for ASK1, complete cds 9174 22102 0.75 1.5E-01 P43446 SWISSPROT WNT-10A PROTEIN PRECURSOR 9396 22324 35687 1.62 1.5E-01 4501972 NT Homo sapiens adaptor-related protein complex 1, beta 1 subunit (ADTB1), mRNA za59e06.s1 Soares fetal liver spieen 1NFLS Homo sapiens cDNA clone IMAGE:296866 3' similar to 9649 22575 35946 2.57 1.5E-01 N74226.1 EST_HUMAN PIR:S44443 S44443 RAD23 protein homolog2 - human; 9735 22660 36043 1.62 1.5E-01 BF585465.1 EST_HUMAN GVO000404 Human Pscriasis Differential Display Homo sapiens cDNA 9742 22666 2.45 1.5E-01 AV754819.1 EST_HUMAN AV754819 TP Homo sapiens cDNA clone TPAAHB12 5' 9985 21343 34678 7.35 1.5E-01 U00455.1 NT Acipenser transmontano vitellogenin mRNA, partial cds 10332 23221 36635 0.76 1.5E-01 M77144.1 NT Human type II 3-beta hydroxysterold dehydrogenase 5-delta-4-delta isomerase gene, complete cds 10432 23321 36738 7.83 1.5E-01 AF007570.1 NT Aplysia californica carboxypepticlasse D mRNA, complete cds 10432 23321 36739 7.83 1.5E-01 AF007570.1 NT Aplysia californica carboxypepticlasse D mRNA, complete cds 10699 23585 37014 2.61 1.5E-01 X98852.1 NT P.leniusculus mRNA for integrin beta subunit wk53h12.x1 NCI_CGAP_Pr22 Homo sapiens cDNA clone IMAGE:2419175 3' similar to gb:M27508 BETA 10798 23684 37113 3.32 1.5E-01 AI814046.1 EST_HUMAN GALACTOSIDASE-RELATED PROTEIN PRECURSOR (HUMAN); wk53h12.x1 NCI_CGAP_Pr22 Homo sapiens cDNA clone IMAGE:2419175 3' similar to gb:M27508 BETA 10798 23684 37114 3.32 1.5E-01 AI814046.1 EST_HUMAN GALACTOSIDASE-RELATED PROTEIN PRECURSOR (HUMAN); 10875 23761 37188 1.92 1.5E-01 U40932.1 NT Danio rerio transcription factor Pax9b (Pax9) mRNA, complete cds 11018 23902 37340 1.49 1.5E-01 AJ011964.1 NT Claviceps purpurea ps1 gene 11018 23902 37341 1.49 1.5E-01 AJ011964.1 NT Claviceps purpurea ps1 gene 11139 24068 37513 1.84 1.5E-01 BE088492.1 EST_HUMAN CM2-BT0688-210300-122-f11 BT0688 Homo sapiens cDNA 11139 24068 37514 1.84 1.5E-01 BE088492.1 EST_HUMAN CM2-BT0688-210300-122-f11 BT0688 Homo sapiens cDNA 11263 24186 37634 5.36 1.5E-01 AL163280.2 NT Homo sapiens chromosome 21 segment HS21C080 11263 24186 37635 5.36 1.5E-01 AL163280.2 NT Homo sapiens chromosome 21 segment HS21C080 11515 24425 37883 1.58 1.6E-01 AW841915.1 EST_HUMAN IL5-CN0024-030300-025-D04 CN0024 Homo sapiens cDNA 11607 20717 34020 1.49 1.5E-01 AI973157.1 EST_HUMAN wr52c08.x1 NCI_CGAP_Ut1 Homo sapiens cDNA clone IMAGE:2491310 3' qe72e01.x1 Soares_fetal_lung_NbHL19W Homo sapiens cDNA clone IMAGE:1744536 3' similar to 12050 24891 1.57 1.5E-01 AI193704.1 EST_HUMAN gb:M17887 60S ACIDIC RIBOSOMAL PROTEIN P2 (HUMAN); 12315 25766 41.76 1.5E-01 BF700582.1 EST_HUMAN 602128753F1 NIH_MGC_56 Homo sapiens cDNA clone IMAGE:4285549 5' Page 110 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 12660 25331 2.53 1.5E-01 AF030358.2 NT Rattus norveglcus chemokine CX3C mRNA, complete cds Homo sapins DNA, DLEC1 to ORCTL4 gene region, section 1/2 (DLEC1, ORCTL3, ORCTL4 genes, 12702 25357 1.6 1.5E-01 AB026898.1 NT complete cds) 12721 25783 .83 1.5E-01 R83077.1 EST_HUMAN yp87e04.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:194430 5' 12801 25803 3.37 1.5E-01 AV741272.1 EST_HUMAN AV741272 CB Homo sapiens cDNA clone CBDAGD04 5' 12902 25722 31667 7.76 1.5E-01 AL139074.2 NT campylobacter jejuni NCTC111168 complete genome; segment 1/6 13082 25603 31732 6.57 1.5E-01 AJ276242.1 NT Sus scrofa mRNA for sodium iodide symporter 319 13411 1.38 1.4E-01 AF0095663.1 NT Homo sapiens T cell receptor beta locus, TCRBV8S5P to TCRBV21S2A2 region 935 13987 3.3 1.4E-01 D78638.1 NT Xenopus laeVIS mRNA for DNA (cytosine-5-)-methyltransferase, complete cds 1286 14319 1.33 1.4E-01 T91864.1 EST_HUMAN yd54c01.s1 Scares fatal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:112032 3' 1774 14800 1.35 1.4E-01 6679980 NT Mus musculus growth differentiation factor 5 (Gdf5), mRNA 1776 14802 27770 1.31 1.4E-01 AE001710.1 NT Thermotoga maritima section 22 of 136 of the complete genome 1923 14944 1.06 1.4E-01 AW135741.1 EST_HUMAN UI-H-BI1-acf-a-09-0-UI.s1 NCI_CGAP_Sub3 Homo sapiens cDNA clone IMAGE:2714009 3' 2002 15020 11.07 1.4E-01 AA720615.1 EST_HUMAN ny72d07.e1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE:1283821 3' 2496 15498 28498 1.35 1.4E-01 P30706 SWISSPROT GLYCEROL-3-PHOSPHATE ACYLTRANSFERASE PRECURSOR (GPAT) 2840 15829 28826 3.96 1.4E-01 AI933496.1 EST_HUMAN wm74d01.x1 NCI_CGAP_Ut2 Homo sapiens cDNA clone IMAGE:2441665 3' 3349 16395 29296 1.03 1.4E-01 R56395.1 EST_HUMAN yg90a10.r1 Soares infant brain 1NIB Homo sapiens cDNA clone IMAGE:40648 5' 3968 16996 29880 1.25 1.4E-01 R59232.1 EST_HUMAN yg97a03.rt Soares infant brain 1NIB Homo sapiens cDNA clone IMAGE:41467 5' 3968 16996 29881 1.25 1.4E-01 R69232.1 EST_HUMAN yg97a03.rt Soares infant brain 1NIB Homo sapiens cDNA clone IMAGE:41467 5' 4269 17285 30152 10.37 1.4E-01 AI699094.1 EST_HUMAN tx56o02.x1 NCI_CGAP_Lu24 Homo sapiens cDNA clone IMAGE:2273570 3' 4269 17285 30153 10.37 1.4E-01 AI699094.1 EST_HUMAN tx56c02.x1 NCI_CGAP_Lu24 Homo sapiens cDNA clone IMAGE:2273570 3' 4337 17351 30214 4.49 1.4E-01 AE01710.1 NT Thermotoga maritima section 22 of 136 of the complete genome zj50b01.s1 Soares_feta_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:453673 3' similar to gb:X01057_ma1 INTERLEUKIN-2 RECEPTOR ALPHA CHAIN PRECURSOR (HUMAN):contains Alu 4518 17527 0.96 1.4E-01 AA776287.1 EST_HUMAN repetitive element; 4980 17978 308383 0.98 1.4E-01 AV689659.1 EST_HUMAN AV889659 GKC Homo sapiens cDNA clone GKCDUG09 5' 5489 18569 31415 4.8 1.4E-01 T90677.1 EST_HUMAN ye15c11.s1 Stratagene lung (#937210 ) Homo saplens cDNA clone IMAGE:117812 3' 5512 18591 31438 4.32 1.4E-01 AB004556.1 NT Candida tropicalis DNA for mitochomdrial NADP-linked isocitrate dehydrogenase, complete cds 5512 18591 31439 4.32 1.4E-01 AB004556.1 NT Candida tropicalis DNA for mitochondrial NADP-linked isocitrate dehydrogenase, complete cds 6562 19594 32782 3.04 1.4E-1 BE326891.1 EST_HUMAN hr67c02.xf NCI_CGAP_Kid11 Homo sepiene cDNA clone IMAGE:3133638 3' 6757 19791 33004 4.3 1.4E-01 AU117147.1 EST_HUMAN AU117147 HEMBA1 Homo sapiens cDNA clone HEMBA1000769 5' 6757 19791 33005 4.3 1.4E-01 AU117147.1 EST_HUMAN AU117147 HEMBA1 Homo sapiens cDNA clone HEMBA1000769 5' 6853 19885 33099 4.04 1.4E-01 AW082796.1 EST_HUMAN xb71d12.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2581751 3' 6867 19899 1.6 1.4E-01 BE266536.1 EST_HUMAN 601193523F1 NIH_MGC_7 Homo sapiens cDNA cone IMAGE:3537581 5' Page 111 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 6891 19921 33136 2.17 1.4E-01 BF378533.1 EST_HUMAN QV1-UM036-080300-103-d09 UM0036 Homo sapiens cDNA 7486 20426 1.03 1.4E-01 AL118568.1 EST_HUMAN DKFZp761A0910_r1 761 (synonym: hamy2) Homo sapiens cDNA clone DKFZp761A0910 5' 7782 20711 1.8 1.4E-01 AW015373.1 EST_HUMAN UI-H-BI0-aat-c-09-0-UI.s1 NCI_CGAP_Sub1 Homo sapiens cDNA clone IMAGE:2710289 3' 7810 20739 34042 0.62 1.4E-01 F08745.1 EST_HUMAN HSC1DB011 nomalized infant brain cDNA Homo sapiens cDNA clone c-1 db01 wi04f12.x1 NCI_CGAP_CLL1 Homo sapiens cDNA clone IMAGE:238295 3' similar to SW:ICE_4_HUMAN 7866 20793 0.68 1.4E-01 AI762827.1 EST_HUMAN P49662 CASPASE-4 PRECURSOR; ya90f11.r2 stragene placenta (#937225) homo sapiens cDNA clone IMAGE:68973 5' similar to contains 7869 20796 34099 0.43 1.4E-01 T53770.1 EST_HUMAN Alu repetitive element 8069 20982 34296 1.21 1.4E-01 U85645.1 NT Oryctolagus cuniculus fructose 1,6, bisphosphate aldolase (AldB) gene, complete cds 8220 21125 34457 1.69 1.4E-01 AI305192.1 EST_HUMAN q190b12.x1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE: 1879583 3' 8553 21484 0.65 1.4E-01 BF310258.1 EST_HUMAN 60189470F1 NIH_MGC_19 Homo sapiens cDNA clone IMAGE:4124199 5' 9044 21973 1.55 1.4E-01 AV659047.1 EST_HUMAN AV659047 GLC Homo saplens cDNA clons GLCFSH06 3' th92b12.x1 Soarec_NSF_F8-9W_OT_PA_P_S1 Homo capienc cDNA clone IMAGE:2126111 3' eimilar to 9343 22271 0.57 1.4E-01 AI436093.1 EST_HUMAN TR:O02710 O02710 GAG POLYPROTEIN.; 9470 22398 35761 5.31 1.4E-01 AA307073.1 EST_HUMAN EST178192 Colon carcinoma (HCC) cell line Homo sapiens cDNA 5'end 9545 22472 35830 0.76 1.4E-01 AW023636.1 EST_HUMAN df58b03.y1 Morton Fetal Cochlea Homo sapiens cDNA clone IMAGE:2487485 5' 9667 22593 35967 1.2 1.4E-01 R62746.1 EST_HUMAN yi10h05.r1 Soares placenta NB2HP Homo sapiens cDNA clone IMAGE:138873 5' 9667 22593 35968 1.2 1.4E-01 R62746.1 EST_HUMAN yi1005.r1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE:138873 5' 9728 22653 36036 8.78 1.4E-01 BF310959.1 EST_HUMAN 601895465F1 NIH_MGC_19 Homo sapiens cDNA clone IMAGE:4124824 5' zd94a04.r1 Soares_fetal_heart_NbHH19W Homo saplens cDNA clone IMAGE:357102 5' similar to contains 9815 22721 36104 1.39 1.4E-01 W93411.1 EST_HUMAN element KER repetilive elemtn ; 9885 22800 36186 0.51 1.4E-01 X73293.1 NT M.vannielii genes rpoH, rpoB and rpoA 9885 22800 36187 0.51 1.4E-01 X73293.1 NT M.vannielii genes rpoH, rpoB and rpoA 9896 22811 36200 1.26 1.4E-01 Y10196.1 NT Homo saplens PHEX gene 9896 22811 36201 1.26 1.4E-01 Y10196.1 NT Homo saplens PHEX gene Drosophila melanogaster signal transducting adaptor protein (STAM), serine threonine kinase lal (IAL), and 9982 21340 34676 1.58 1.4E-01 AF121361.1 NT zine finger protein (DNZ1) genes, complete cds 10321 23210 36622 0.74 1.4E-01 X65092.1 NT C.perfringens ORF for putative membrane transport protein Macromitrium levalum small ribosomal protein 4 (rps4) gene, chloroplastgene encoding chloroplast protein, 10493 23381 36794 1.11 1.4E-01 AF023813.1 NT partial cds 10590 23476 36903 0.73 1.4E-01 AW021908.1 EST_HUMAN df29h08.yl Morton Fetal Cochles Homo sapiens cDNA clone IMAGE:2485094 5' 10590 23476 36904 0.73 1.4E-01 AW021908.1 EST_HUMAN df29h08.yl Morton Fetal Cochlea Homo sapiens cDNA clone IMAGE:2485094 5' 10750 23638 37068 0.7 1.4E-01 BF375285.1 EST_HUMAN MR3-ST0218-211299-013-a08 ST0218 Homo sapiens cDNA 10750 23636 37069 0.7 1.4E-01 BF375285.1 EST_HUMAN MR3-ST0218-211299-013-a08 ST0218 Homo sapiens cDNA Page 112 to 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 11151 24080 1.76 1.4E-01 AA811480.1 EST_HUMAN oa99a03.s1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE:1320364 3' 11280 24202 37654 3.28 1.4E-01 R53400.1 EST_HUMAN yj70c05.r1 Soares breast 2NbHBst Homo sapiens cDNA clone IMAGE:154088 5' 11469 24382 37829 1.52 1.4E-01 AR104982.1 EST_HUMAN xd73e10.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2603274 3' 11537 24447 37908 1.51 1.4E-01 T96102.1 EST_HUMAN ye47g10.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGG: 120930 5' 11537 24447 37909 1.51 1.4E-01 T96102.1 EST_HUMAN ye47910.r1 Soares fetal liver spleen 1NFLS Homo saplens cDNA clone IMAGE: 120930 5' INTEGRIN ALPHA-5 PRECURSOR (FIBRONECTIN RECEPTOR ALPHA SUBUNIT) (INTEGRIN ALPHA- 11539 24449 37912 1.5 1.4E-01 P08648 SWISSPROT F)(VLA-5)(CD49E) 11738 24640 38120 1.77 1.4E-01 X66092.1 NT C.perfringens ORF for pultative membrane fransport protein 11773 20711 1.65 1.4E-01 AW015373.1 EST_HUMAN UI-H-BI0-aaT-c-09-0-UI.s1 NCI_CGAP_Sub1 Homo sapiens cDNA clone IMAGE:2710289 3' Borrelia burgdorferi glyceraldehyde-3-phosphate dehydrogenase (GAPDH), phosphoglycerate kinase (PGK), 11901 24001 37440 2.05 1.4E-01 U28760.1 NT triosephosphate Isomerase (TPI) genes, complete cds 11957 24800 1.44 1.4E-01 X52102.1 NT M.musculus p16K gene for 16 kDa protein Mus musculus neuromedin U precursor (Nmu) gene, partial cds; tPhLP (Tphlp) gene, partial cds; CLOCK 12160 24998 38499 1.51 1.4E-01 AF146793.2 NT (Clock) gene, complete cds; PFT27 (Pft27) gene, complete cds; and H5AR (H5ar) gene, complete cds 12602 25298 31813 4.54 1.4E-01 X74773.1 NT P.sallna plastid gene secY 12614 25305 2.27 1.4E-01 11968117 NT Rattus norvegicus desmin (Des), mRNA 12659 25943 2.04 1.4E-01 BE513802.1 EST_HUMAN 601315638F1 NIH_MGC_8 Homo sapiens cDNA clone IMAGE:3634329 5' Fugu rubripes putative neurotransmitter receptors, YDR140w homolog, and glycinamide ribonucleotide 12747 25386 6.48 1.4E-01 AF083221.1 NT transformylase (GART) genes, complete cds 12825 25961 5.22 1.4E-01 P01447 SWISSPROT TYROSINE-PROTEIN KINASE TRASFORMING PROTEIN ABL 13019 25784 3.23 1.4E-01 D82983.1 NT Mus musculus mRNA for prolldse, complete cds 13106 25622 3.39 1.4E-01 U01337.1 NT Human Ser/Thr protein kinase (A-RAF-1) gene, complete cds 342 13432 26346 2.17 1.3E-01 4758467 NT Homo sapiens G protein-coupled receptor 50 (GPR50) mRNA 342 13432 26347 2.17 1.3E-01 4758467 NT Homo sapiens G protein-coupled receptor 50 (GPR50) mRNA 552 13621 26529 1.88 1.3E-01 AB013139.1 NT Homo sapiens gene for NBS1, complete cds 659 13721 26632 1.24 1.3E-01 AJ277606.1 NT Human calicivirus HU/NLV/Girlington/93/UK RNA for capsid protein (ORF2), strain HU/NLV/Girlington/93/UK 659 13721 26633 1.24 1.3E-01 AJ277606.1 NT Human callcivirus HU/NLV/Girlington/93/UK RNA for capsid protein (ORF2), strain HU/NLV/Girlington/93/UK 869 13922 26869 0.84 1.3E-01 X53330.1 NT P.dumerilii histone gene oluster for core histones H2A, H2B, H3 and H4 919 13971 26918 1.37 1.3E-01 AF139518.1 NT Rattus norvegicus A-kinase anchor protein mRNA, complete cds 1053 14097 27035 1.24 1.3E-01 AL117078.1 NT Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation 1154 14195 2.28 1.3E-01 AL115265.1 NT Botrytis cinerea strain T4 cDNA library under condition of nitrogen deprivation Page 113 to 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 1243 14279 27221 1.32 1.3E-01 AV712467.1 EST_HUMAN AV71247 DCA Homo sapiens cDNA clone DCAAFF05 5' 1462 14493 0.95 1.3E-01 AF146277.1 NT Homo saplens adapter protein CMS mRNA, complete cds 1882 14903 27837 1.13 1.3E-01 6680957 NT Mus musculus procollagen, type XI, alpha XI, alpha 1 (Col11a1), mRNA 1973 14991 27974 2.21 1.3E-01 AL117078.1 NT Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation Rhodopseudomonas acidophila pucB5, pucA5, pucB6, pucA6, pucB7, pucA7, pucB8, pucA8 and PucC 2183 15194 0.93 1.3E-01 AJ243578.1 NT ganes and ORF151 2309 15317 1.15 1.3E-01 AW812104.1 EST_HUMAN RC4-ST0137-191099-032-d12 ST0173 Homo sapiens cDNA 2403 15408 2.79 1.3E-01 AE001016.1 NT Archaeoglobus fulgidus section 91 of 172 of the complete genome 2625 15623 28616 2.66 1.3E-01 M86918.1 NT Cerassius auratus keratin type I mRNA, complete cds Homo sapiens transcription factor IGHM enhancer 3, JM11 protein, JM4 protein, JM5 protein, T54 protein, JM10 protein. A4 differentiation-dependent protein, triple LIM domain protein 6, and synaptophysin genes, 3410 16452 29358 0.66 1.3E-01 AF196779.1 NT complete cds; and L-type calclum channel a> 3512 16550 29450 1.1 1.3E-01 M21572.1 NT Bovine branched chain alpha-kelo acid dihyrolipoyl transacylase mRNA, complete cds 3786 16817 29704 0.78 1.3E-01 AP000001.1 NT Pyrococcus horikoshii OT3 genomic DNA, 1-287000 nt. position (1/7) 3786 16817 29705 0.78 1.3E-01 AP000001.1 NT Pyrococcus horikoshii OT3 genomic DNA, 1-287000 nt. position (1/7) 3870 16899 29783 0.67 1.3E-01 6978840 NT Rattus norvegicus Fibrinogen, gamma polypeptide (Fgg), mRNA 4074 17100 1.57 1.3E-01 AL161581.2 NT Arabidopois thaliana DNA ohromosome 4, contig fragment No. 77 4135 13721 26632 0.77 1.3E-01 AJ277606.1 NT Human callcivirus HU/NLV/Girlington/93/UK RNA for capsid protein (ORF2), strain HU/NLV/Girlington/93/UK 4135 13721 26633 0.77 1.3E-01 AJ277606.1 NT Human calicivirus HU/NLV/Girlingotn/93/UK RNA for capsid protein (ORF2), strain HU/NLV/Girlington/93/UK 4236 17252 1.13 1.3E-01 AF020713.1 NT Bacteriophage SPBc2 complete genome. 4255 17271 4.13 1.3E-01 AW364341.1 EST_HUMAN QV3-DT0018-081299-036-a03 DT0018 Homo sapiens cDNA 4263 17279 30148 2.18 1.3E-01 AF026805.1 NT Schistosoma mansoni frutose bisphosphate aldolasemRNA, complete cds 4282 17296 30162 26.88 1.3E-01 AW273741.1 EST_HUMAN xv24f10.x1 Soares_NFL_T_BGC_S1 Homo sapiens cDNA clone IMAGE:2813995 3' 4387 17401 30269 1.05 1.3E-01 AV752279.1 EST_HUMAN AV752279 NPD Homo sapiens cDNA clone NPDAZE02 5' 4387 17401 30270 1.05 1.3E-01 AV752279.1 EST_HUMAN AV752279 NPD Homo sapiens cDNA clone NPDAZE02 5' 4419 17430 1.93 1.3E-01 AL163280.2 NT Homo sapiens chromosome 21 segment HS21C080 4592 17600 30457 0.88 1.3E-01 M21572.1 NT Bovine branched chain alpha-kelo acid dihydrolipoyl transacylase mRNA, complete cds 4650 17656 30522 2.2 1.3E-01 BE272339.1 EST_HUMAN 601126096F1 NIH_MGC_9 Homo sapiens cDNA clone IMAGE:2990063 5' 5099 18096 1.01 1.3E-01 AU136619.1 EST_HUMAN AU136619 PLACE1 Homo saplens cDNA clone PLACE1004693 5' 5152 18145 0.74 1.3E-01 BF091980.1 EST_HUMAN RC4-TN0077-180900-012-c05 TN0077 Homo sapiens cDNA 5255 18241 31093 1.2 1.3E-01 AI432531.1 EST_HUMAN th38c10.x1 NCI_CGAP_Pan1 Homo sapiens cDNA clone IMAGE:2120562 3' 5268 18264 31103 0.68 1.3E-01 L76979.1 NT Schizoaccharomyces pombe HMG-CoA reductase (hmg1+) gen, complete cds Page 114 to 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 5377 18359 31198 0.92 1.3E-01 8922935 NT Homo saplens hypothtical protein FLJ11198 (FLJ11198), mRNA ha07b06.x1 NCI_CGAP_Kid12 Homo sapiens cDNA clone IMAGE:2872979 3' similar to contains L1.b1 L1 5508 18587 31436 0.76 1.3E-01 AW466988.1 EST_HUMAN L1 repetitive element ; 5547 16625 31500 1.99 1.3E-01 AW604417.1 EST_HUMAN QVo-UM0093-100400-189-a06 UM0093 Homo sapiens cDNA 5691 18764 0.81 1.3E-01 AF107793.1 NT Emericella nidulans DNA-dependent RNA polymerase II RPB140 (RPB2) gene, partial cds 5778 18850 22.2 1.3E-01 AF056880.1 NT Hepatitis C Virus 68_CL10 genome polyprotein gene, partial cds 5926 18993 32112 0.88 1.3E-01 BF210920.1 EST_HUMAN 60187459F1 NIH_MGC_54 Homo sapiens cDNA cione IMAGE:4101119 5' 6216 19271 32424 0.68 1.3E-01 BF52728.1 EST_HUMAN 602039337F2NCI_CGAP_Bm67 Homo sapiens cDNA clone IMAGE:4177233 5' 6216 19271 32425 0.68 1.3E-01 BF52728.1 EST_HUMAN 602039337F2NCI_CGAP_Bm67 Homo sapiens cDNA clone IMAGE:4177233 5' 6758 19792 33006 17.04 1.3E-01 AB031326.1 nt Schizosaccharomyces pombe gene for Alp41, complete cds 6850 19862 33096 1.19 1.3E-01 X88891.1 NT C.jacchus intron 4 of visual pigment gene (red allele) 7096 20302 0.74 1.3E-01 W26367.1 EST_HUMAN 26f3 Human retina cDNA randomly primed sulibrary Homo sapiens cDNA 7148 20256 33508 0.55 1.3E-01 BE782926.1 EST_HUMAN 601465957F1 NIH_MGC_67 Homo sapiens cDNA clone IMAGE:3869079 5' 7148 20256 33509 0.56 1.3E-01 BE782926.1 EST_HUMAN 601465957F1 NIH_MGC_67 Homo sapiens cDNA clone IMAGE:3869079 5' 7359 20354 0.73 1.3E-01 BF529560.1 EST_HUMAN 602044345F1 NCI_CGAP_Brn67 Homo sapiens cDNA clone IMAGE:4181866 5' 7637 20572 1.85 1.3E-01 H48664.1 EST_HUMAN yr33d02.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:207075 5' 8262 21167 0.45 1.3E-01 BE681615.1 EST_HUMAN 60215643F1 NIH_MGC_83 Hcom sapiens cDNA clone IMAGE:4297354 5' 8537 21468 0.87 1.3E-01 BE272339.1 EST_HUMAN 601126096F1 NIH_MGC_9 Homo sapiens cDNA clone IMAGE:2990063 5' 8551 21482 34823 1.67 1.3E-01 11423294 NT Homo sapiens PRO0611 protein (PRO0611), mRNA 8582 21513 34857 1.28 1.3E-01 BF690522.1 EST_HUMAN 602187015T1 NIH_MGC_49 Homo sapiens cDNA clone IMAGE:4299074 3' 8850 21780 35127 0.7 1.3E-01 11421556 NT Homo sapiens TED protein (TED), mRNA 8919 21849 4.33 1.3E-01 Z74102.1 NT S.cerevislae chromosome IV reading frame ORF YDL054c 8957 21887 5.17 1.3E-01 8923919 NT Homo saplens core histone macroH2A2.2 (MARCROH2A2), mRNA 9092 22021 35378 2.2 1.3E-01 BF690522.1 EST_HUMAN 602187015T1 NIH_MGC_49 Homo sapiens cDNA clone IMAGE:4299074 3' yf39g11.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:129284 5' similar to 9503 22430 35792 0.88 1.3E-01 R11172.1 EST_HUMAN SP:RL2B_RAT P29316 60S RIBOSOMAL PROTEIN ; yf39g11.rf Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:129284 t' similar to 9503 22430 36793 0.88 1.3E-01 R11172.1 EST_HUMAN SP:RL2B_RAT P29316 60S RIBOSOMAL PROTEIN ; 9760 22684 36070 0.78 1.3E-01 11068003 NT Plutella xylostella granulovirus, complete genome 9760 22684 36071 0.78 1.3E-01 11068003 NT Plutella xylostella granulovirus, complete genome 10005 22822 36210 4.26 1.3E-01 AF023129.1 NT Orytolagua cuniculus H+,K+-Pase alpha 2c subunit mRNA, complete cds 10554 23440 1.09 1.3E-01 8393940 NT Raltus norvegicus peptidyl arginine deiminase, type IV (Pdi4), mRNA 10629 23515 36948 1.21 1.3E-01 AW851599.1 EST_HUMAN MR2-CT0222-201099-001-e01 CT0222 Homo saplens cDNA 10879 25695 37189 1.15 1.3E-01 AL163246.2 NT Homo sapiens chromosome 21 segment HS21C046 Page 115 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 11078 24010 2.71 1.3E-01 BF330999.1 EST_HUMAN MR4-BT0358-130700-010-h08 BT0358 Homo sapiens cDNA 11301 24220 37669 1.52 1.3E-01 H01883.1 EST_HUMAN yj32d09.r1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE:150449 5' 11540 24450 37913 1.66 1.3E-01 AF119117.1 NT Homo sapiene dopamine transporter (SKLC6A3) gene, complete cds 11624 24532 1.68 1.3E-01 BF092708.1 EST_HUMAN MR4-TN0112-120900-102-e08 TN012 Homo sapiens cDNA 11697 24599 4.27 1.3E-01 6671745 NT Mus musculus cofilin 2, muscie (Cfl2), mRNA 11776 24675 38163 1.54 1.3E-01 BF677328.1 EST_HUMAN 602087045F1 NIH_MGC_83 Homo sapiens cDNA clone IMAGE:4251346 5' 11776 24675 38164 1.54 1.3E-01 BF677328.1 EST_HUMAN 602087045F1 NIH_MGC_83 Homo sapiens cDNA clone IMAGE:4251346 5' 12025 24867 38369 3.34 1.3E-01 BE279449.1 EST_HUMAN 601158052F1 NIH_MGC_21 Homo sapiens cDNA clone IMAGE:3504804 5' 12145 24985 38485 1.51 1.3E-01 BE619364.1 EST_HUMAN 601473369F1 NIH_MGC_68 Homo sapiens cDNA clone IMAGE:3876208 5' 12461 25208 31852 1.75 1.3E-01 BE618346.1 EST_HUMAN 601462741F1 NIH_MGC_67 Homo sapiens cDNA clone IMAGE:3866003 6' 12587 25285 3.4 1.3E-01 AJ242790.1 NT Gellus gallus scyc1 gene for lymphotactin, exons 1-3 wu24d09.x1 Soares_Dieckgrseie_colon_NHCD Homo sapiens cDNA clone IMAGE:2520977 3' similar to 12957 26518 1.79 1.3E-01 AW001114.1 EST_HUMAN TR:O60287 O60287 KIAA0539 PROTEIN. ; tf39b02.x1 NCI_CGAP_Brn23 Homo sapiens cDNA clon IMAGE:2098539j 3' similer to gb:U05760_ma1 404 13517 26438 6.68 1.2E-01 AI421744.1 EST_HUMAN ANNEXIN (HUMAN); 447 13114 1.08 1.2E-01 U66912.1 NT Dictyostellum discoideum ORFDG1016 gene, partial cds 569 13637 2.5 1.2E-01 AF039442.1 NT Homo sapiens colon cancer antigen NY-CO-45 mRNA, partial cds 1403 14434 27389 2.23 1.2E-01 AU149146.1 EST_HUMAN AU149146 NT2RM4 Homo sapiens cDNA clone NT2RM4001691 3' 1403 14434 27390 2.23 1.2E-01 AU149146.1 EST_HUMAN AU149146 NT2RM4 Homo sapiens cDNA clone NT2RM4001691 3' 1410 14441 2.04 1.2E-01 AV735249.1 EST_Human AV735249 cdA Homo sapiens cDNA clone cdAAJB11 5' al48e0g.s1 Soares_NFL_T_GBC_S1 Homo saplens cDNA clone IMAGF'14605843' similar to TR@Q16671 1526 14557 1.23 1.2E-01 AA897474.1 EST_HUMAN Q16671 ANTI-MULLERIAN HORMONE TYPE II RECEPTOR PRECURSOR. : NUCLEAR FACTOR OF ACTIVATED T-CELLS, CYTOPLASMIC 4 (T CELL TRANSCRIPTION FACTOR 165 14665 27646 1.2 1.2E-01 Q14934 SWISSPROT NFAT3) (NF-ATC4) (NF-AT3) 1677 14707 27670 3.09 1.2E-01 AI285402.1 EST_HUMAN qt69f09.x1 NCI_CGAP_Es02 Homo saplens cDNA clone IMAGE:1960553 3' 1793 14819 14.19 1.2E-01 X89211.1 NT H.saplens DNA for endogenous retroviral like element 2196 15207 28211 1.22 1.2E-01 BF248490.1 EST_HUMAN 601821567F1 NIH_MGC_62 Homo spaiens cDNA clone IMAGE:4046224 5' 2305 15313 28317 0.98 1.2E-01 AL163213.2 NT Homo sapiens chomosome 21 segment HS21C013 2630 15628 28621 1.96 1.2E-01 AW996556.1 EST_HUMAN QV3-BN0046-220300-129-f10 BN0046 Homo sapiens cDNA ts18g07.x1 NCI_CGAP_Pan1 Homo sapiens cDNA clone IMAGE:2228988 3' similar to TR:Q14045 Q 14048 COLLAGEN VIALPHA-2 ALTERNATIVE C-TERMINAL DOMAIN. [1];contains element pTR5 repetitive 2776 15767 28762 1.09 1.2E-01 AI623388.1 EST_HUMAN element ; 2888 15942 28844 1.24 1.24-01 U18018.1 NT Human E1A enhancer binding prolein (E1A-F) mRNA, partial cds Page 116 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value as80c09.x1 Barstead coion HPLRB7 Homo sapiens cDNA cione IMAGE;2335024 3' similer to gb:l.05095 2946 15998 28900 5.32 1.2E-01 AI720470.1 EST_HUMAN 60S RIBOSOMAL_PROTEIN L30 (HUMAN); 2977 16029 28931 5.06 1.2E-01 M16364.1 NT Humen creatine kinese-B mRNA, compiele ods 3048 16100 29003 0.86 1.2E-01 X56882.1 NT Wheat mRNA for a group 3 late embryogenesis abundant protain (LEA) 3277 16325 29231 3 1.2E-01 AW370668.1 EST_HUMAN QV1-BT0259-261099-012-d05 BT0259 Homo sapiens cDNA 3302 16349 1.05 1.2E-01 U67600.1 NT Methanococcus janneschii seclion 142 of 160 of the complete genome 3404 16446 29364 1.03 1.2E-01 AW503374.1 EST_HUMAN UI-HF-BNO-akw-a-10-0-UI.r1 NIH_MGC_50 Homo sapiens cDNA clone IMAGE:3078427 5' 3538 15576 0.66 1.2E-01 Z99118.1 NT Bacillus subtilis complete genome (section 15 of 21); from 2795131 to 3013540 3582 16619 29522 0.95 1.2E-01 X56882.1 NT Wheat mRNA for a group 3 lete embryogenesis ebundant protein (LEA) 3582 16619 29523 0.95 1.2E-01 X56882.1 NT Wheat mRNA for a group 3 lete embryogenesis ebundant protein (LEA) 3559 15576 1.11 1.2E-01 Z99118.1 NT Bacillus subilis complele geome (section 15 of 21); from 2795131 to 3013540 3833 16862 1.19 1.2E-01 BF128551.1 EST_HUMAN 601810786R1 NIH_MGC_46 Homo sapiens cDNA clone IMAGE:4053668 3' 4278 17202 30167 2.81 1.2E-01 Z64255.1 NT P. clarki mRNA; repeat region (ID 2MRT7) 4278 17202 30158 2.81 1.2E-01 Z64255.1 NT P. clarki mRNA; repeat region (ID 2MRT7) 4417 17428 30290 0.74 1.2E-01 M15861.1 NT Chicken neural cell-adhesion moiecule (N-CAM) gene, exon 19 4834 17835 30705 1.1 1.2E-01 Z48183.1 NT Lesculentum mRNA for glyaxaiase-1 4887 17886 0.73 1.2E-01 L32873.1 NT Arloiolopsis th aliana homeodomain protein (GLABRA2) gene, complete cds 4980 17988 30845 1.03 1.2E-01 BF311914.1 EST_HUMAN 601897754F1 NIH_MGC_19 Homo sapiens cDNA clone IMAGE;4127004 5' 5033 18030 30887 1.04 1.2E-01 AF134904.1 NT Schistocerca gregaria semaphorin 2a mRNA, complele cds 5214 18204 0.97 1.2E-01 P16466 SWISSPROT HEMOLYSIN PRECURSOR 5251 18237 31087 1.02 1.2E-01 AL163227.2 NT Homo sapiens chromosome 21 segment HS21C027 5251 18237 31088 1.02 1.2E-01 AL163227.2 NT Homo sapiens chromosome 21 segment HS21C027 5415 18395 31233 0.65 1.2E-01 L31380.1 NT Macace muletta vitamin K dependent protein S (PROS) mRNA, complets ods 5431 18513 31236 0.67 1.2E-01 AA744369.1 EST_HUMAN ny63c04.s1 NCI_CGAP_GCB1 Homo saplens cDNA clone IMAGE:1282950 3' Homo sapiens calcium channel alpha1E subunit (CACNA1E) gene, exons 7-49, and partial cds, altematively 5483 18564 31408 0.89 1.2E-01 AF223391.1 NT spliced 5493 18573 31418 2.48 1.2E-01 W33035.1 EST_HUMAN zc08d02.r1 Soares_parathyroid_tumor_NbHPA Homo sapiens cDNA clone IMAGE:321699 5' 6553 18631 31510 2.67 1.2E-01 Z98266.1 NT Homo sapiens gene enconding plakophilln (exons 1-13) 5695 18768 31693 0.93 1.2E-01 Z48234.1 NT M. domestica Borkh. Granny Smith adh mRNA for alcohol dehydrogenase 6441 19487 32664 1.9 1.2E-01 BE620945.1 EST_HUMAN 601493518F1NIH_MGC_70 Homo sapiens cDNA clone IMAGE 3895613 5' 6495 19540 32717 0.73 1.2E-01 P10842 SWISSPROT MATING-TYPE P-SPECIFIC FOLYPEPTIDE PI 6553 19595 32783 2.24 1.2E-01 AW845275.1 EST_HUMAN IL0-CT0031-221099-113-e04 CT0031 Homo saplens cDNA 6623 19663 32848 1.56 1.2E-01 M26925.1 NT Mouse galactosyltrans fer ase mRNA, complete cds 6699 19735 32937 0.68 1.2E-01 AA747635.1 EST_HUMAN nx85c01.s1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE:1269024 3' Page 117 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 6939 19968 33191 1.13 1.2E-01 BF347985.1 EST_HUMAN 602023112F1 NCI_CGAP_Bm67 Homo sapiens cDNA clone IMAGE:4158386 5' 7107 20312 33575 0.43 1.2E-01 AF295739.1 NT JC virus agnoprotein, VP2, VP3, VP1, large T anligen, and small t antigen genes, complete cds 7358 20363 33622 0.71 1.2E-01 H47799.1 EST_HUMAN yp80-04.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE: 193759 5' 7358 20363 33623 0.71 1.2E-01 H47799.1 EST_HUMAN yp80-04.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE: 193759 5' Homo sapiens partial ILF3 gene for interleukin enhancer binding fector 3 (altemative transcripts drbp76, 8039 20953 34268 0.64 1.2E-01 AJ271741.1 NT drbp78 gamma, drbp76 alpha and ILF3) 8306 21210 34546 0.5 1.2E-01 D87458.1 NT Human mRNA for KIAA0282 gene, partial cds 8306 21210 34547 0.5 1.2E-01 D87458.1 NT Human mRNA for KIAA0282 gene, partial cds 8472 21403 1.62 1.2E-01 BE007072.1 EST_HUMAN PM3-BN0137-290300-002-f09 BN0137 Homo sapiens cDNA wc99g03.x1 NCI_CGAP_Co3 Homo sapiens cDNA clone IMAGE:2326804 3' similar to SW:GST2_HUMAN 8540 21471 34812 3.35 1.2E-01 AI913753.1 EST_HUMAN Q99735 MICROSOMAL GLUTATHION S-TRANSFERASE II; 8586 21517 34861 0.66 1.2E-01 Q02369 SWISSPROT NADH-UBIQUINONE OXIDOREDUCTASE B22 SUBUNIT (COMPLEXI-B22) (CI-B22) 8884 21814 35165 0.74 1.2E-01 A1832681.1 EST_HUMAN at71b 10.x1 Barstead colon HPLRB7 Homo sapiens cDNA clone IMAGE:2377435 3' xc49d07.x1 NCI_CGAP_Eso2 Homo sapiens cDNA clone IMAGE:2587597 3' similer to gb:M13452 LAMIN A 8967 21897 10.92 1.2E-01 AW083652.1 EST_HUMAN (HUMAN); Staphyiococcus aureus plasmid pSK23 putative recombinase Sin (ain) gene, pertial cds; and transcriptional 8987 21916 4.31 1.2E-01 AF053772.1 NT regulalor QacR (qacR) and multidrung efflux protein QacB (qacB) genes, complete cds 9023 21952 35308 1.07 1.2E-01 J03956.1 NT N.crassa vacuoiar ATPase 57-Kd subunit (vma-2) gene, complete cds 9023 21952 35309 1.07 1.2E-01 J03956.1 NT N.crassa vacuoiar ATPase 57-Kd subunit (vma-2) gene, complete cds 9163 22091 0.92 1.2E-01 AJ271736.1 NT Homo sapiens Cq pseucloaulosomal region; segment 2/2 9247 22175 1.72 1.2E-01 LJ32714.1 NT Haemophilus influenzae Rd section 29 of 163 of the complete gename 9282 22210 0.85 1.2E-01 X15191.1 NT M.musculus DNA fragment of Apolipoprotein B gene 10100 22949 36338 2.16 1.2E-01 X77961.1 NT S.cerevisiae HXT5 gene 10510 23397 36809 1.47 1.2E-01 AV710857.1 EST_HUMAN AV710857 Cu Homo sapiens cDNA clone CuAAKE08 5' 11323 24242 2.68 1.2E-01 D26184.1 NT Yeast MPT5 gene for suppressor protein, complete cds 11504 24414 3.06 1.2E-01 BE962324.2 EST_HUMAN 601655578R1 NIH_MGC_65 Homo sapiens cDNA clone IMAGE:3846283 3' 11587 24498 1.63 1.2E-01 BF314481.1 EST_HUMAN 601900763F1 NIH_MGC_19 Homo sapiens cDNA clone IMAGE:4130103 5' 11702 24604 38079 2.65 1.2E-01 AF190493.1 NT Homo sapiens dynein Intermediate chaln DNAI1 (DNAI1) gene, exon 17 11578 24859 38143 1.76 1.2E-01 R40249.1 EST_HUMAN yf80c02s1 Soares infant brain 1NIB Homo sapiens cDNA CLONE IMAGE:28880 3' 11845 24695 38185 1.43 1.2E-01 994174 NT Homo saplens UDP-GabbetaGlcNAc beta 1.4- galactosyltrensiferase, polypetide 4 (B4GALT4), mRNA 11940 24784 1.41 1.2E-01 M66109.1 NT Rabbit glycogen-associsted protein phosphatase regulatory subunit (RG1) mRNA, complete cds 12221 25055 38554 1.51 1.2E-01 BF358736.1 EST_HUMAN CM2-ET0016-310500-206-b11 ET0016 Homo saplens cDNA Page 118 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 12250 25072 1.82 1.2E-01 AV858033.1 EST_HUMAN AV658033 GLC Homo sapiens cDNA clone GLCFIB12 3' 12570 25275 3.58 1.2E-01 AJ271736.1 NT Homo sapiens Xq pseudoautosomal region; segment 2/2 MACROPHAGE-STIMULATING PRO TEIN RECEPTOR PRECURSOR (MSP RECERTOR) (P185-R02) 12647 25903 31363 2.74 1.2E-01 Q04912 SWISSPROTS (CDW136) (CD136 ANTIGEN) Drosophila malanogasler strain Oregon R potential RNA-binding protein gene, complete cds; and syntaxin 12753 25389 1.79 1.2E-01 AF188892.1 NT gene, Partial cds 12755 13637 22.79 1.2E-01 AF039442.1 NT Homo sapiens colon cancer antigen NY-CO-45 mRNA, patial cds 12846 25458 2.72 1.2E-01 X53981.1 NT R. norvegicus NF68 gene for 68kDa neurofilament 12933 25502 31771 5.48 1.2E-01 AI299903.1 EST_HUMAN qn20g05.x1 MCI_CGAP_Lu5 Homo sapiens cDNA cione IMAGE: 1898840 3' 12954 25515 3.58 1.2E-01 L10187.1 NT Xanopus laevis integrin alphe 3 subunit mRNA, PARTIAL CDS 12959 25845 6.55 1.2E-01 O96433 SWISSPROT CYCLIN T 12985 25544 31752 1.63 1.2E-01 AE004428.1 NT Vibrio cholerae chromosome Il, section 85 of 93 of the complele chromosome 586 13654 26559 0.78 1.1E-01 AI561003.1 EST_HUMAN in18d08.x1 NCI_CGAP_Bm25 Homo sapiens cDNA clone IMAGE;2167983 3' nm08g11.s1 NCI_CGAP_Co10 Homo sapiens cDNA clone IMAGE:1059620 3' simiar to gb:X06985_ma1 638 13699 26605 2.48 1.1E-01 AA569006.1 EST_HUMAN HEME OXYGENASE 1 (HUMAN); 1081 14125 27063 1.8 1.1E-01 BF697308.1 EST_HUMAN602129847F1 NIH_MGC_56 Homo sapiens cDNA clone IMAGE:4286771 5' 1112 14154 1.47 1.1E-01 AL161560.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 60 1186 15894 27164 4.18 1.1E-01 AW972158.1 EST_HUMAN EST384142 MAGE resequences, MAGL Homo sapiens cDNA 1277 14311 27261 1.96 1.1E-01 D64004.1 NT Synechocystis sp. PCC6803 complete genome, 23/27, 2868767-3002965 1542 14572 27531 2.28 1.1E-01 EST_HUMAN AU140363 PLACE2 Homo sapiens cDNA clone PLACE2000403 5' 2198 15209 0.99 1.1E-01 AJ006701.1 NT Homo sapiens mRNA for putative serine/threonine prolein kinase, partial 2336 15343 3.96 1.1E-01 6755215 NT Mus muscuius pre T-cell antigen receptor alpha (Ptcra), mRNA 2567 15860 0.91 1.1E-01 6978686 NT Rattus norvegicus Procollagen Il alpha 1 (Col2a1), mRNA 2602 15600 1.2 1.1E-01 AW821909.1 EST_HUMAN RC0-ST0379-210100-032-g04 ST0379 Homo sapiens cDNA 3080 16131 29027 0.67 1.1E-01 F03265.1 EST_HUMAN HSC1RF022 normalized infant brain cDNA Homo sapiens cDNA clone c-1rf02 3' 3390 16433 2.14 1.1E-01 6753231 NT Mus musculus caclum channel, voltage-dependent, T type, alpha 1G subunit (Canca1g), mRNA 3482 16522 29421 3 1.1E-01 BE393166.1 EST_HUMAN 801308679F1 HIH_MGC_44 Homo sepiene cDNA clone IMAGE:3627066 5' 3513 16551 29451 1.39 1.1E-01 X62135.1 NT C.relnharditil nuclear gene on linkage group XIX yp62g08.s1 Soares fetal liver spleen 1NFLS Homo sapiers cDNA clone IMAGE:200414 3' similar to contains 3550 16588 29494 0.82 1.1E-01 R96946.1 EST_HUMAN Alu repelitive element, 3544 16660 29577 0.96 1.1E-01 Y07695.1 NT A. immersus gene for transpossase 3765 16797 1.08 1.1E-01 P97385 SWISSPROT ANNEXIN XI (CALCYCLIN-ASSOCIATED ANNEXIN 50) (CAP-50) 3772 16804 29891 1.8 1.1E-01 X52708.1 NT G. gallus gene encoding non-histone chromsomal protein HMG-14b, exons 4 and 5 4204 17222 30086 1.03 1.1E-01 AW819412.1 EST_HUMAN MR3-ST0290-290 100-025-g07 ST0290 Homo saplens cDNA Page 119 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLASTE No. NO: NO: Source Value 4204 17222 30087 1.03 1.1E-01 AW819412.1 EST_HUMAN MR3-ST0290-290100-025-g07 ST0290 Homo saplens cDNA mus muscuius major histocompatibility locus ciass Ill region:butyrophilin-like protain gene, partial cds: Notoh4, PBX2, RAGe, lysophetidio scid soyli transferase-alpha, palmiltoly-protein thioesterase 2 (PPT2), 4210 17227 0.65 1.1E-01 AF03001.1 NT CRER-RP, and tenascin X(TNX) genes, comple> 4351 17385 11.07 1.1E-01 AF167066.1 NT Drosophila melanogaster klarsicht protein (klar) mRNA, complete cds 4384 17398 30266 0.69 1.1E-01 AW802056.1 EST_HUMAN IL5-UM0070-020500-068-a08 UM0070 Homo sapiens cDNA Fugu rubripes neurofibromalcsis type 1 (NF1), A-kinase anchor protain (AKAP84), BAW protein (BAW), and 4683 17688 30555 0.8 1.1E-01 AF064564.2 NT WSB1 protein (WSB1) genes, complele cds 4946 17945 30803 1.28 1.1E-01 Y07695.1 NT A.immersus gene for transoposase 5143 18138 0.69 1.1E-01 AW026547.1 EST_HUMAN wv14h02x1 NCI_CGAP_Bm23 Homo sapiens cDNA clone IMAGE:2529565 3' Mus musculus major histocompatibility locus class Ill region:butyrophilin-like protein gene, pertial cds; Noich4, PBX2, RAGE, Lysophatidic acid acyi transferase-alpha, paimiloyl-protein thioesterase 2(PPT2), 5148 17227 0.82 1.1E-01 AF030001.1 NT CREB-RP, and tanascin X (TNX) ganes, comple> 5241 18228 31076 0.76 1.1E-01 AW819412.1 EST_HUMAN MR3-ST0290-290100-025-g07 ST0290 Homo sapiens cDNA 5241 18228 31077 0.76 1.1E-01 AW819412.1 EST_HUMAN MR3-ST0290-290100-025-g07 ST0290 Homo sapiens cDNA 5303 18287 31140 1.02 1.1E-01 P70281 SWISSPROT SYNAPTONEMAL. COMPLEXPROTEIN 3 (SCP-3 PROTEIN) nx76a03.s1 NCI_CGAP_Ew1 Homo sapiens cDNA clone IMAGE:1268140 similar to contains Alu repetitive 5867 18938 1.53 1.1E-01 AA747216.1 EST_HUMAN element; contains element MER35 repetitive element ; 5942 19009 32128 1.26 1.1E-01 AF020927.1 NT 6 Homo sapiens diacylglyoerol kinase 3 (DAGK3) gene, exon 6 5982 19047 32171 0.81 1.1E-01 AL110965.1 NT Boirytis cinerea strain T4cDNA library under conditions of nitrogen deprivation 6017 19079 32204 0.76 1.1E-01 BF339519.1 EST_HUMAN 502039176F1 NCI_CGAP brn64 Homo sapiens cDNA clone IMAGE;4186618 5' 6017 19079 32205 0.76 1.1E-01 BF339519.1 EST_HUMAN 502039176F1 NCI_CGAP brn64 Homo sapiens cDNA clone IMAGE;4186618 5' 6049 19111 32240 1.96 1.1E-01 X68851.1 NT S.pombe ste8 gene encoding protein kinase 6086 19147 32282 4.55 1.1E-01 M86533.1 NT Providencia rettgeri penicillin G amidase gene 6259 19310 32474 1.59 1.1E-01 AJ007973.1 NT Homo sapiens LGMD2B gene 6281 19332 32498 1.8 1.1E-01 BE769152.1 EST_HUMAN PM3-FT0024-130600-004-f12 FT0024 Homo sapiens cDNA 6301 19352 32521 8.23 1.1E-01 AW853599.1 EST_HUMAN PM3-FT0024-130600-004-f12 FT0024 Homo sapiens cDNA 6692 19728 32928 0.61 1.1E-01 AL163282.2 NT homo saplens chromosome 21 segment HS21C082 6700 19736 32938 1.43 1.1E-01 AF035746.1 EST_HUMAN AF086746 Human selivary gland cell line HSG Homo saiens cDNA clone RL43 6746 19780 32993 0.81 1.1E-01 AI216307.1 EST_HUMAN qg76d06.x1 Soeres_NFL_T_GBC_S1 Homo spiens cDNA clone IMAGE; 18410099 3' 6894 19924 33139 4.03 1.1E-01 O69635 SWISSPROT ACETYL-COENZYME A SYNTHETASE (ACETATE-COA LIGASE0 (ACYL-ACTIVATING ENZYME) 7001 20028 3.2 1.1E-01 AF032922.1 NT Homo sapiens syntaxin 4 binding protein UNC-18c (UNC-18c) mRNA, complete cds 7103 20309 33570 2.17 1.1E-01 11432372 NT Homo sepiens phosphatidylinositol glycan, class B (PIGB), mRNA 7400 20099 33333 0.61 1.1E-01 AE002155.1 NT Ureapiasma urealyticum section 58 of 59 of the completa genome Page 120 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 7400 20099 33334 0.61 1.1E-01 AE002155.1 NT Ureaplasma urealyticurm section 56 of 59 of the complete genome 7551 25961 0.89 1.1E-01 BF382758.1 EST_HUMAN 601816524F1 NIH_MGC_56 Homo sapiens cDNA clone IMAGE:4050653 5' 7685 25674 33919 0.98 1.1E-01 AP00006.1 NT Pyrococcus horikoshli OT3 genomic DNA, 116601-1485000 nt. poeition (6/7) 7963 20885 34195 8.05 1.1E-01 BF684628.1 EST_HUMAN 6021 40976F1 NIH_MGC_46 Homo sapiens cDNA clone IMAGE: 4302019 5' 7963 20885 34196 8.05 1.1E-01 BF684628.1 EST_HUMAN 6021 40976F1 NIH_MGC_46 Homo sapiens cDNA clone IMAGE: 4302019 5' 8023 20939 34254 0.52 1.1E-01 AA995908.1 EST_HUMAN ou44g03.s1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE: 1629172 3' 8104 21018 34343 1.87 1.1E-01 P41067 SWISSPROT TRAB PROTEIN 8149 21058 0.72 1.1E-01 Z14098.1 NT B. subtilis gene encoding hypothetical polyketide synthase ah31b06.s1 Soares_parathyroid_tumor_NbHPA Homo sapiens cDNA cone 1240403 3' similar to gb:J03483 8150 21059 34390 3.26 1.1E-01 AA788784.1 EST_HUMAN CHROMOGRANIN A PRECURSOR (HUMAN); 8327 21232 34567 0.63 1.1E-01 BE782290.1 EST_HUMAN 601470055F1 NIH_MGC_67 Homo sapiens cDNA clone IMAGE:3873229 5' 8546 21477 34819 0.8 1.1E-01 U67492.1 NT Methanococcus jannaschil section 34 of 150 of the complete genome 8786 21716 35063 1.64 1.1E-01 AA493574.1 EST_HUMAN nh04g10.s1 NCI_GGAP_Thyl Homo sapiens cDNA clone IMAGE:943362 8786 21716 35064 1.64 1.1E-01 AA493574.1 EST_HUMAN nh04g10.s1 NCI_GGAP_Thyl Homo sapiens cDNA clone IMAGE:943362 8830 21760 35106 1.42 1.1E-01 X91233.1 NT H. saplens IL 15 gene 8870 21800 1.1 1.1E-01 AW817918.1 EST_HUMAN PM1-ST0270-080200-001-f09 ST0270 Homo sapiens cDNA 8925 21855 35211 1.96 1.1E-01 al134349.1 EST_HUMAN DKFZp547P194_r1 547 (synonym: hfbr1) Homo sapiens cDNA clone DKFZp5470194 5' Pediococcus acidilectici H plesmid pSMB74 pediocin AcH production (pap) gene cluster papA, papB, papC 9377 22305 35666 1.95 1.1E-01 U02482.1 NT and papD genes, complele cds wf48c01.x1 Soares_NFL_T_GBC_S1 Homo sapiens CDNA cione IMAGE:2358616 3' skimilar to contains Alu 9469 22397 35760 1.28 1.1E-01 AI807474.1 EST_HUMAN repetitive element; 9560 22487 35848 0.6 1.1E-01 AF050081.1 NT Homo sapiens C16orf3 large protein mRNA, complete cds 9595 22521 35884 2,84 1.1E-01 AA192153.1 EST_HUMAN zp93b12.r1 Strstagene muscle 937209 Homo sapiens cDNA clone IMAGE:627743 5' 9595 22521 35885 2,84 1.1E-01 AA192153.1 EST_HUMAN zp93b12.r1 Strstagene muscle 937209 Homo sapiens cDNA clone IMAGE:627743 5' 9578 22604 35977 0.62 1.1E-01 Y12727.1 NT P. furiosus partial dph5 gene and argF gene yd19h03.s1 Soares felal liver spleen 1NFLS Homo saplens cDNA cions IMAGE:108725 3' similar to 9708 22633 36013 4.43 1.1E-01 T72675.1 EST_HUMAN gb:M81181 SODIUM/POTASSIUM-TRANSPORTING ATPASE BETA-2 (HUMAN); 9733 22658 0.73 1.1E-01 BE893260.1 EST_HUMAN 601436972F1 NIH_MGC_72 Homo saplens cDNA clone IMAGE:3922048 5' 9956 22861 0.98 1.1E-01 BE142305.1 EST_HUMAN CM3-HT0142-271099-026-g11 HT0142 Homo sapiens cDNA 10029 22929 2.47 1.1E-01 BF085149.1 EST_HUMAN MR2-GN0027-04900-005-a08 GN0027 Homo sapiens cDNA 10421 23310 0.64 1.1E-01 NT Arabidopsls thaliana DNA chromosome 4, contig fragment No. 43 10702 23588 1.49 1.1E-01 R80590.1 EST_HUMAN yi96a09.s1 Soares placanta Nb2HP Homo sapiens cDNA clone IMAGE:147064 3' 10825 23711 37138 1.14 1.1E-01 U60529.1 NT Ceratitie cepitata yoyo retrotrensposon geg-like, pol-like and env-like genes, complets cds 11244 16131 29027 2.09 1.1E-01 f03265.1 1.1E-01 HSC1RF022 normalized infant brain cDNA Homo sapiens cDNA clone c-1rf02 3' Page 121 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 11359 24277 2.21 1.1E-01 AF169032.1 NT Carasslus auratus activin beta A precursor, mRNA, complete cds yh35f12.r1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE:1317595' similar tocontains Alu 11481 24394 37844 3.55 1.1E-01 R23708.1 EST_HUMANrepetitive element; contains TAR1 repetitie element ; 11490 24402 37853 1.79 1.1E-01 6981351 NT Rattus norvegious Phosphofructokinase, liver, B-type (Pffd), mRNA 11656 24562 38033 2.69 1.1E-01 Z11910.1 NT Z.mabilis tgt and lig genes encoding tRNA guanine transglycosylase and DNA ligase 11656 24562 38034 2.69 1.1E-01 Z11910.1 NT Z.mabilis tgt and lig genes encoding tRNA guanine transglycosylase and DNA ligase 11751 24652 98133 2.61 1.1E-01 P17437 SWISSPROT SKIN SECRETORY PROTEIN XP2 PRECURSOR (APEG PROTEIN) 12099 24940 1.53 1.1E-01 AL161511.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 23 12343 25136 1.64 1.1E-01 AA192153.1 EST_HUMAN zp93b12.r1 Stratagene muscle 937209 Homo sapiens cDNA clone IMAGE:627743 5' 12444 25199 1.89 1.1E-01 BE767023.1 EST_HUMAN RC2-NT0112-120600-014-f03 NT01 12 Homo sapiens cDNA 12676 25731 1.99 1.1E-01 BE974556.1 EST_HUMAN 601680551R2 NIH_MG_83 Homo sapiens cDNA clone IMAGE:3950804 3' 1229 14266 2.23 1.0E-01 O62855 SWISSPROT DEOXYRIBONUCLEASE II PRECURSOR (DNASE II) (ACID DNASE) (LYSOSOMAL DNASE II) ws08d01.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2496577 3' similar to contains MER7.t3 199 14332 27278 2.06 1.0E-01 AI985499.1 EST_HUMAN MER7 repetitive element ; 1419 14450 27404 2.07 1.0E-01 AL161504.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 16 2512 15513 28516 1.08 1.0E-01 AW451365.1 EST_HUMAN UI-H-BI3-alc-d-07-0-UI.s1 NCI_CGAP_Sub5 Homo sapiens cDNA clone IMAGE:2736420 3' 3572 16609 29512 1.45 1.0E-01 BF033991.1 EST_HUMAN 601456301F1 NIH_MGC_66 Homo sapiens cDNA clone IMAGE:3859849 5' 3783 16814 29701 0.98 1.0E-01 BF239818.1 EST_HUMAN 601906489F1 NIH_MGC_54 Homo sapiens cDNA clone IMAGE:4134071 5' 4036 17063 29952 3.39 1.0E-01 BF365703.1 EST_HUMAN QV2-NT0048-160800-316-e05 NT0048 Homo sapiens cDNA 4513 17522 30387 1.05 1.0E-01 AE002265.2 NT Chlamydophila pneumoniae AR39, section 91 of 94 of the complete genome 4670 17675 0.76 1.0E-01 AI792349.1 EST_HUMAN an32c04.y5 Gessler Wilms tumor Homo sapiens cDNA clone IMAGE:1700358 5' 4825 17826 30694 1.33 1.0E-01 U50450.1 NT Drosophila melanogaster tyrosine kinase p45 isoform (fer) mRNA, complete cds 5030 18027 30885 2.62 1.0E-01 AW952344.1 EST_HUMAN EST364414 MAGE resequences, MAGB Homo sapiens cDNA 5300 18284 31135 0.68 1.0E-01 BE389100.1 EST_HUMAN 601286969F1 NIH_MGC_44 Homo sapiens cDNA clone IMAGE:3613552 5' 5504 18583 8.68 1.0E-01 W86490.1 EST_HUMAN zh62h04.s1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:416695 3' 5603 18679 0.64 1.0E-01 X54015.1 NT X.campestris genes for sensor and regulator protein 5685 18758 0.43 1.0E-01 Q36860 SWISSPROT CYTOCHROME C OXIDASE POLYPEPTIDE III 6095 19156 0.99 1.0E-01 AK024472.1 NT Homo sapiens mRNA for FLJ00065 protein, partial cds 6257 19309 32473 12.02 1.0E-01 AF274875.1 NT Homo sapiens growth factor receptor-bound protein 7 (GRB7) gene, complete cds zv41g10.s1 Soares ovary tumor NbHOT Homo sapiens cDNA clone IMAGE:766258 3' similar to contains 6592 19633 32815 0.84 1.0E-01 AA481879.1 EST_HUMAN L1.t3 L1 repetitive element ; 6606 19647 32830 0.68 1.0E-01 AA406039.1 EST_HUMAN zu67c12.s1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:743062 3' yh34h06.r1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE:131675 5' similar to contains Alu 7369 20363 1.63 1.0E-01 R23821.1 EST_HUMAN repetitive element; Page 122 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 8200 21106 2.05 1.0E-01 Y12488.1 NT M.musculus whn gene 8324 21229 34563 0.51 1.0E-01 AJ011400.1 NT Bos taurus mRNA for b17.2 subunit of NADH:ubiquinone oxidoreductase complex (complex I) 8324 21229 34564 0.51 1.0E-01 AJ011400.1 NT Bos taurus mRNA for b17.2 subunit of NADH:ubiquinone oxidoreductase complex (complex I) 8420 21323 34656 0.41 1.0E-01 BF128224.1 EST_HUMAN 601810459R1 NIH_MGC_46 Homo sapiens cDNA clone IMAGE:4053494 3' ak32g01.s1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1407696 3' similar to gb:M34182 CAMP- 8512 21443 34785 0.69 1.0E-01 AA861091.1 EST_HUMAN DEPENDENT PROTEIN KINASE, GAMMA-CATALYTIC SUBUNIT (HUMAN); 8744 21674 0.6 1.0E-01 4758365 NT Homo sapiens fibroblast growth factor 13 (FGF13) mRNA xl09b01.x1 NCI_CGAP_Ut4 Homo sapiens cDNA clone IMAGE:2675689 3' similar to gb:X17206 40S 9061 21990 1.26 1.0E-01 AW189797.1 EST_HUMAN RIBOSOMAL PROTEIN 34 (HUMAN); contains TAR1.t3 TAR1 repetitive element ; 9727 22652 36035 1.23 1.0E-01 AF102855.2 NT Rattus norvegicus synaptic SAPAP-interacting protein Synamon mRNA, complete cds 10028 22928 36316 0.57 1.0E-01 R44993.1 EST_HUMAN yg33h04.s1 Soares infant brain 1NIB Homo sapiens cDNA clone IMAGE:34549 3' 10038 22938 2.14 1.0E-01 M76729.1 NT Human pro-alpha-1- (V) collagen mRNA, complete cds 10079 22872 2.71 1.0E-01 AE001501.1 NT Hellcobacter pylort, strain J99 section 62 of 132 of the complete genome 10093 22943 36331 0.77 1.0E-01 W01955.1 EST_HUMAN zc66c10.s1 Soares_fetal_heart_NbHH19W Homo sapiens cDNA clone IMAGE:327282 3' 10336 23225 36640 2.03 1.0E-01 BF240154.1 EST_HUMAN 601905661F1 NIH_MGC_54 Homo sapiens cDNA clone IMAGE:4133487 5' 10444 23333 36750 9.79 1.0E-01 AB046799.1 NT Homo sapiens mRNA for KIAA1579 protein, partial cds 10444 23333 36751 9.79 1.0E-01 AB046799.1 NT Homo sapiens mRNA for KIAA1579 protein, partial cds 10641 23527 1.21 1.0E-01 AW967425.1 EST_HUMAN EST369615 MAGE resequences, MAGE Homo sapiens cDNA yb29a06.s1 Stratagene fetal spleen (#937205) Homo sapiens cDNA clone IMAGE: 72562 3' similar to 10646 23532 36964 0.56 1.0E-01 T51952.1 EST_HUMAN contains Alu repetitie element 10820 23706 37133 1.27 1.0E-01 BE792750.1 EST_HUMAN 601584604F1 NIH_MGC_7 Homo sapiens cDNA clone IMAGE:3939096 5' 11101 24032 1.68 1.0E-01 AU159127.1 EST_HUMAN AU159127 THYRO1 Homo sapiens cDNA clone THYRO1000895 3' 11472 24385 37834 2.34 1.0E-01 BF242946.1 EST_HUMAN 601877703F1 NIH_MGC_55 Homo sapiens cDNA clone IMAGE:4106089 5' 11472 24385 37835 2.34 1.0E-01 BF242946.1 EST_HUMAN 601877703F1 NIH_MGC_55 Homo sapiens cDNA clone IMAGE:4106089 5' 11837 24688 381774.8 1.0E-01 BE790543.1 EST_HUMAN 601582558F1 NIH_MGC_7 Homo sapiens cDNA clone IMAGE:3936734 5' 12430 25505 3 1.0E-01 BE537719.1 EST_HUMAN 601065554F1 NIH_MGC_10 Homo sapiens cDNA clone IMAGE:3451933 5' 12658 253301.89 1.0E-01 Xo0854.1 NT Drosophila melanogaster ftz gene 12909 25896 4 1.0E-01 U52691.1 NT Gonyaulax polyedra putative type-1 serinathreonine phosphatase (PP1)mRNA, complete cds 12937 25505 2.82 1.0E-01 BE537719.1 EST_HUMAN 601065554F1 NIH_MGC_10 Homo sapiens cDNA clone IMAGE:3451933 5' 12996 25874 30.18 1.0E-01 U66834.1 NT Saccharomyces cerevisiae suppressor of ABF1 (SAB2) gene, complete cds 13043 25578 8.53 1.0E-01 AP001507.1 NT Bacillus halodurans genomio DNA, secton 1/14 Drosophila melanogaster cAMP-dependent protein kinase type II regulatory subunit (pka-RII) mRNA, 2829 15818 28813 1.39 9.9E-02 AF274008.1 NT complete cds 2835 15824 28820 1.29 9.9E-02 BE545554.1 EST_HUMAN 601070219F1 NIH_MGC_12 Homo sapiens cDNA clone IMAGE:3456365 5' Page 123 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 2835 15824 28821 1.29 9.9E-02 BE545554.1 EST_HUMAN 601070219F1 NIH_MGC_12 Homo sapiens cDNA clone IMAGE:3456365 5' 3311 16358 29259 1.23 9.9E-02 AF099810.1 NT Homo sapiens neurexin III-alpha gene, partial cds 4032 17059 29948 0.9 9.9E-02 AI821637.1 EST_HUMANzu45c03.x5 Soares ovary tumor NbHOT Homo sapiens cDNA clone IMAGE:740932 3' 7185 20185 33429 0.49 9.9E-02 BE613498.1 EST_HUMAN 601504252F1 NIH_MGC_71 Homo sapiens cDNA clone IMAGE:39060845' 7309 18477 31299 8.22 9.9E-02 D63710.1 NT Aspergillusterreus BSD mRNA for blasticidin S deaminase, complete cds xd43c09.x1 NCI_CGAP_Ov23 Homo sapiens cDNA clone IMAGE:2596528 3' similar to contains Alu 8494 21425 34765 0.52 9.9E-02 AW103088.1 EST_HUMAN repetitive element; contains element MIR MIR repetitive element ; xd43c09.x1 NCI_CGAP_Ov23 Homo sapiens cDNA clone IMAGE:2596528 3' similar to contains Alu 8494 21425 34766 0.52 9.9E-02 AW103088.1 EST_HUMAN repetitive element; contains element MIR MIR repetitive element ; 9799 22763 36148 1.86 9.9E-02 6755111 NT Mus musculus phospholipidtransfer protein (Pltp), mRNA 585 13653 1.16 9.8E-02 X56338.1 NT O.sativa RAmy3C gene for alpha-amylase 3188 16237 29131 4.99 9.8E-02 AF184274.1 NT Daucuscarota leucoanthocyanidin dioxygenase 2 (LDOX)mRNA, LDOX-2 allele, complete cds 4323 17337 30201 9.42 9.8E-02 AF257329.1 NT Leptospheeria maculans beta-tubulin mRNA, complete cds 4323 17337 30202 9.42 9.8E-02 AF257329.1 NT Leptospheeria maculans beta-tubulin mRNA, complete cds 7902 20827 0.93 9.8E-02 X54133.1 NT Human HPTP delta mRNA for protein tyrosine phosphatase delta 9796 22760 1.08 9.8E-02 M61943.1 NT Human laminin B1 chain gene, exon 26 11892 23992 37431 2.03 9.8E-02 BF037421.1 EST_HUMAN 601460793F1 NIH_MGC_6 Homo sapiens cDNA clone IMAGE:3864287 5' 12402 25174 1.7 9.8E-02 8393751 NT Rattus norvegicus microtubule-associated protein tau (Mapt), mRNA 1379 14411 27366 1.33 9.7E-02 AB006808.1 NT Aloe arborescens mRNA for NADP-malic enzyme, complete cds 1608 14638 0.99 9.7E-02 4503710 NT Homo sapiens fibroblast growth factor receptor 3 (achondroplasia, thanatophoric dwarfism) (FGFR3) mRNA 2278 15287 28295 2.33 9.7E-02 BE168660.1 EST_HUMAN QV1-HT0516-070300-095-a04 HT0516 Homo sapiens cDNA 4068 17094 4.75 9.7E-02 Q99795 SWISSPROT CELL SURFACE A33 ANTIGEN PRECURSOR (GLYCOPROTEIN A33) Caulobacter crescentus thymydilate kinase (tmk) and DNA polymerase III delta prime subunit (dnaC) genes, 5529 18608 31456 0.93 9.7E-02 AF099189.1 NT complete cds Caulobacter crescentus thymydilate kinase (tmk) and DNA polymerase III delta prime subunit (dnaC) genes, 5529 18608 31457 0.93 9.7E-02 AF099189.1 NT complete cds 6247 19300 32460 1.38 9.7E-02 AW954476.1 EST_HUMAN EST366546 MAGE resequences, MAGC Homo sapiens cDNA 7679 20613 33912 3.3 9.7E-02 Z99119.1 NT Bacillus subtilis complete genome (section 16 of 21): from 2997771 to 3213410 8562 21493 34835 1.62 9.7E-02 N22798.1 EST_HUMAN yw41c03.s1 Weizmann Olfactory Epithelium Homo sapiens cDNA clone IMAGE:254788 3' 8562 21493 34836 1.62 9.7E-02 N22798.1 EST_HUMAN yw41c03.s1 Weizmann Olfactory Epithelium Homo sapiens cDNA clone IMAGE:254788 3' wx78b06.x1 NCI_CGAP_Ov38 Homo sapiens cDNA clone IMAGE:2549747 3' similar to gb:X52851_mai 9408 22336 35700 1.25 9.7E-02 AI953984.1 EST_HUMAN PEPTIDYL-PROLYL CIS-TRANS ISOMERASE A (HUMAN); 11642 24548 2.11 9.7E-02 U58337.1 NT Mus musculus ligatin (Lgtn) mRNA, partial cds Page 124 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 2029 15046 28041 1.01 9.6E-02 AI080721.1 EST_HUMANoz47d11.x1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:1678485 3' 2029 15046 28042 1.01 9.6E-02 AI080721.1 EST_HUMANoz47d11.x1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:1678485 3' 4454 17464 30321 8.84 9.6E-02 Z32686.2 NT Proteus mirabilis fimbrial operon, strain HI4320 5122 1811830960 1.47 9.6E-02 AW966230.1 EST_HUMAN EST378303 MAGE resequence, MAGI Homo sapiens cDNA 5296 18281 31131 0.74 9.6E-02 BE061729.1 EST_HUMAN RC5-BT0254-031099-011-a03 BT0254 Homo sapiens cDNA 6343 19393 2.9 9.6E-02 BE910039.1 EST_HUMAN 601498088F1 NIH_MGC_70 Homo sapiens cDNA clone IMAGE:3900165 5' 8402 21305 0.48 9.6E-02 6678753 NT Mus musculus lymphocyte antigen 78 (Ly78), mRNA 8947 21877 0.6 9.6E-02 AU137084.1 EST_HUMAN AU137084 PLACE1 Homo sapiens cDNA clone PLACE1005740 5' 10073 22988 36383 2.18 9.6E-02 AV687898.1 EST_HUMAN AV687898 GKC Homo sapiens cDNA clone GKCAAH02 5' 10384 23273 1.71 9.6E-02 BE894895.1 EST_HUMAN 601434080F1 NIH_MGC_72 Homo sapiens cDNA clone IMAGE:3919363 5' 10542 23428 36848 1.69 9.6E-02 AJ243211.1 NT Homo sapiens DMBT1 candidate tumoursuppressor gene, exons 1 to 55 10542 23428 36849 1.69 9.6E-02 AJ243211.1 NT Homo sapiens DMBT1 candidate tumoursuppressor gene, exons 1 to 55 10620 23506 36940 0.64 9.6E-02 BF677270.1 EST_HUMAN602086769F1 NIH_MGC_83 Homo sapiens cDNA clone IMAGE:4250969 5' 10648 23534 36966 2 9.6E-02 AB013985.1 NT Antirrhinum majus transposon Tam3 pseudogene for transposase (in S-5 copy) 10648 23534 36967 2 9.6E-02 AB013985.1 NT Antirrhinum majus transposon Tam3 pseudogene for transposase (in S-5 copy) 10751 23637 37070 4.05 9.6E-02 P08174 SWISSPROT COMPLEMENT DECAY-ACCELERATING FACTOR PRECURSOR(CD55) 11183 24109 37556 6.87 9.6E-02 Z79702.1 NT Mycobacterium tuberculosis H37Rv complete genome; segment 102/162 12141 24981 384811.43 9.6E-02 AA625755.1 EST_HUMAN zu91g01.s1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:745392 3' 12974 25536 1.87 9.6E-02 H14599.1 EST_HUMAN ym19h03.s1 Soares infant brain 1NIB Homo sapiens cDNA clone IMAGE:48653 3' 13103 25618 3.56 9.6E-02 AJ300197.1 NT Xanopus laevismRNA for dickkopf2 (dkk2 gene) 4192 17212 30079 2.37 9.5E-02 Aw992395.1 EST_HUMAN CM2-BN0023-050200-087-f12 BN0023 Homo sapiens cDNA 5862 18933 32052 0.88 9.5E-02 P51854 SWISSPROT TRANSKETOLASE 2 (TK 2) (TRANSKETOLASE RELATED PROTEI) 7684 20618 33918 4.969.5E-02 AB003473.1 NT Trimeresurus flavoviridis DNA for phospholipase A2 inhibitor, complete cds 8001 20919 34236 7.96 9.5E-02 AL161538.2 NT Arabidopsisthaliana DNA chromosome 4, config fragment No. 38 8152 18933 32052 0.88 9.5E-02 P51854 SWISSPROT TRANSKETOLASE 2 (TK 2)(TRANSKETOLASE RELATED PROTEIN) 8460 21391 34732 2.46 9.5E-02 BF035861.1 EST_HUMAN 601453642F1 NHI_MGC_66 Homo sapiens cDNA clone IMAGE:3857243 5' 8460 21391 34733 2.46 9.5E-02 BF035861.1 EST_HUMAN 601453642F1 NHI_MGC_66 Homo sapiens cDNA clone IMAGE:3857243 5' 11122 24052 37497 2.86 9.5E-02 BF035861.1 EST_HUMAN 601453642F1 NHI_MGC_66 Homo sapiens cDNA clone IMAGE:3857243 5' 11122 24052 37498 2.86 9.5E-02 BF035861.1 EST_HUMAN 601453642F1 NHI_MGC_66 Homo sapiens cDNA clone IMAGE:3857243 5' 12226 25060 38558 1.83 9.5E-02 U37070.1 NT Human transforming growth factor-beta type II receptor (TGF-beta RII), promoter region 13031 25570 1.79 9.5E-02 AF272732.1 NT Arabidopsisthaliana putative transcription factor (MYB110) mRNA,c omplete cds 1857 14879 27858 3.42 9.4E-02 BF671063.1 EST_HUMAN 602150882F1 NIH_MGC_81 Homo sapiens cDNA clone IMAGE:4291917 5' 3949 16977 29861 6.79 9.4E-02 Z33059.1 NT M.capricolum DNA for CONTIG MC073 5182 18174 31019 0.71 9.4E-02 6753517 NT Mus musculus coding region determinant-binding protein (Crodbp), mRNA Page 125 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 6572 19613 32799 0.82 9.4E-02 AF097363.1 NT Trilicum aestivum heat shock protein 101 (Hsp101a) mRNA, complete cds 8036 20951 34266 0.62 9.4E-02 L78833.1 NT Human BRCA1, Rho7 and vatl genes, complete cds, and ipf35 gene, partial cds 9162 220901.8 9.4E-02 Z46863.1 NT Acinetobacter sp. cysD, cobQ, sodM, lysS, rubA, rubB, estB, oxyR, ppk, mtgA, ORF2 and ORF3 genes 11372 20951 34266 2.5 9.4E-02 L78833.1 NT Human BRCA1, Rho7 andvatl genes, complete cds, and ipf35 gene, partial cds 12298 25814 7.24 9.4E-02 U31815.1 NT Rattus norveglcus clacium channel alpha-1C subunit (ROB2)mRNA, partial cds 13096 25612 31735 2.36 9.4E-02U27699.1 NT Human paphBGT-1 betaine-GABA transporter mRNA, complete cds 3031 16083 2.22 9.3E-02 4809280 NT Homo sapiens BAI1-associated protein 3 (BAIAP3) mRNA 3075 16127 7.87 9.3E-02 6912525 NT Homo sapiens nasopharyngeal epithelium specific protein 1 (NESG1), mRNA 3301 16348 29253 1.91 9.3E-02 BF575511.1 EST_HUMAN 602133086F1 NIH_MGC_81 Homo sapiens cDNA clone IMAGE:4288269 5' 4245 17261 30127 1.3 9.3E-02 BE543175.1 EST_HUMAN 601069147F1 NIH_MGC_12 Homo sapiens cDNA clone IMAGE:3455435 5' 4250 17266 30133 3.6 9.3E-02 BE391943.1 EST_HUMAN 601286082F1 NIH_MGC_44Homo sapiens cDNA clone IMAGE:3607653 5' 4250 17266 30134 3.6 9.3E-02 BE391943.1 EST_HUMAN 601286082F1 NIH_MGC_44Homo sapiens cDNA clone IMAGE:3607653 5' 4848 17849 2.35 9.3E-02AV732224.1 EST_HUMAN AV732224 HTF Homo sapiens cDNA clone HTFAUA06 5' 5136 18132 30974 1 9.3E-02 AF115443.1 NT HIV-1 isolate Br112 from Brazil gag protein (gag) gene, partial cds 5859 18930 1.09 9.3E-02 AP001507.1 NT Bacillus haiodurans genomic DNA, section 1/14 8374 21278 34610 0.4 9.3E-02 M75984.1 NT Human hepatocyte growth factor gene exon 18, 3' end 8391 21295 34626 0.61 9.3E-02 AL163210.2 NT Homo sapiens chroosome 21 segment HS21C010 8823 21753 35099 0.67 9.3E-02 AW566007.1 EST_HUMAN EST69 Human FEtal Brain MATCHMAKER cDNA LibraryHomo sapiens cDNA 9669 22595 0.52 9.3E-02 AL113179.1 NT Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation 10232 23123 36525 2.62 9.3E-02 BE962631.2 EST_HUMAN 601655988R1 NIH_MGC_66 Homo sapiens cDNA clone IMAGE:3855981 3' 10688 23574 37003 4.48 9.3E-02 Q15034 SWISSPROT HYPOTHETICAL PROTEIN KIAA0032 10688 23574 37004 4.48 9.3E-02 Q15034 SWISSPROT HYPOTHETICAL PROTEIN KIAA0032 10809 23695 4.05 9.3E-02 AW206117.1 EST_HUMAN UI-H-BI1-afx-h-05-0-UI.s1 NCI_CGAP_Sub3 Homo sapiens cDNA clone IMAGE:2723553 3' 12537 25748 2.76 9.3E-02 AJ249850.1 NT Pholobacterium damselae subsp. damselae partial gyrB gne for DNA gyrase B subunit 12879 25772 22.87 9.3E-02 AW468850.1 EST_HUMAN hd28h12.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2910887 3' Mus musculus major histocompatibility locus class II region; FAs-binding protein Daxx (DAXX) gene, partial cds; Bing1 (BING1), tapasin (tapasin), RAlGDS-like factor (RLF), KE2 (KE2), BING4 (BING4), beta1, 3- 13059 25813 3.15 9.3E-02 AF100956.1 NT galactosyl transferase (beta1,3-galactosyl tr> 247 13345 26255 5.64 9.2E-02 U60315.1 NT Molluscum contagiosum virus subtype 1, complete genome 247 13345 26256 5.64 9.2E-02 U60315.1 NT Molluscum contagiosum virus subtype 1, complete genome 247 13345 26257 5.64 9.2E-02 U60315.1 NT Molluscum contagiosum virus subtype 1, complete genome 2240 15250 2.02 9.2E-02 R54156.1 EST_HUMAN yg98f07.r1 Soares infant brain 1NIB Homo sapiens cDNA clone IMAGE:41618 5' 3222 16270 29169 4.67 9.2E-02 Q28631 SWISSPROT MAJOR EPIDIDYMIS-SPECIFIC PROTEIN E4 (EPIDIDYMAL PROTEIN BE-20) Page 126 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 3351 16397 29297 1.11 9.2E-02 AA534354.1 EST_HUMAN nf79e0.1s1 NCI_CGAP_Co3 Homo sapiens cDNA clone IMAGE:926136 3' 3647 16683 1.21 9.2E-02 6755215 NT Mus muscuius pre T-cell receptor alpha (Plcra), mRNA 4338 17352 1.5 9.2E-02 U92048.1 NT Human herpesvirus 1 strain KOS-63, Ialency-associated transcript, promoter region 4412 17423 0.67 9.2E-02 BE299722.1 EST_HUMAN 600944365F1 NIH_MGC_17 Homo sapiens cDNA clone IMAGE:2960176 5' 4750 17756 30615 1.81 9.2E-02 X96402.1 NT G.gallus Mla-CK gene ya99c09.ra Stratagene placenta (#937225) Homo sapiens cDNA clone IMAGE:69808 5' similar to similar to 8587 21518 34862 2.03 9.2E-02 T49920.1 EST_HUMAN gb:X56009 GUANINE NUCLEOTIDE-BINDING PROTEIN G(S), ALPHA SUBUNIT (HUMAN) 8755 21685 35028 2.03 9.2E-02 X95256.1 NT H.vulgare xylose isomerase gene 13045 25966 1.57 9.2E-02 11456872 NT Podospora ansperina mitochondrion, complete genome 446 13113 26000 3 9.1E-02 X77665.1 NT O. ounioulue k12 keralin gene 2440 15444 28444 1.27 9.1E-02 P78985 SWISSPROT 6-PHOSPHOFRUCTOKINASE (PHOSPHOFRUCTOKINASE) (PHOSPHOHEXOKINASE) 3737 16769 1.4 9.1E-02 AW372569.1 EST_HUMAN PM2-BT0349-161299-001-402 BT0349 Homo sapiens cDNA 4598 17606 30463 2.1 9.1E-02 AL161554.2 NT Arabidopsis thallane DNA chromosome 4, conlig fragment No. 54 Homo sapiens MSH55 gene, partial cds; and CLIC1, DDAH, G5b, G6c, G5b, G6d, G6e, G6f, BAT5, G5b, 5932 18999 32119 1.65 9.1E-02 AF129756.1 NT CSK2B, BAT4, G4, Apo M, BAT3, BAT2, AIF-1, 1C7, LST-1, LTB, TNF, and LTA genes, complete cds 7690 25982 0.45 9.1E-02 AF029308.1 NT Homo sapiens chromosome 9 duplication of the T cell receptor beta locus and trypsinogen gene familles 7783 20712 34014 11.62 9.1E-02 AW160858.1 EST_HUMAN au74a05.y1 Schneider fetal brain 00004 Homo sapiens cDNA clone IMAGE:2781958 5' 8128 21038 34367 0.87 9.1E-02 AP000061.1 NT Aeropyrum pernix genomic DNA, section 4/7 8169 21076 34406 0.79 9.1E-02 U39073.1 NT Mus musculus thymopoletin zeta mRNA, complete cds 8372 21276 34608 0.42 9.1E-02 AJ286667.1 NT Welwitschia mirabilis partial phyN gene for phytochrome 9480 22408 35769 1.08 9.1E-02 Y1479.1 NT Homo sapiens gamma adducin gene, exon 9 10910 23795 1.58 9.1E-02 T02984.1 EST_HUMAN FB19F10 Fetal brein, Stretagene Homo sapiens cDNA clone FB19F10 3'end 10936 23821 37248 0.93 9.1E-02 S74059.1 NT Tg616=Cyl actin [Tripneustes gratilla=sea urchins, embryos, Genomic, 5275 nt] 10964 23848 37274 0.88 9.1E-02 Y11187.1 NT A.Thalian RH1, TC1, G14587-5, G14587-6, and PRL1 genes 11609 24517 37987 3.25 9.1E-02 AF037525.1 NT Rana catesbelana dihydropyidlne receptor mRNA, complete cds 12525 25249 2.31 9.1E-02 AF052695.1 NT Rattus norvegicus cell cycle protein p55CDC gene, complete cds 12958 25767 10.65 9.1E-02 AJ291390.1 NT Homo sapiens partial MUSC3B gene for MUSC3B mucin, exons 1-11 FOLATE RECEPTOR ALPHA PRECURSOR (FR-ALPHA) (FOLATE RECEPTOR 1) (FOLATE RECEPTOR, ADULT) (ADULT FOLATE-BINDING PROTEIN) (FBP) (OVARIAN TUMOR-ASSOCIATED 768 13825 26755 2.93 9.0E-02 P15328 SWISSPROT ANTIGEN MOV18) (KB CELLS FBP) hy39g10.x1 NCI_CGAP_Lu24 Homo sapiens cDNA clone IMAGE:3175842 3' similar to contains Alu 1660 14690 27650 5.44 9.0E-02 BE220482.1 EST_HUMAN repetitive element; Page 127 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 2850 15839 28837 5.76 9.0E-02 AF138522.1 NT HIV-1 p8c095-06 from USA envelope glycoprotein (env) gene, partial cds 2850 15839 28838 5.76 9.0E-02 AF138522.1 NT HIV-1 p8c095-06 from USA envelope glycoprotein (env) gene, partial cds 3385 16428 29333 0.73 9.0E-02 AF279135.1 NT Dichyostelium discoideum spore coat structural protein SP65 (cofE) gene, complete cds 4779 17784 30654 2.38 9.0E-02 X65740.2 NT Pla@modium foloparum P-type ATPase 3 gene za66a12.r1 Soares_fetal_lung_NbHL19W Homo sapiens cDNA clone IMAGE:297694 5' similar to 6227 19282 32437 13.23 9.0E-02 W56037.1 EST_HUMAN PIR:S52171 S52171 small G protein - human ; 7h63d03.x1 NCI_CGAP_Co16 Homo sapiens cDNA clone IMAGE:3320645 3' similar to contains Alu 7019 20045 0.93 9.0E-02 BF062651.1 EST_HUMAN repetitive element; 7072 20278 33532 0.61 9.0E-02 R62805.1 EST_HUMAN yl11b08.s1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE:138903 3' Escherichia coli strain E2348/69 pathogenicity Island, rOrf1 (rorf1), rOrf2 (rorf2), EscR (escR), EscS (escS), EscT (escT), EscU (escU), CesD (cesD), EscC (escC), EscJ (escJ), SepZ (sepZ), EscV (escV), EscN 12811 25433 1.71 9.0E-02 AF022236.1 NT (escN), SepQ (sepQ), Tir (tir), OrfU (orfU), > 1457 14489 27449 1.46 8.9E-02 bf701603.1 EST_HUMAN 602129030F2 NIH_MGC_56 Homo sapiens cDNA clone IMAGE:4285951 6' 1457 14489 27450 1.46 8.9E-02 BF701593.1 EST_HUMAN 602129030F2 NIH_MGC_56 Homo sapiens cDNA clone IMAGE:4285951 5' 2410 15414 28417 0.91 8.9E-02 BE153572.1 EST_HUMAN PM0-HO0339-251199-003-d01 HT0339 Homo sapiens cDNA 4295 17309 2.07 8.9E-02 AF286055.1 NT Atrichum angustatum AtranFlo2 protein (AtranFlo2), gene partial cds 6064 19126 32255 3.18 8.9E-02 AW452122.1 EST_HUMAN UI-H-B13-alo-f-08-0-Ul.s1 NCI_CGAP_Sub5 Homo sapiens cDNA clone IMAGE:3068294 3' 6064 19126 32255 3.18 8.9E-02 AW452122.1 EST_HUMAN UI-H-B13-alo-f-08-0-Ul.s1 NCI_CGAP_Sub5 Homo sapiens cDNA clone IMAGE:3068294 3' 6081 19142 32278 3.36 8.9E-02 11433478 NT Homo sapiens similar to endoglycan (H. sapiens) (LOC63107), mRNA FOLD BIFUNCTIONAL PROTEIN (INCLUDES; METHYLENETETRAHYDROFOLATE 7557 20494 33784 1.49 8.9E-02 P47259 SWISSPROT DEHYDROGENASE ; METHENYLTETRAHYDROFOLATE CYCLOHYDROLASE] 7990 20909 1.78 8.9E-02 279021.1 NT H.sapiens flow-sorted chromosome 6 Hindl@@ fragment, SC5pA20F8 NITRIC-OXIDE SYNTHASE, BRAIN (NOS, TYPE I) (NEURONAL NOS) (N-NOS) (NNOS) 8628 21559 34897 1.01 8.9E-02 P29475 SWISSPROT (CONSTITUTIVE NOS) (NC-NOS) (BNOS) 8707 21638 34985 0.85 8.9E-02 BF701665.1 EST_HUMAN 602129111F2 NIH_MGC_56 Homo sapiens cDNA clone IMAGE:4285827 5' 8707 21638 34986 0.85 8.9E-02 BF701665.1 EST_HUMAN 602129111F2 NIH_MGC_56 Homo sapiens cDNA clone IMAGE:4285827 5' 9160 22068 35447 5.72 8.9E-02 AA309319.1 EST_HUMAN EST180187 Liver, hepatocellular carcinoma Homo sapiens cDNA 5'end qu55c05.x1 NCI_CGAP_Lym6 Homo sapiens cDNA clone IMAGE:1966680 3' similar to contains MER10.b1 10146 23037 36435 1.02 8.9E-02 AI285627.1 EST_HUMAN MER10 repetitive element ; qu55c05.x1 NCI_CGAP_Lym6 Homo sapiens cDNA clone IMAGE:1966680 3' similar to contains MER10.b1 10146 23037 36435 1.02 8.9E-02 AI285627.1 EST_HUMAN MER10 repetitive element ; 10253 23143 36552 0.64 8.9E-02 aa339356.1 EST_HUMAN EST144454 Fetal brain 1 Homo sapiens cDNA 5' end 12432 25192 3.75 8.9E-02 BF595918.1 EST_HUMAN 602129682F1 NIH_MGC_58 Homo sapiens cDNA clone IMAGE:4286180 5' 12582 25283 2.97 8.9E-02 6680220 NT Mus musculus hippcoampus abundant gene transcript 1 (Hiat1), mRNA Page 128 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 12860 25908 1.58 8.9E-02 AE001514.1 Helicobecter pylori, strain J99 section 75 of 132 of the complete genome 1400 14431 27386 0.99 8.8E-02 Q27474 SWISSPROT PROBABLE DNA LIGASE (POLYDEOXYRIBONUCLEOTIDE SYNTHASE [ATP]) 3975 17003 29890 1.24 8.8E-02 AA299128.1 EST_HUMAN EST11595 Uterus Homo sapiens cDNA 5' end TRANSCRIPTION INITIATION FACTOR TFIID 135 KDA SUBUNIT (TAFII-135) (TAFII135) (TAFII-130) 4118 17141 6.33 8.8E-02 O00258 SWISSPROT (TAFII130) 4405 17417 0.8 8.8E-02 4580423 NT Homo sapiens paired box gene 5 (aniridia, keratitis) (PAX6), Isoform 6, mRNA 7974 20895 0.7 8.8E-02 D17520.1 NT Shaep mRNA for angiotensingen, complete cds 9539 22466 35827 2.38 8.8E-02 AA151872.1 EST_HUMAN zn99a05.s1 Stratagene colan (#937204) Homo sapiens cDNA clone IMAGE:566288 3' 11558 24467 37931 2.78 8.8E-02 BE264455.1 EST_HUMAN 601191770F1 NIH_MGC_7 Homo sapiens cDNA clone IMAGE:3535648 5' 11558 24467 37932 2.78 8.8E-02 BE264455.1 EST_HUMAN 601191770F1 NIH_MGC_7 Homo sapiens cDNA clone IMAGE:3535648 5' 11709 24611 38088 6.42 8.8E-02 AL040129.1 EST_HUMAN DKFZp434D1313_r1 434 (synonym: htes3) Homo sapiens cDNA clone DKFZp434D1313 5' Homo sapiens zinc finger protein 92 (ZFP92), expressed-Xq28STS protein (XQ28ORF0, and biglycan (BGN) 3759 16791 29682 4.71 8.7E-02 U82695.2 NT genes, complete cds: and plasma membrane calcium ATPase isoform 3 (PMGA3) gene, pertial cds Homo sapiens zinc finger protein 92 (ZFP92), expressed-Xq28STS protein (XQ28ORF0, and biglycan (BGN) 3759 16791 29682 4.71 8.7E-02 U82695.2 NT genes, complete cds: and plasma membrane calcium ATPase isoform 3 (PMGA3) gene, pertial cds 4820 17821 30690 1.35 8.7E-02 af178636.1 NT Mus musculus JNK interacting protein-3a (Jip3) mRNA, complete cds 5155 18148 30994 0.66 8.7E-02 AI818839.1 EST_HUMAN wk92a02.x1 NCI_CGAP_Lu19 Homo sapiens cDNA clone IMAGE:2422826 3' 5497 18576 31422 5.51 8.7E-02 AA286875.1 EST_HUMAN za55g08.s1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE:701438 3' 5497 18576 31423 5.51 8.7E-02 AA286875.1 EST_HUMAN za55g08.s1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE:701438 3' 7161 20268 33524 0.7 8.7E-02 AJ271885.2 NT Mus musculus partial Kcnq1 gene for polassium channel protein, exons 10-14 7161 20268 33525 0.7 8.7E-02 AJ271885.2 NT Mus musculus partial Kcnq1 gene for polassium channel protein, exons 10-14 7394 20093 33327 0.69 8.7E-02 AF281342.1 NT Oncorhynchus mylkiss TAT-binding protein 1 mRNA, partial cds 9081 22010 35366 0.71 8.7E-02 AE004787.1 NT Pseudomonas aeruginosa PA01, section 348 of 529 of the complete genome 9081 22010 35367 0.71 8.7E-02 AE004787.1 NT Pseudomonas aeruginosa PA01, section 348 of 529 of the complete genome 11154 24083 2.5 8.7E-02 L04758.1 NT Oryctolagus cuniculus cytochrome P-450 (CYP4A4) gene, 5' end 11758 24657 38140 1.73 8.7E-02 AJ007763.1 NT Glyconobacter oxydans tRNA-Ile and tRNA-Ala genes 12487 25230 2.04 8.7E-02 X17116.1 NT Human DNA for Immunoglobulin alpha heavy chain from a case of alpha heavy chain disease 12675 25330 2.57 8.7E-02 6679057 NT Mus musculus nidogen 2 (Nid2), mRNA 1260 14313 27262 4.96 8.6E-02 AJ271736.1 NT Homo sapiens Xq pseudo@utocomel region; segment 2/2 2259 15269 28275 2.26 8.6E-02 BE408667.1 EST_HUMAN 601304016F1 NIH_MGC_21 Homo sapiens cDNA clone IMAGE:3638643 5' 3231 16279 29179 3.01 8.6E-02 L05468.1 NT Trichomonas vaginalis beta-tubulin (btub1) gene, complete cds 3713 16745 5.42 8.6E-02 A153362.1 NT Dicycstelium discoideum adenylyl cyclese (aerA) gene, complete cds Page 129 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 5306 18290 31143 1.83 8.6E-02 AF060174.1 NT Rattua norveglcus synaptic vesicle protein 2C (SV2C) mRNA, complete cds 6331 19381 32549 4.7 8.6E-02 Y10826.1 NT Homo sapiens LCN1B gene 6634 19674 32861 1.53 8.6E-02 J00440.1 NT Mouse germline IgM chain gene, D region; D-q52, mu switch region (part a) 6634 19674 32862 1.53 8.6E-02 J00440.1 NT Mouse germline IgM chain gene, D region; D-q52, mu switch region (part a) 8017 20933 34251 1.04 8.6E-02 P14616 SWISSPROT INSULIN RECEPTOR-RELATED PROTEIN PRECGURSOR (RR) (R-RELATED RECEPTOR) 8509 21440 34780 1.23 8.6E-02 5730066 NT Homo sapiens Snf2-related CBP activator protein (SRCAP) mRNA 8509 21440 34781 1.23 8.6E-02 5730066 NT Homo sapiens Snf2-related CBP activator protein (SRCAP) mRNA 8648 21579 34915 0.59 8.6E-02 11427428 NT Homo sapiens hypothetical protein FLJ11005 (FLJ11005), mRNA 8708 21639 0.89 8.6E-02 U60168.1 NT Dictyostelium disccideum proteasome subunit C2 homolog PriC (priC) gene, complete cds 10257 23147 36555 1.3 8.6E-02 AF111170.3 NT Homo sapiena 14q2 Jegged2 gene, complete cds; end unknown gene 10292 23182 0.67 8.6E-02 AW662153.1 EST_HUMAN hl20c08.x1 NCI_CGAP_GU1 Homo sapiens cDNA clone IMAGE:2972846 3' 10650 23536 36969 0.71 8.6E-02 AF026504.1 NT Raltus norvegicus SPA-1 like protein p1294 mRNA, complete cds 11385 24301 37747 1.89 8.6E-02 AF206551.1 NT Lacerta media cytochrome oxidase subunit 1 gene, partial cds; mitochondrial gene for mitochondrial product 11385 24301 37747 1.89 8.6E-02 AF206551.1 NT Lacerta media cytochrome oxidase subunit 1 gene, partial cds; mitochondrial gene for mitochondrial product 11695 24597 38074 2.74 8.6E-02 BF305606.1 EST_HUMAN 601893437F1 NIH_MGC_17 Homo sapiens cDNA clone IMAGE:4139216 5' 11695 24597 38075 2.74 8.6E-02 BF305606.1 EST_HUMAN 601893437F1 NIH_MGC_17 Homo sapiens cDNA clone IMAGE:4139216 5' 1872 23972 37409 6.04 8.6E-02 AE001073.1 NT Archaeoglobus fulgidus section 34 of 172 of the complete genome Bacilus stearothermophilus BerFI methylase (FIM) and BerFI restrciction endonuclease (FIR) genes, complete 12007 24849 38348 1.83 8.6E-02 AF283660.1 NT cds 2419 15423 28424 3.2 8.5E-02 AE000652.1 NT Helicobacter pylori 26695 section 130 of 134 of the complete gene oq83b07.s1 NCI_CGAP_Kid6 Homo sapien@ cDNA clons IMAGE:1592917 3' similar to gb:K01144 HLA 5866 18937 32055 0.7 8.5E-02 AA98549.1 EST_HUMAN CLASS II HISTOCOMPATIBILITY ANTIGEN, GAMMA CHAIN PRECURSOR (HUMAN) ; 5907 18975 1.89 8.5E-02 P06089 SWISSPROT M PROTEIN, SEROTYPE 6 PRECURSOR 6244 19298 32456 5.44 8.5E-02 AF233885.1 NT Mus musculus phospholipase C-like protein mRNA, partial cds 9167 22095 35454 2.4 8.5E-02 6754779 NT Mus musculus myosin XV (Myo15), mRNA 10351 23240 36659 3.24 8.5E-02 BE833054.1 EST_HUMAN RC4-OT0037-200700-014-e05 OT0037 Homo sapiens cDNA 10351 23240 36660 3.24 8.5E-02 BE833054.1 EST_HUMAN RC4-OT0037-200700-014-e05 OT0037 Homo sapiens cDNA 10849 23735 37158 0.57 8.5E-02 X76731.1 NT V.ammodytes gene for ammodytoxin C 10963 23847 37273 0.69 8.5E-02 11418108 NT Homo sapiens chromosome 22 open reading frame 5 (C22ORF5), mRNA 11596 24505 10.13 8.5E-02 AF155510.1 NT Homo sapiens heparanase precursor, mRNA, complete cds 11614 24522 37990 3.62 8.5E-02 AB001562.1 Streptococcus mutans gene for glucose-1-phosphate uridylytransferase, complete cds 12856 25713 2.03 8.5E-02 AJ005586.1 NT Antirrhinum majus mRNA for MYB-related transcription factor Page 130 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 12875 25871 2.65 8.5E-02 AF110403.1 NT Bactrocera tryonl transposon Homer putative transposase gene, complete cds 13012 25559 2.28 8.5E-02 AA362934.1 EST_HUMAN EST72736 Ovary II Homo sapiens cDNA 5'end 2716 15931 28706 3.67 8.4E-02 W69330.1 EST_HUMAN zd44e11.r1 Soares_fetal_heart_nBHH19W Homo sapiens cDNA clone IMAGE:343532 5' 5400 18382 31222 1.1 8.4E-02 AB042555.1 NT Homo sapiens mRNA, Similar to ret myomegalin, complete cds 5495 18574 31420 9.5 8.4E-02 BE267153.1 EST_HUMAN 601190436F1 NIH_MGC_7 Homo sapiens cDNA clone IMAGE:3534393 5' 6986 20013 33244 1.74 8.4E-02 AK024458.1 NT Homo sapiens mRNA for FLJ00050 protein, partial cds 8607 21538 34880 5.64 8.4E-02 BE095074.1 EST_HUMAN CM3-BT0790-260400-162-d05 BT0790 Homo sapiens cDNA 9401 22329 35691 0.81 8.4E-02 AF218890.1 NT Homo sapiens attractin precureor (ATRN) gene, exon 2 as88g10.x1 Barsteatd colon HPLRB7 Homo sapiens cDNA clone IMAGE:2335842 3' similar to TR:O88312 10848 23734 37157 1.85 8.4E-02 AI735184.1 EST_HUMAN O88312 GOB-4. ; 3653 16689 29584 8.44 8.3E-02 P75334 SWISSPROT HYPOTHETICAL LIPOPROTEIN MG309 HOMOLOG PRECURSOR 3685 16718 29609 0.82 8.3E-02 AI436797.1 EST_HUMAN th82g06.x1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:212510 3' 3685 16718 29610 0.82 8.3E-02 AI436797.1 EST_HUMAN th82g06.x1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:212510 3' 4404 17416 0.67 8.3E-02 M54964.1 NT C.thummi A2b region open reading frame, complete cds 6510 19554 32734 0.87 8.3E-02 AI942338.1 EST_HUMAN w079f11.x1 NCI_CGAP_Kid1 Homo sapiens cDNA clone IMAGE:1455422 3' 6626 19668 32851 3.45 8.3E-02 AF052683.1 NT Homo sapiens protocadherin 43 gene, exon 1 8560 21491 34832 3.01 8.3E-02 AF195787.1 NT Rattus norvegicus dystrophin-related protein 2A-from splice varient (Drp2) mRNA, complete cds og88g08.s1 NCI_CGAP_Kid5 Homo sapients cDNA clone IMAGE:1455422 3' similar to contains L1.t1 L1 L1 8591 21522 1.29 8.3E-02 AA865285.1 EST_HUMAN repetitive element ; 8874 21804 1.57 8.3E-02 AA987873.1 EST_HUMAN oq81f10.s1 NCI_GAP_Kid6 Homo sapiens cDNA clone IMAGE:1592779 3' la05h10.x1 Human Pancreatic Islets Homo sapiens cDNA 3' similar to TR:Q15332 Q15332 GAMMA 10067 22983 36374 1.33 8.3E-02 AW583503.1 EST_HUMAN SUBUNIT OF SODIUM POTASSIUM ATPASE LIKE. ; 10080 22873 1.54 8.3E-02 AL161595.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 91 10829 23715 1.18 8.3E-02 AF020409.1 NT Dictyostelium discoideum DocA (docA) mRNA, complete cds 1406 14437 7.8 8.2E-02 Y08170.2 NT Gallus gallus mRNA for for OBCAM protein gamma isoform 1514 14545 27507 1.48 8.2E-02 AF167077.2 NT Canis familiaris glutamate transporter (EAAT4) mRNA, complete cds 3122 16173 2.45 8.2E-02 AL163206.2 NT Homo sapiens chromosome 21 segment HS21C006 3869 16898 2.09 8.2E-02 AL161498.2 NT Arabidopsis thaliena DNA chromosome 4, contig fragment No.10 4382 17396 30261 7.87 8.2E-02 P48960 SWISSPROT LEUCOCYTE ANTIGEN CD97 PRECURSOR 4382 17396 30262 7.87 8.2E-02 P48960 SWISSPROT LEUCOCYTE ANTIGEN CD97 PRECURSOR 4382 17396 30263 7.87 8.2E-02 P48960 SWISSPROT LEUCOCYTE ANTIGEN CD97 PRECURSOR 5202 18193 31035 0.65 8.2E-02 AF240776.1 NT Mus musculus pepsinogen F(Pepf) mRNA, complete cds 5216 18206 31051 3.24 8.2E-02 U76009.1 NT Mus musculus zinc transporter (ZnT-3) gene, complete cds 5518 18597 31445 1.73 8.2E-02 BE897030.1 EST_HUMAN 601439578F1 NIH_MGC_72 Homo sapiens cDNA clone MAGE:3924523 5' Page 131 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 7370 20364 33633 2.85 8.2E-02 AF309555.1 NT Bos taurus connective tissue growth factor precursor (CTGF) gene, complete cds 8196 21103 0.52 8.2E-02 AV743341.1 EST_HUMAN AV743341 CB Homo sapiens cDNA clone CBLANF07 5' 9266 22194 0.55 8.2E-02 U29397.1 NT Rattue norvegious plasma membrane Ca2+ ATPase isoform 3 (PMCA3) gene, 5' flanking region 9331 22259 35623 3.87 8.2E-02 AW875126.1 EST_HUMAN RC2-PT0004-031299-011-d05 PT0004 Homo sapiens cDNA 10126 23017 36412 6.21 8.2E-02 X04197.1 NT Beet necrotic yellow vein virus RNA-2 10283 23173 36585 2.27 8.2E-02 BE254318.1 EST_HUMAN 601115055F1 NIH_MGC_16 Homo sapiens cDNA clone IMAGE:3355596 5' 11648 24554 38024 1.63 8.2E-02 9506428 NT Rattus norvegicus B-cell transiocation gene 3 (Btg3), mRNA 12507 25241 31865 4.43 8.2E-02 AE002246.2 NT Chiamydophila pneumoniae AR39, section 73 of 94 the complete genome 12711 25363 31799 1.49 8.2E-02 AW862195.1 EST_HUMAN QV4-CT0361-021299-049-b01 CT0361 Homo sapiens cDNA Mus musculus epidermal growth factor receptor (Egfr) gene, exons 5 through 28, and complete cds, 12882 25703 3.61 8.2E-02 AF275366.1 NT alternatively spliced Pseudomonas putida maonate decarboxylase gene cluster (mdcA, mdcB, mdcC, mdcD, mdcE, mdcG, 1513 14544 27506 1.22 8.1E-02 AB017138.1 NT mdcH, mdcL and mdcM genec), complete cds 5961 19028 32149 1.02 8.1E-02 AE004006.1 NT Xyleila fastidlosa, section 152 of 229 of the complete genome 6640 19679 32869 0.87 8.1E-02 T11532.1 EST_HUMAN A1484F Heart Homo sapiens cDNa clone A1484 7561 20498 0.8 8.1E-02 AL163279.2 NT Homo sapiens chromoscome 21 segmant HS21C079 8018 20934 1.45 8.1E-02 AI692681.1 EST_HUMAN wd86f08.x1 NCI_CGAP_Lu24 Homo sapiens cDNa clone IMAGE:2338503 3' 8914 21844 35197 0.69 8.1E-02 11426974 NT Homo sapiens hypothetical protein FLJ10060 (FLJ10060), mRNA 8914 21844 35198 0.69 8.1E-02 11426974 NT Homo sapiens hypothetical protein FLJ10060 (FLJ10060), mRNA 10423 23312 1.79 8.1E-02 AY005150.1 NT Homo sapiens extracellular glycoprotein lacritin precursor, gene, complete cds 11929 24774 38272 1.67 8.1E-02 AL163202.2 NT Homo sapiens chromosome 21 segment HS21C002 6 15864 26009 4.67 8.0E-02 AW954653.1 EST_HUMAN EST366723 MAGE resequences, MAGC Homo sapiens cDNA 963 14013 26955 1.84 8.0E-02 U60315.1 NT Molluscum contagiosum virus subtype 1, complete genome 1725 15908 27721 10.85 8.0E-02 D26535.1 NT Human gene for dihydrolipoemide succinyltransferase, complete cds (exon 1-15) 1725 15908 27722 10.85 8.0E-02 D26535.1 NT Human gene for dihydrolipoemide succinyltransferase, complete cds (exon 1-15) 1921 14942 27919 2.65 8.0E-02 BE067219.1 EST_HUMAN PM3-BT0347-170200-001-b08 BT0347 Homo sapiens cDNA 2493 15495 3.37 8.0E-02 BF246744.1 EST_HUMAN 601855548F1 NIH_MGC_57 Homo sapiens cDNA clone IMAGE:4075619 5' 2868 14160 27098 2.15 8.0E-02 M23449.1 NT Dictyoselium discoldeum cyclic nucleotide phosphodiesterase gene, complete cds 2944 15996 28897 0.79 8.0E-02 AL445067.1 NT Thermoplecme acidophilum complete genome; cegment 5/5 3887 16916 29794 0.65 8.0E-02 AW966118.1 EST_HUMAN EST378191 MAGE resequences, MAGI Homo sapiens cDNA 4159 17180 0.69 8.0E-02 4503034 NT Homo sapiens cAMP responsive element binding protein-like 2 (CREBL2) mRNA 4928 17927 7.91 8.0E-02 X72794.1 M.musculus gene for gelatinase B 5404 14013 26955 0.94 8.0E-02 U60315.1 NT Molluscum contagiosum virus subtype 1, complete genome 5945 19012 32131 0.49 8.0E-02 AW951139.1 EST_HUMAN EST363209 MAGE resequences, MAGA Homo saplens cDNA Page 132 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 6108 19168 32300 3.19 8.0E-02 AF275948.1 NT Homo sapiens ABCA1 (ABCA1) gene, complete cds 7544 19168 32300 1.49 8.0E-02 AF275948.1 NT Homo sapiens ABCA1 (ABCA1) gene, complete cds 8704 21635 34981 2.53 8.0E-02 AL114993.1 NT Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation 9926 22831 36217 0.9 8.0E-02 X74208.1 NT H.sapiens AGT gene, intron 4 9926 22831 36218 0.9 8.0E-02 X74208.1 NT H.sapiens AGT gene, intron 4 10654 23540 0.51 8.0E-02 AL163209.2 NT Homo sapiens chromosome 21 segment HS21C009 Homo sapiens SCG10 like-protein, helicase-like protein NHL, M68, and ADP-ribosylation factor related 11232 24158 37607 2.52 8.0E-02 AF217796.1 NT protein 1 (ARFRP1) genes, complete cds 12538 25260 31835 4.67 8.0E-02 AJ005375.1 NT Drosophila orena hunchback region 13056 17180 1.9 8.0E-02 4503034 NT Homo sapients cAMP responsive element binding protein-like 2 (CREBL2) mRNA 2187 15198 28203 3.62 7.9E-02 BE250008.1 EST_HUMAN 600943191F1 NIH_MGC_15 Homo sapiens cDNA clone IMAGE2959510 5' ar98c08.x1 Barstead colon HPLRB7 Homo sapiens cDNA clone IMAGE:2173646 3' similar to gb:Z26876 3020 16072 28974 15.45 7.9E-02 AI582029.1 EST_HUMAN 60S RIBOSOMAL PROTEIN L38 (HUMAN); 3917 16945 29824 3.25 7.9E-02 6681044 NT Mus musculue colony stimulaling factor 1 receptor (Csf1r), mRNA 3917 16945 29825 3.25 7.9E-02 6681044 NT Mus musculue colony stimulaling factor 1 receptor (Csf1r), mRNA 4926 17925 1.21 7.9E-02 AB008019.1 NT Arabidopsis thaliana RXW24L mRNA, partial cds 5024 18021 0.99 7.9E-02 AW081738.1 EST_HUMAN xb70a10.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE;2581626 3' 6994 20021 1.11 7.9E-02 BF368016.1 EST_HUMAN RC3-GN0042-310800-024-d11 GN0042 Homo sapiens cDNA 8610 21541 34883 3.74 7.9E-02 U27832.1 NT Saccharomyces cerevislae suppressor of MIF2 Smt4p (SMT4) gene, complete cds ou63b05.s1 NCI_CGAP_Br2 Homo sapiens cDNA clone IMAGE:1632465 3' similar to WP:C37A2.2 10531 23417 36831 6.09 7.9E-02 AI081644.1 EST_HUMAN CE08611 ; ou63b05.s1 NCI_CGAP_Br2 Homo sapiens cDNA clone IMAGE:1632465 3' similar to WP:C37A2.2 10531 23417 36832 6.09 7.9E-02 AI081644.1 EST_HUMAN CE08611 ; 12967 25532 1.54 7.9E-02 AI761639.1 EST_HUMAN wg66h01.x1 Soares_NSF_F8_9W_OT_PA_P_S1 Homo sapiens cDNA clone IMAGE:2370097 3' co59d02.y5 NCI_CGAP_Lu5 Homo sapiens cDNA clone IMAGE:1570467 5' similar to contains L1.t3 L1 1238 14274 27216 1.32 7.8E-02 AI793275.1 EST_HUMAN repetitive element ; oo59d02.y5 NCI_CGAP_Lu5 Homo sapiens cDNA clone IMAGE:1570467 5' similar to comtains L1.t3 L1 1238 14274 27217 1.32 7.8E-02 AI793275.1 EST_HUMAN repetitive element ; 3812 16842 1 7.8E-02 BE250048.1 EST_HUMAN 600943055F1 NIH_MGC_15 Homo sapiens cDNA clone IMAGE:2959693 5' 4910 17909 30779 0.71 7.8E-02 BE836331.1 EST_HUMAN PM3-FN0058-140700-005-f09 FN0058 Homo sapiens cDNA 5221 16842 3.56 7.8E-02 BE250048.1 EST_HUMAN 600943055F1 NIH_MGC_15 Homo sapiens cDNA clone IMAGE:2959693 5' Homo sapiens zinc finger protein 92 (ZFP92), expressed-Xq28STS protain (XQ28ORF), and biglycan (BGN) 7431 20129 33370 1.19 7.8E-02 U82695.2 NT genes, complete cds; and plasma membrane calcium ATPase isoform 3 (PMCA3) gene, partial cds Page 133 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value Homo saplens zinc finger protein 92 (ZFP92), expressed-Xq28STS protein (XQ28ORF), and biglycan (BGN) 7431 20129 33371 1.19 7.8E-02 U82695.2 NT genes, complete cds; and plasma membrane calcium ATPase isoform 3 (PMCA3) gene, partial cds 9437 22365 35725 0.87 7.8E-02 X78344.1 NT S.cerevisiae CAT8 gene Homo saplents FYVE domain-containing dual specificity protein phosphatase FYVE-DSP1b mRNA, complete 9605 22531 35898 0.84 7.8E-02 AF233437.1 NT cds Homo saplents FYVE domain-containing dual specificity protein phosphatase FYVE-DSP1b mRNA, complete 9605 22531 35899 0.84 7.8E-02 AF233437.1 NT cds 9899 22887 36271 1.13 7.8E-02 AA469354.1 EST_HUMAN nc68b06.r1 NCI_CGAP_Pr1 Homo sapiens cDNa clone IMAGE:771731 10318 23207 36618 0.51 7.8E-02 Z99124.1 NT Bacillus subtilis complete genorme (section 21 of 21): from 3999281 to 4214814 11108 24039 37483 1.92 7.8E-02 U32323.1 NT Human interleukin-11 receptor alpha chain gene, complete cds 12883 25479 31764 1.85 7.8E-02 U72847.1 NT Homo saplens envoplakin (EVPL) gene, exons 15 through 18 3648 16684 2.13 7.7E-02 AJ238093.1 NT Homo saplens partial AF-4 gene, exons 2 to 7 and Alu repeat elements 5734 18807 31901 0.43 7.7E-02 AF062636.1 NT Gallus gallus collagen type XII alpha-1 (COL12A1) gene, promoter region and partial cds 7e04f03.x1 NCI_CGAP_Lu24 Homo sapiens cDNA clone IMAGE:3281501 3' similar to TR:O95415 O95415 8413 21315 34647 0.61 7.7E-02 BE674473.1 EST_HUMAN I3 PROTEIN.; zu53d11.r1 Soares ovary tumor NbHOT Homo sapiens cDNA clone IMAGE:741717 5' similar to 8488 21419 34756 4.99 7.7E-02 AA402949.1 EST_HUMAN TR:G1173905 G1173905 SPLICEOSOME ASSOCIATED PROTEIN.; 10350 23239 36658 5.01 7.7E-02 P38080 SWISSPROT PROBABLE SERINE/THREONINE-PROTEIN KINASE YBR059C ta80b08.x1 NCI_CGAP_HSC2 Homo sapiens cDNA clone IMAGE:2050369 3' similar to gb:Z26876 60S 10630 23516 36949 1.09 7.7E-02 AI318662.1 EST_HUMAN RIBOSOMAL PROTEIN L38 (HUMAN); ta80b08.x1 NCI_CGAP_HSC2 Homo sapiens cDNA clone IMAGE:2050369 3' similar to gb:Z26876 60S 10630 23516 36949 1.50 7.7E-02 AI318662.1 EST_HUMAN RIBOSOMAL PROTEIN L38 (HUMAN); 11449 24365 37814 5.97 7.7E-02 11422757 NT Homo sapiens KIAA0628 gene product (KIAA0628), mRNA 12724 25780 1.61 7.7E-02 11436859 NT Homo sapiens interferon regulatory factor 7 (IRF7), mRNA 3446 16487 29394 3.15 7.6E-02 BE514432.1 EST_HUMAN 601316426F1 NIH_MGC-8 Homo sapiens cDNA clone IMAGE:3634903 5' 3468 16508 29409 1.18 7.6E-02 AA296447.1 EST_HUMAN EST112214 Cerebellum II Homo sapiens cDNA 5' end similar to similar to protocadherin 43 6334 19384 32552 0.7 7.6E-02 AI061275.1 EST_HUMAN en25g02.x1 Gessier Wilms tumor Homo sapiens cDNA clone IMAGE:1699730 3' 6614 19655 32839 0.86 7.6E-02 BE379328.1 EST_HUMAN 601236402F1 NIH_MGC_44 Homo sapiens cDNA clone IMAGE:3608401 5' 9909 22897 36284 1.49 7.6E-02 AJ131016.1 NT Homo sapiens SCL gene locus 10409 23298 1.74 7.6E-02 AL139078.2 NT Campylobacter jejuni NCTC11168 complete genome; segment 5/6 10715 23601 37028 0.58 7.6E-02 BE708002.1 EST_HUMAN RC1-HT0545-020800-017-d06 HT0545 Homo sapiens cDNA 10836 23722 0.6 7.6E-02 BE959638.2 EST_HUMAN 601654915R1 NIH_MGC_57 Homo sapiens cDNA clone IMAGE:3839810 3' 11060 23944 37380 0.98 7.6E-02 X92656.1 NT L.esculentum mRNA for triose phosphate translocator Page 134 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 11060 23944 37381 0.98 7.6E-02 X92656.1 NT L.esculentum mRNA for troise phosphale translocator 12102 24943 38446 2.23 7.6E-02 AW996645.1 EST_HUMAN QV3-BN0046-150400-151-e04 BN0046 Homo sapiens cDNA 811 13867 26802 1.05 7.5E-02 5902093 NT Homo sapiens solute carrier family 6 (neurotransmitter transporter, glycine), member 9 (SLC6A9), mRNA 811 13867 26803 1.05 7.5E-02 5902093 NT Homo sapiens solute carrier family 6 (neurotransmitter transporter, glycine), member 9 (SLC6A9), mRNA 4630 17636 30500 0.84 7.5E-02 AB015961.1 NT Homo sapiens IL-18 gene for interleukin-18, intron 1 and exon 2 6066 19127 32258 1.45 7.5E-02 AI948714.1 EST_HUMAN wq24h09.x1 NCI_CGAP_Kld11 Homo sapiens cDNA clone IMAGE:2472257 3' wl52b02.x1 NCI_CGAP_Brn25 Homo sapiens cDNA clone IMAGE:2428491 3' similar to gb:M14328 ALPHA 8913 21843 35196 1.49 7.5E-02 AI864367.1 EST_HUMAN ENOLASE (HUMAN); 9074 22003 35357 1.4 7.5E-02 AU116913.1 EST_HUMAN AU116913 HEMBA1 Homo sapiens cDNA clone HEMBA 1000264 5' 7o61c05.x1 NCI_CGAP_Pr28 Homo sapiens cDNA clone IMAGE:3578504 3' similar to contrains element 10535 23421 0.58 7.5E-02 BF221730.1 EST_HUMAN MER27 repetitive element; 10971 23855 37282 0.87 7.5E-02 BF206809.1 EST_HUMAN 601870205F1 NIH_MGC_19 Homo sapiens cDNA clone IMAGE:4100449 6' 11061 23945 37382 0.93 7.5E-02 X79460.1 NT C.flmi DSM 20113 16S rDNA 500 13570 26488 1.17 7.4E-02 AW838647.1 EST_HUMAN RC3-LT0054-260100-011-H09 LT0054 Homo sapiens cDNA 2618 15616 0.98 7.4E-02 6755069 NT Mus musculus paired-like homeodomain transcription factor 1 (Pitx1), mRNA 3655 16691 29587 0.81 7.4E-02 AI807885.1 EST_HUMAN wf43h01.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2358385 3' 4817 17818 30686 1.15 7.4E-02 L78810.1 NT Homo sapiens ADP/ATP carrier protein (ANT-2) gene, complete cds 4909 17908 30778 3.04 7.4E-02 6978442 NT Rattus norvegicus Activin receptor like kinase 1 (Aovrl1), mRNA 5054 18051 30904 1.65 7.4E-02 6678492 NT Mus musculus ubiquintin c-teminal hydrolase related polypeptide (Uchrp), mRNA 5366 18348 31191 1.05 7.4E-02 AJ012469.1 NT Caenorhabditis elegans mRNA for DYS-1 protein, partial 6771 19805 1.58 7.4E-02 R17477.1 EST_HUMAN yg14g06.r1 Soares infant brain 1NIB Homo sapiens cDNA clone IMAGE:32339 5' 6869 19901 33116 0.41 7.4E-02 AF030422.1 NT Electrophorus electricus acetylcholinesterase catalytic subunit precursor gene, complete cds 7885 20811 34117 0.65 7.4E-02 AA605132.1 EST_HUMAN no71d02.s1 NCI_CGAP_AA1 Homo sapiens cDNA clone IMAGE:1112259 3' 8481 21412 34749 1.33 7.4E-02 BE880112.1 EST_HUMAN 601493366F1 NIH_MGC_69 Homo sapiens cDNA clone IMAGE:3895264 5' 9068 21997 35351 0.83 7.4E-02 U56089.1 NT Human periodic tryptophan protein 2 (PWP2) gene, exons 15 to 21, and complete ods hh67d11.y1 NCI_CGAP_GU1 Homo sapiens cDNA clone IMAGE:2967861 5' similar to SW:SCA2_HUMAN 9709 22634 36014 1.1 7.4E-02 AW629605.1 EST_HUMAN O15127 SECRETORY CARRIER-ASSOCIATED MEMBRANE PROTEIN 2. ; hh67d11.y1 NCI_CGAP_GU1 Homo sapiens cDNA clone IMAGE:2967661 5' similar to SW:SCA2_HUMAN 9709 22634 36015 1.1 7.4E-02 AW629605.1 EST_HUMAN O15127 SECRETORY CARRIER-ASSOCIATED MEMBRANE PROTEIN 2. ; 10330 23219 36633 1.02 7.4e-02 u62293.1 NT Human LIM-kinase1 and alternatively spliced LIM-kinase1 (LIMK1) gene, complete cds 12179 25015 1.49 7.4E-02 U89282.1 NT Rattus norvegious telomerase protein component 1 (TLP1) mRNA, complete cds 12717 25884 3.75 7.4E-02 AW379431.1 EST_HUMAN CM4-HT0243-081199-037-d11 HT0243 Homo sapiens cDNA Page 135 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 12854 25464 31781 2.43 7.4E-02 BF035099.1 EST_HUMAN 601453813F1 NIH_MGC_66 Homo sapiens cDNA clone IMAGE:3857738 5' 491 13562 26478 1.08 7.3E-02 BE9649612 EST_HUMAN 601658738R1 NIH_MGC_69 Homo sapiens cDNA clone IMAGE:3886209 3' 491 13562 26479 1.08 7.3E-02 BE9649612 EST_HUMAN 601658738R1 NIH_MGC_69 Homo sapiens cDNA clone IMAGE:3886209 3' 708 13767 26683 2.8 7.3E-02 AE001789.1 NT Thermotoga maritima section 101 of 136 of the complete genome 1499 15902 27495 2.95 7.3E-02 AW900281.1 EST_HUMAN CM0-NN1004-130300-284-g08 NN1004 Homo sapiens cDNA 1870 15912 16.74 7.3E-02 AL163302.2 NT Homo sapiens chromosome 21 segment HS21C102 4180 17200 30070 1.02 7.3E-02 AJ245944.1 NT Homo sapiens NGB gene for neuroglobin, exons 1-4 5118 18115 1.64 7.3E-02 U12283.1 NT Mus musculus trenscription factor USF2 (USF2) gene, exons 8-10 and complete ods zj24s02 s1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:451178 3' similar to 6723 19759 32966 2.08 7.3E-02 AA779977.1 EST_HUMAN gb:L02426 26S PROTEASE SUBUNIT 4 (HUMAN); 7882 20808 34113 3.2 7.3E-02 P05143 SWISSPROT PROLINE-RICH PROTEIN MP-3 7882 20808 34114 3.2 7.3E-02 P05143 SWISSPROT PROLINE-RICH PROTEIN MP-3 8293 21197 0.45 7.3E-02 BF316067.1 EST_HUMAN 601806047F1 NIH_MGC_10 Homo sapiens cDNA clone IMAGE:4125516 5' 8746 21676 1.48 7.3E-02 7662107 NT Homo sapiens KIAA0424 protein (KIAA0424), mRNA 8972 21902 35257 0.55 7.3E-02 Y10887.2 NT Mus musculus cdh5 gene, exon 1, partial 9761 22675 1.34 7.3E-02 AB011090.1 NT Homo sapiens mRNA for KIAA0518 protein, partial cds zj24a02.s1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:451178 3' similar to 11665 19759 32966 2.1 7.3E-02 AA779977.1 EST_HUMAN gb:L02426 26S PROTEASE SUBUNIT 4 (HUMAN); Metinanobacterium thermoeutotrophicum from bases 1029155 to 1039934 (section 88 of 148) of the comoplete 124 13230 26145 2.42 7.2E-02 AE000882.1 NT genome Metinanobacterium thermoeutotrophicum from bases 1029155 to 1039934 (section 88 of 148) of the comoplete 124 13230 26146 2.42 7.2E-02 AE000882.1 NT genome 1494 14525 27486 2.25 7.2E-02 AL163301.2 NT Homo sapiens chromosome 21 segment HS21C101 1494 14525 27487 2.25 7.2E-02 AL163301.2 NT Homo sapiens chromosome 21 segment HS21C101 Human immunodeficiency virus type 1 isolate 26 reverse transcriptase (pol) gene, interrel fragment, partial 2581 15580 3.58 7.2E-02 U14794.1 NT cds 3954 16982 29866 0.72 7.2E-02 AW298322.1 EST_HUMAN Ul-H-BW0-aji-a-05-0-Ul.s1 NCI_CGAP_Sub6 Homo sapiens cDNA clone IMAGE:2732049 3' 4455 17465 30322 3.42 7.2E-02 BF572307.1 EST_HUMAN 602077757F1 NIH_MGC_82 Homo sapiens cDNA clone IMAGE:4261950 5' 4806 17807 30673 0.71 7.2E-02 11466563 NT Rhodomones selina mitochondrion, complete genome 5470 18551 31393 2.77 7.2E-02 U67531.1 NT Methanococcus jannaschii section 73 of 150 of the complete genome 5471 18552 31394 3.49 7.2E-02 P11120 SWISSPROT CALMODULIN 6356 19405 0.55 7.2E-02 BF217596.1 EST_HUMAN 601883905F1 NIH_MGC_57 Homo sapiens cDNA clone IMAGE:4096224 5' 7531 20470 33769 1.26 7.2E-02 BF216086.1 EST_HUMAN 601883558F1 NIH_MGC_57 Homo sapiens cDNA clone IMAGE:4095710 5' Page 136 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value Streptococcus pneumoniae putative response regulator (zmpR), putative histidine kinase (zmpS), and putative 7549 20487 33776 0.63 7.2E-02 AF221126.1 NT zinc metalloprotease (zmpB) genes, complete cds 7576 20512 1.44 7.2E-02 5834897 NT Stronglyocentrotus purpuratus mitochondrion, complete gencme 8766 21696 35039 0.69 7.2E-02 P05143 SWISSPROT PROLINE-RICH PROTEIN MP-3 8766 21696 35040 0.69 7.2E-02 P05143 SWISSPROT PROLINE-RICH PROTEIN MP-3 9616 22542 0.63 7.2E-02 Y17217.1 NT Lactococcus lactis cspE gene 10104 22995 0.67 7.2E-02 X16349.1 NT Human gene for sex hormone-binding globulin (SHBG) 10138 23029 36426 2.37 7.2E-02 AV712452.1 EST_HUMAN AV712452 DCA Homo sapiens cDNA clone DCAAUG01 5' Homo sapiens plasma membrane calcium ATPase isoform 1 (ATP2B1) gene, altemative splice products, 10279 23169 36582 4.17 7.2E-02 L14561.1 NT partial cds 10425 23314 36731 1.25 7.2E-02 BF125399.1 EST_HUMAN 601763523F1 NIH_MGC_20 Homo saplens cDNA clone IMAGE:4026436 5' hq24f11.x1 NCI_CGAP_Adr1 Homo sapiens cDNA clone IMAGE:3120333 3' similar to TR:Q9Z340 Q9Z340 10508 23395 36807 2.45 7.2E-02 AW873187.1 EST_HUMAN ATYPICAL PKC SPECIFIC BINDING PROTEIN.; 10680 23575 37005 0.62 7.2E-02 AA768204.1 EST_HUMAN ca62c07.s1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE:1316844 3' Homo sapiens zinc finger protein 92 (ZFP92), expressed-Xq28STS protein (XQ28ORF), and biglycan (BGN) 10839 23725 37148 2.25 7.2E-02 U82695.2 NT genes, complete cds; and plasma membrane calcium ATPase isoform 3 (PMCA3) gene, partial cds 10953 23837 37264 4.92 7.2E-02 BE565003.1 EST_HUMAN 601343926F1 NIH_MGC_53 Homo sapiens cDNA clone IMAGE:3685951 5' 10976 23860 3.94 7.2E-02 BE569214.1 EST_HUMAN 601065194F1 NIH_MGC_10 Homo sapiens cDNA clone IMAGE:3451559 5' 11351 24269 37711 3.94 7.2E-02 AF049874.1 NT Rattus norvegicus bHLH transcription factor Mist1 (Mist1) gene, complete cds 12387 25165 31872 1.82 7.2E-02 AA773696.1 EST_HUMAN af81a04.r1 Soares_NhHMPu-S1 Homo sapiens cDNA clone IMAGE:1048398 5' 12471 25217 1.81 7.2E-02 AA584465.1 EST_HUMAN no05H08.s1 NCI_CGAP_Phe1 Homo sapiens cDNA clone IMAGE:1099839 3' 12526 25250 4.57 7.2E-02 U82828.1 NT Homo sapiens ataxta telanglectasia (ATM) gene, complete cds 12540 25752 5.88 7.2E-02 AW900962.1 EST_HUMAN CM4-NN1009-200300-116-c11 NN1009 Homo sapiens cDNA 1922 14943 27920 2.31 7.1E-02 L02290.1 NT Human Immunodeficiency virus type 1 (D9) proviral structural capsid protein (gag) gene, partial cds 2311 15319 28320 4.11 7.1E-02 BF208802.1 EST_HUMAN 601872281F1 NIH_MGC_53 Homo sapiens cDNA clone IMAGE:4092981 5' 8486 21417 34753 1.08 7.1E-02 AI125264.1 EST_HUMAN qd92a10.x1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1736922 3' 12280 25094 4.11 7.1E-02 BE304764.1 EST_HUMAN 601143974F1 NIH_MGC_15 Homo sapiens cDNA clone IMAGE:3051234 5' 551 13620 26528 1.22 7.0E-02 Q07092 SWISSPROT COLLAGEN ALPHA 1(XV) CHAIN PRECURSOR 1517 14548 1.24 7.0E-02 X96677.1 NT M.artlelia Mitcut-1 gene 1786 14812 27781 1.18 7.0E-02 AA056343.1 EST_HUMAN zl66f04.s1 Stratagene colon (#937204) Homo sapiens cDNA clone IMAGE:509599 3' 3076 16128 29025 2.02 7.0E-02 AW138152.1 EST_HUMAN Ul-H-BI1-acy-c-07-0-Ul.s1 NCI_CGAP_Sub3 Homo sapiens cDNA clone IMAGE:2716020 3' Page 137 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value al65a12.s1 Soares_testis_NHT Homo sapiens cDNA clone 1375678 3' similar to gb:K03002 60S 3967 16995 29879 1.54 7.0E-02 AA815438.1 EST_HUMAN RIBOSOMAL PROTEIN L32 (HUMAN); 4128 17151 30026 1.29 7.0E-02 BE070264.1 EST_HUMAN QV4-BT0407-280100-090-e10 BT0407 Homo sapiens cDNA 4237 17253 1.13 7.0E-02 AW792962.1 EST_HUMAN CM0-UM0001-060300-270-e12 UM0001 Homo sapiens cDNA 4310 17324 30191 1.21 7.0E-02 AF077821.1 NT Canis familiaris inducible nitrio oxide synthase mRNA, complete cds 5041 18038 30894 9.37 7.0E-02 BF381987.1 EST_HUMAN 601816291F1 NIH_MGC_56 Homo sapiens cDNA clone IMAGE:4050071 5' 5562 18640 0.82 7.0E-02 Y09143.2 NT Lumbricus rubellus mRNA for cyclophilin B 7799 20728 34030 0.88 7.0E-02 AV689285.1 EST_HUMAN AV689285 GKC Homo sapiens cDNA clone GKCCAE06 5' 8050 20963 34279 0.74 7.0E-02 Y19187.1 NT Gallus gallus mRNA for partial aczonin, XL spliced variant (acz gene) 9643 22569 35940 1.23 7.0E-02 9628113 NT African swine fever virus, complete genome 10124 23015 36411 1.57 7.0E-02 K02901.1 NT Rat lg germline epsilon H-chain gene C-region, 3' end 10459 23347 36764 0.89 7.0E-02 U27266.1 NT Human myosin binding protein H (MyBP-H) gene, complete cds ah99a05.s1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:1327184 3' similar to gb:L14837 11811 24732 38223 3.23 7.0E-02 AA724295.1 EST_HUMAN TIGHT JUNCTION PROTEIN ZO-1 (HUMAN); 12980 25540 31750 1.68 7.0E-02 11421638 NT Homo sapiens hypothetical protein FLJ20116 (FLJ20116), mRNA 537 13606 26514 9.27 6.9E-02 AL163210.2 NT Homo sapiens chromosome 21 segment HS21 C010 537 13606 26515 9.27 6.9E-02 AL163210.2 NT Homo sapiens chromosome 21 segment HS21 C010 1361 14392 1.06 6.9E-02 4507968 NT Homo sapiens regulator of Gz-selective protein signaling (ZGAP1) mRNA, and translated products 3857 16886 29770 1.36 6.9E-02 Q06364 SWISSPROT 26S PROTEASOME REGULATORY SUBUNIT S3 (NUCLEAR ANTIGEN 21D7) 3857 16886 29771 1.36 6.9E-02 Q06364 SWISSPROT 26S PROTEASOME REGULATORY SUBUNIT S3 (NUCLEAR ANTIGEN 21D7) 5283 18239 31090 0.93 6.9E-02 AA670269.1 EST_HUMAN af25e08.s1 Soares total fetus Nb2HF8_9w Homo sapiens cDNA clone IMAGE:1032710 3' 6141 19200 0.48 6.9E-02 AF161364.1 NT Homo sapiens HSPC101 mRNA, partial cds 8062 20975 0.55 6.9E-02 AF164967.1 NT Canine distemper virus strain A75/17, complete genome 8630 21561 0.88 6.9E-02 U12022.1 NT Human calmodulin (CALM1) gene, exons 2,3,4,5 and 6, and complete cds 9116 22044 35400 0.96 6.9E-02 BE567435.1 EST_HUMAN 601340661F1 NIH_MGC_53 Homo sapiens cDNS clone IMAGE:3683030 5' 9116 22044 35401 0.96 6.9E-02 BE567435.1 EST_HUMAN 601340661F1 NIH_MGC_53 Homo sapiens cDNS clone IMAGE:3683030 5' 9664 22590 35963 0.7 6.9E-02 U22967.1 NT Barbarie duck parvovirus REP protein (rep) and three capsid protein VP (vp) genes, complete cds 12415 25184 5.82 6.9E-02 X74315.1 NT X.Iaevis XFD2 mRNA for fork head protein 12571 25276 1.53 6.9E-02 P44621 SWISSPROT PROTEIN TRANSPORT PROTEIN HOFC HOMOLOG 12780 25409 5.15 6.9E-02 AF195953.1 NT Homo sapiens membrane-bound aminopeptidase P (XNPEP2) gene, complete cds 1924 14945 27921 4.83 6.8E-02 AF156673.1 NT Homo sapiens putative hepatic transcription factor (WBSCR14) gene, complete cds 1996 15014 28004 0.94 6.8E-02 BE263781.1 EST_HUMAN 601194141F1 NIH_MGC_7 Homo sapiens cDNA clone IMAGE:3537706 5' 4247 17263 30129 0.87 6.8E-02 6679250 NT Mus musculus phosphodiesterase 9A (Pde9a), mRNA Page 138 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 4668 17673 0.76 6.8E-02 BE141076.1 EST_HUMAN MR0-HT0069-071099-001-c05 HT0069 Homo sapiens cDNA 6911 19941 0.66 6.8E-02 P20792 SWISSPROT CELL-SURFACE RECEPTOR DAF-1 PRECURSOR 7228 20137 1.21 6.8E-02 BE061890.1 EST_HUMAN RC1-BT0254-090300-017_d09 BT0254 Homo sapiens cDNA 7659 20593 33891 8.38 6.8E-02 AL163268.2 NT Homo sapiens chromosome 21 segment HS21C068 8137 21046 34376 0.74 6.8E-02 U16856.1 NT Dictyostelium discoideum myosin heavy chain kinase A (MHCK A) mRNA, complete cds 8865 21795 35147 5.72 6.8E-02 AJ248287.1 NT Pyrococcus abyssi complete genome; segment 5/6 8865 21795 35148 5.72 6.8E-02 AJ248287.1 NT Pyrococcus abyssi complete genome; segment 5/6 12234 25925 1.53 6.8E-02 T03214.1 EST_HUMAN FB4A8 Fetal brain, Stratagene Homo sapiens cDNA clone FB4A8 3'end similar to LINE-1 12354 25144 1.7 6.8E-02 AA758014.1 EST_HUMAN ah67f05.s1 Soaree_testis_NHT Homo sapiens cDNA clone 1320705 3' 12936 25504 2.09 6.8E-02 9910585 NT Mus musculus latent TGF beta binding protein (Tgfb), mRNA 1551 14582 2.6 6.7E-02 AF115536.1 NT Oncorhynchus mykiss TAP1 protein (OnmTAP1) mRNA, OnmyTAP1*01 allele, complete cds 1911 14932 27909 1.47 6.7E-02 AI220285.1 EST_HUMAN qg79e04.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:1841406 3' 3781 16812 29698 5.04 6.7E-02 P17278 SWISSPROT HOMEOBOX PROTEIN HOX-D4 (CHOX-A) 4037 17064 29953 0.8 6.7E-02 U53783.1 NT Cyprinus carpio Rap1b mRNA, complete cds 4037 17064 29954 0.8 6.7E-02 U53783.1 NT Cyprinus carpio Rap1b mRNA, complete cds 8433 21365 34704 0.82 6.7E-02 X62695.1 NT H. saplens DNA for cGMP phosphodlesterase (exons 4-22) 8433 21365 34705 0.82 6.7E-02 X62695.1 NT H. saplens DNA for cGMP phosphodlesterase (exons 4-22) 10127 23018 36413 0.64 6.7E-02 AW137359.1 EST_HUMAN UI-H-BI1-acr-g-0f-0-UI.s1 NCI_CGAP_Sub3 Homo sapiens cDNA clone IMAGE:2715433 3' 10127 23018 36414 0.64 6.7E-02 AW137359.1 EST_HUMAN UI-H-BI1-acr-g-0f-0-UI.s1 NCI_CGAP_Sub3 Homo sapiens cDNA clone IMAGE:2715433 3' at12e09.x1 Barstead aota HPLRB6 Homo sapiens cDNA clone IMAGE:2354920 3' similar to 1377 14409 27363 0.91 6.6E-02 AI735509.1 EST_HUMAN SW:LIN1_NYCCO P08548 LINE_1 REVERSE TRANSCRIPTASE HOMOLOG. ; 1396 14427 27381 0.96 6.6E-02 AF245116.1 NT Drosophila melanogaster cactin mRNA, compiete cds 2195 15206 28210 2.21 6.6E-02 AJ289241.1 NT Mus musculus Capn12 gene for calpain 12, exons 1-21, three altemative transcipts 3525 16563 29467 10.68 6.6E-02 R64306.1 EST_HUMAN yi18b10.s1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE:139579 3' 3537 16575 29479 3.59 6.6E-02 7108357 NT Homo sapiens mescthelin (MSLN), transcript variant 1, mRNA 3537 16575 29480 3.59 6.6E-02 7108357 NT Homo sapiens mescthelin (MSLN), transcript variant 1, mRNA 4167 17188 30061 1.93 6.6E-02 AF260225.1 NT Homo sapiens TESTIN 2 and TESTIN 3 genes, compiete cds, alternatively spliced 5100 18097 30943 12.83 6.6E-02 Q61703 SWISSPROT INTER-ALPHA-TRYPSIN INHIBITOR HEAVY CHAIN H2 PRECURSOR (ITI HEAVY CHAIN H2) 5100 18097 30944 12.83 6.6E-02 Q61703 SWISSPROT INTER-ALPHA-TRYPSIN INHIBITOR HEAVY CHAIN H2 PRECURSOR (ITI HEAVY CHAIN H2) 6866 19898 33114 3.37 6.6E-02 X06411.1 NT P.vulgaris mRNA for chalcone synthese 6901 19931 33148 0.53 6.6E-02 P25159 SWISSPROT MATERNAL EFFECT PROTEIN STAUFEN 6901 19931 33149 0.53 6.6E-02 P25159 SWISSPROT MATERNAL EFFECT PROTEIN STAUFEN 7108 19931 33148 0.65 6.6E-02 P25159 SWISSPROT MATERNAL EFFECT PROTEIN STAUFEN 7108 19931 33149 0.65 6.6E-02 P25159 SWISSPROT MATERNAL EFFECT PROTEIN STAUFEN Page 139 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 7437 20134 33374 0.42 6.6E-02 AI243326.1 EST_HUMAN qh41d01.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:1847233 3' 8390 21294 0.48 6.6E-02 D14567.1 NT Penlcillium urticae mitochondrial I-rRNA (large rRNA) gene and its flanking region 8526 21457 34800 2.09 6.6E-02 AF052572.1 NT Homo sapiens chemokine receptor CXCR4 gene, promoter region and complete cds 9043 21972 35331 0.99 6.6E-02 AF006055.1 NT Dictyostelium discoideum darlin (darA) gene, complete cds 9477 22405 35764 1.14 6.6E-02 9629198 NT Human respiratory syncytial virus, complete genome 9477 22405 35765 1.14 6.6E-02 9629198 NT Human respiratory syncytial virus, complete genome 10458 23346 36763 0.54 6.6E-02 AI458752.1 EST_HUMAN tj97g06.x1 NCI_CGAP_Lu24 Homo sapiens cDNA clone IMAGE:2149498 3' 10589 23475 36902 1.44 6.6E-02 Y07848.1 NT Homo sapiens EWS, gar22, rrp22 and bam22 genes 10622 23508 0.81 6.6E-02 1.1430559 NT Homo sapiens vinculin (VCL), mRNA 11400 24316 37763 6.43 6.6E-02 BF374248.1 EST_HUMAN MR1-SN0064-010600-006-a12 SN0064 Homo sapiens cDNA 12773 25402 2.22 6.6E-02 9937991 NT Mus musculus DIPB gene (Dipb), mRNA 603 13669 26572 1.49 6.5E-02 BF027639.1 EST_HUMAN 601671046F1 NIH_MGC_20 Homo sapiens cDNA clone IMAGE:3954178 5' 1014 14064 27008 1.43 6.5E-02 7706068 NT Homo sapiens E2F-like protein (LOC51270), mRNA 1418 14449 27403 3.55 6.5E-02 U47624.1 NT Xenopuas laevis alphe(E)-catenin mRNA, complete cds 1764 14790 27760 2.01 6.5E-02 AE000764.1 NT Aquifex aeollcus section 96 of 109 of the complete genome zv46h12.s1 Soares ovary tumor NbHOT Homo sapiens cDNA clone IMAGE:756743 3' similar to gb:M26038 5750 18823 31920 1.77 6.5E-02 AA443991.1 EST_HUMAN HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR-5 BETA CHAIN (HUMAN); 6822 19855 33067 0.89 6.5E-02 BF665340.1 EST_HUMAN 602118687F1 NIH_MGC_58 Homo sapiens cDNA clone IMAGE:4276029 5' 7312 18480 31303 0.9 6.5E-02 U22661.1 NT Azolobacter vinelandii ATCC 9046 negative regulator MucB (mucB) gene, partial cds 10451 23340 36756 0.66 6.5E-02 BE963200.2 EST_HUMAN 601656817R1 NIH_MGC_67 Homo sapiens cDNA IMAGE:3865637 3' 10451 23340 36757 0.66 6.5E-02 BE963200.2 EST_HUMAN 601656817R1 NIH_MGC_67 Homo sapiens cDNA IMAGE:3865637 3' 10944 23829 37255 0.61 6.5E-02 BF106300.1 EST_HUMAN 601823511F1 NIH_MGC_77 Homo sapiens cDNA clone IMAGE:4043138 5' 11084 24016 37457 6.78 6.5E-02 AA196648.1 EST_HUMAN zr32g05.s1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:665144 3' 12252 26073 4.17 6.5E-02 M21496.1 NT Rabbit microsomal epoxide hycirolase 12578 25280 2.45 6.5E-02 AF102993.1 NT Nectria haematococca kinesin related protein 2 (KRP2) gene, complete cds 697 13664 26566 2.04 6.4E-02 X94549.1 NT A.carterae precursor of peridinin-chlorophylla-portein (PCP) gene 3059 16111 29016 0.97 6.4E-02 6996923 NT Mus musculus histone deacetylase 5 (Hdac5), mRNA 5005 16111 29016 1.01 6.4E-02 6996923 NT Mus musculus histone deacetylase 5 (Hdac5), mRNA 5237 18224 31073 1.56 6.4E-02 AL163247.2 NT Homo sapiens chromosome 21 segment HS21C047 qe07b01.x1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1738249 3' similar to contains LTR8.b3 5635 18711 31611 1.05 6.4E-02 AI191956.1 EST_HUMAN LTR8 repetitive element ; 6097 19158 32291 0.47 6.4E-02 7305186 NT Mus musculus IFN-response element binding factor 1 (IREBF-1), mRNA 6351 19400 32567 5.29 6.4E-02 AF052733.1 NT Heterodera glycines bata-1,4-endoglucanase-1 precursor (HG-eng-1) gene, complete cds 6351 19400 32568 5.29 6.4E-02 AF052733.1 NT Heterodera glycines bata-1,4-endoglucanase-1 precursor (HG-eng-1) gene, complete cds Page 140 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 6667 19705 32900 0.78 6.4E-02 AI672896.1 EST_HUMAN we73g12.x1 Soares_Dieckgraefe_colon_NHCD Homo sapiens cDNA clone IMAGE:2346790 3' 7129 20333 33597 4.59 6.4E-02 BE974448.1 EST_HUMAN 601680425R2 NIH_MGC_83 Homo sapiens cDNA clone IMAGE:3950503 3' 7865 20792 34095 0.46 6.4E-02 AL162757.2 NT Neisseria meningitidisserogroup A srain Z2491 complete genome; segment 6/7 8911 21841 3.15 6.4E-02 6753323 NT Mus musculus chaperonin subunit 6a (zeta) (Cct6a), mRNA 9223 22151 35503 4.56 6.4E-02 AA093305.1 EST_HUMAN k1419.seq.F Human fetal heart, Lambda ZAP Express Homo sapiens cDNA 5' 9672 22598 35971 0.75 6.4E-02 AF150195.1 EST_HUMAN AF150196 Human mRNA from cd34+ setem cells Homo sapiens cDNA clone CBDAIA10 10114 23005 0.61 6.4E-02 BE834083.1 EST_HUMAN RC1-OT0083-150600-014-g06 OT0083 Homo sapiens cDNA 10239 23130 36533 1.96 6.4E-02 AB011126.1 NT Homo sapiens mRNA for KIAA0554 protein, partial cds 10754 23640 37073 0.68 6.4E-02 AF087150.1 NT Homo sapiens DNA topolsomerase II beta (TOP2B) gene, exons 16, 17, and 18 10754 23640 37074 0.68 6.4E-02 AF087150.1 NT Homo sapiens DNA topolsomerase II beta (TOP2B) gene, exons 16, 17, and 18 Human hereditary haemochromatosis region, histone 2A-like protein gene, hereditary haemochromatosis 12131 24972 38475 2.01 6.4E-02 U91328.1 NT (HLA-H) gene, RoRet gene, and sodium phosphate transporter (NPT3) gene, complete cds Human hereditary haemochromatosis region, histone 2A-like protein gene, hereditary haemochromatosis 12131 24972 38476 2.01 6.4E-02 U91328.1 NT (HLA-H) gene, RoRet gene, and sodium phosphate transporter (NPT3) gene, complete cds 12483 25844 4.18 6.4E-02 AF107890.1 NT Homo sapiens much 5B (MUC5B) gene, p artial cds 12531 25254 31830 2.41 6.4E-02 AJ277174.1 NT Drosophila melanogaster mRNA for mod(mdg4)51.4 protein Mus musculus major histocompatibility locus class III regions Hsc70t gene, partial cds; smRNP, G7A, NG23, 1780 14806 27775 1.92 6.3E-02 AF109905.1 NT MutS homolog, CLCP, NG24, NG25, and NG26 genes, complete cds; and unknown genes 3666 16700 2.94 6.3E-02 P37092 SWISSPROT HEAT SHOCK PROTEIN 70 HOMOLOG 5084 18081 30930 1.09 6.3E-02 AI963769.1 EST_HUMAN wr66g10.x1 NCI_CGAP_Ut1 Homo sapiens cDNA clone IMAGE:2492706 3' 5365 18347 31190 0.99 6.3E-02 D90912.1 NT Synechocystis sp. PCC6803 complate genome, 14/27, 1719644-1848241 6376 19425 32591 1.14 6.3E-02 BF210736.1 EST_HUMAN 601873316F1 NIH_MGC_54 Homo sapiens cDNA clone IMAGE:4097499 5' 7612 20547 0.71 6.3E-02 X97869.1 NT H.sapiens gene encoding La autoantigen 9831 22737 36119 1.1 6.3E-02 AJ243916.1 NT Drosophila melanogaster Domina gene, exons 1-3 10517 23404 36816 3.78 6.3E-02 AB010162.1 NT Hepaitis G virus RNA for polyprotein (NS5A region), partial cds, strain: CMR-152 10764 23650 1.14 6.3E-02 AV698070.1 EST_HUMAN AV698070 GKC Homo sapiens cDNA clone GKCAHE01 5' 11158 19425 32591 3.33 6.3E-02 BF210736.1 EST_HUMAN 601873316F1 NIH_MGC_54 Homo sapiens cDNA clone IMAGE:4097499 5' 4349 17363 30227 2.04 6.2E-02 AL161572.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 68 Raitus norvegicus differentation-associated Na-dependent inorganic phosphate cotransporter (DNPI) mRNA, 4447 17458 1.05 6.2E-02 AF271235,1 NT complete cds 4448 18413 0.83 6.2E-02 U67584.1 NT Methanococcus jannaschii section 126 of 150 of the complete genome Page 141 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 4696 17701 7.74 6.2E-02 Q62191 SWISSPROT 52 KD RO PROTEIN (SJOGREN SYNDROME TYPE A ANTIGEN (SS-1)) (RO(SS-A)) (RO52) 5416 18397 1.07 6.2E-02 AF126399.1 NT Arabidopsis thaliana werewolf (WER) gene, complete cds 7104 20310 33571 0.7 6.2E-02 D49530.1 NT Spirulina platensis DNA for adenylate cyclase, complete cds 8075 20988 34305 0.86 6.2E-02 U41453.1 NT Rattus norvegicus PKC binding protein and substrate mRNA, complete cds 8395 21298 0.6 6.2E-02 AL161545.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 45 9502 25990 0.86 6.2E-02 M61101.1 NT Porcine group C rotavirus (strain Cowden) outer membrane protein (VP7) mRNA, complete cds 9882 22797 36183 0.54 6.2E-02 AA778450.1 EST_HUMAN af20a06.s1 Soares_total_fetus_Nb2HF8_9w Homo sapiens cDNA clone IMAGE:1032178 3' 10013 22913 36302 1.31 6.2E-02 6677898 NT Mus musculus stromal cell derived factor receptor 2 (Sdtr2), mRNA 12342 25959 8.19 6.2E-02 AE000750.1 NT Aquifex aeolicus section 82 of 109 of the compiete genome 7137h08.x1 Soares_NSF_F8_9W_OT_PA_P_S1 Homo sapiens cDNA clone IMAGE:3523815 3' similar to 12728 26371 31802 3.62 6.2E-02 BF112039.1 EST_HUMAN TR:Q9Y4S6 Q9Y4S6 HYPOTHETICAL 30.3 KD PROTEIN. [1] ; 275 13370 28285 5 6.1E-02 D16471.1 NT Human mRNA, Xq terminal portion 2737 15730 28725 1.52 6.1E-02 AA159168.1 EST_HUMAN zo07f05.s1 Stratagene pancreas (#937208) Homo sapiens cDNA clone IMAGE:592929 3' 4077 17103 3.55 6.1E-02 U73325.1 NT Arabidopsis thaliana K+ inward reotifying channel protein (AtKC1) gene, complete cds 4765 17770 30635 1.14 6.1E-02 AF119413.1 NT Lupinus albus 1-aminocyclopropane-1-carboxylate synthase 3 (ACS3) gene, complete cds 4765 17770 30636 1.14 6.1E-02 AF119413.1 NT Lupinus albus 1-aminocyclopropane-1-carboxylate synthase 3 (ACS3) gene, complete cds 6158 19216 32356 0.48 6.1E-02 7662463 NT Homo sapiens KIAA1052 protein (KIAA1052), mRNA 6158 19216 32357 0.48 6.1E-02 7662463 NT Homo sapiens KIAA1052 protein (KIAA1052), mRNA Homo sapiens SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, 6352 19401 1.67 6.1E-02 4507070 NT member 3 (SMARCAS) mRNA 7510 20449 33733 0.45 6.1E-02 AJ001497.1 NT Homo saplens AFG3L1 gene, exon 2 8839 21769 35115 4.28 6.1E-02 X99268.1 NT H . sapiens mRNA for B-HLH DNA binding protein 9219 22147 35499 0.78 6.1E-02 BE971853.1 EST_HUMAN 601651086R1 NIH_MGC_81 HOmo sapiens cDNA clone IMAGE:3934604 3' 9219 22147 35500 0.78 6.1E-02 BE971853.1 EST_HUMAN 601651086R1 NIH_MGC_81 HOmo sapiens cDNA clone IMAGE:3934604 3' 11171 24099 37545 4.83 6.1E-02 BE179543.1 EST_HUMAN IL3-HT0618-110500-136-C06 HT0618 Homo sapiens cDNA 12302 25879 34.23 6.1E-02 X70969.1 NT S.japonicum mRNA for serine-enzyme 12955 25516 6.39 6.1E-02 AL163207.2 NT Homo sapiens chromosome 21 segment HS21C007 1289 14322 27268 1.11 6.0E-02 AE001777.1 NT Thermotoga maritima section 89 of 136 of the complete genome 2724 15717 28714 1.5 6.0E-02 AW968848.1 EST_HUMAN EST380924 MAGE resequences, MAGJ Homo sapiens cDNA Mesocestoids corti mitochondrial DNA, NADH dehydrogenase subunit 4, tRNA-Gln, tRNA-Phe, tRNA-Met, 2822 15811 1.63 6.0E-02 AB031289.1 NT ATPase subunit 6, and NADH dehydrogenase subunit 2 2979 13213 26125 1.11 6.0E-02 AA188730.1 EST_HUMAN zp78c04.r1 Stratagene HeLa cell s3 937216 Homo sapiens cDNA clone IMAGE:626310 5' 2979 13213 26126 1.11 6.0E-02 AA188730.1 EST_HUMAN zp78c04.r1 Stratagene HeLa cell s3 937216 Homo sapiens cDNA clone IMAGE:626310 5' 3276 16324 29229 1.13 6.0E-02 AA372376.1 EST_HUMAN EST84266 Colon adenocarcinoma IV Homo sapiens cDNA 5' end Similar to tissu-specific protein Page 142 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 3276 16324 29230 1.13 6.0E-02 AA372376.1 EST_HUMAN EST84266 Colon adenocarcinoma IV Homo sapiens cDNA 5' end similar to tissus-specific protein 3702 16734 1.22 6.0E-02 BE964443.2 EST_HUMAN 60 1658150R1 NIH_MGC_58 Homo sapiens cDNA clone IMAGE:3876060 3' 5089 18086 30937 2.43 6.0E-02 Z67739.2 NT Streptococcus pneumonlae parC, parE and transposase genes and ORF DNA 5232 18220 31068 0.79 6.0E-02 AF146738.1 NT Rattus norvegious teotio specific protein mRNA, complete cds 5583 18560 1.93 6.0E-02 AW370211.1 EST_HUMAN RC3-BT0253-01199-013-b04 BT0253 Homo sapiens cDNA wf48h06.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2358873 3' similar to contains 6460 19505 32680 1.03 6.0E-02 AI807537.1 EST_HUMAN L1.t1 L1 L1 repetitive element ; 7328 18496 31271 2.42 6.0E-02 5174698 NT Homo sapiens stimulated trans-acting factor (50 kDa) (STAF50) mRNA 7328 18496 31272 2.42 6.0E-02 5174698 NT Homo sapiens stimulated trans-acting factor (50 kDa) (STAF50) mRNA 7552 20489 33778 2.15 6.0E-02 BF382349.1 EST_HUMAN 601815274F2 NIH_MGC_56 Homo sapiens cDNA clone IMAGE:4049226 5' 7670 20604 33902 0.64 6.0E-02 BF210488.1 EST_HUMAN 601874710F1 NIH_MGC_54 Homo sapiens cDNA clone IMAGE:4101074 5' 8133 21043 34373 1.78 6.0E-02 AI204275.1 EST_HUMAN qf58b08.x1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1754199 3' 9812 22718 36100 0.8 6.0E-02 AI623167.1 EST_HUMAN ts78a06.x1 NCI_CGAP_GCS Homo sapiens cDNA clone IMAGE:2237382 3' 9812 22718 36101 0.8 6.0E-02 AI623167.1 EST_HUMAN ts78a06.x1 NCI_CGAP_GCS Homo sapiens cDNA clone IMAGE:2237382 3' 9940 22845 36235 1.91 6.0E-02 AJ245365.1 NT Acipenser baeri partial IGLV gene for Immunoglobulin light chain variable region, exons 1-2 9940 22845 36236 1.91 6.0E-02 AJ245365.1 NT Acipenser baeri partial IGLV gene for Immunoglobulin light chain variable region, exons 1-2 EST180654 Jurkat T-cells V Homo sapiens cDNA 5' and similar to similar to heat shock protein 1, 60 kDa- 10416 23305 36723 0.64 6.0E-02 AA309797.1 EST_HUMAN like EST180654 Jurkat T-cells V Homo sapiens cDNA 5' and similar to similar to heat shock protein 1, 60 kDa- 10416 23305 36724 0.64 6.0E-02 AA309797.1 EST_HUMAN like zn87c08.r1 Stratagene lung carcinoma 937218 Homo sapiens cDNA clone IMAGE:565166 5' similar to 11778 24677 1.76 6.0E-02 AA128386.1 EST_HUMAN gb:X69181 60S RIBOSOMAL PROTEIN L31 (HUMAN); wf69h03.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2360885 3' similar to TR:O60298 12893 25483 3.06 6.0E-02 AI89273.1 EST_HUMAN O80298 KIAA0551 PROTEIN ; 248 13346 26258 4.63 5.9E-02 AW934719.1 EST_HUMAN RC1-DT0001-290100-012-e10 DT0001 Homo sapiens cDNA 3025 16077 28980 2.7 5.9E-02 AF190269.1 NT Mus musculus p53 tumor suppressor gene, exon 10 and 11, partial cds; alternatively splicad 7220 25665 33467 0.6 5.9E-02 AF145680.1 NT Drosophila melanogaster LD23107 sting (sting) mRNA, complete cds 9176 22104 35462 2.23 5.9-02 9055249 NT Mus musculus troquois related homeobox 5 (Dresophila) (Irx5), mRNA 9983 21341 0.95 5.9E-02 BF24748.1 EST_HUMAN 601877609F1 NIH_MGC_55 Homo sapiens cDNA clone IMAGE:4105994 5' 11224 24160 3.86 5.9E-02 6679870 NT Mus musculus follistatin-like (Fsti), mRNA 11459 24374 37622 1.5 5.9E-02 11433356 NT Homo sapiens ninein (LOC51199), mRNA 11974 24817 1.7 5.9E-02 BF572539.1 EST_HUMAN 602076548F1 NIH_MGC_62 Homo sapiens cDNA clone IMAGE:4243834 5' 11988 24831 1.68 5.9E-02 AJ240733.1 NT Gallus gallus HKC9 telomere junction 961 14011 4.6 5.8E-02 D90110.1 NT Thiobacillus ferrocxidans merC, merA genes and URF-1 Page 143 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 1687 14717 27678 1.07 5.8E-02 Q61768 SWISSPROT KINESIN HEAVY CHAIN (UBIQUITOUS KINESIN HEAVY CHAIN) (UKHC) 3731 16763 29850 1.44 5.8E-02 AE001775.1 NT Thermotoga maritima section 87 of 136 of the complete genome 4464 17475 30332 7.89 5.8E-02 AW051927.1 EST_HUMAN wx24c02.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2544578 3' 4464 17475 30333 7.89 5.8E-02 AW051927.1 EST_HUMAN wx24c02.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2544578 3' qh56f01.x1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:1848697 3' similar to 4663 17668 30537 5.63 5.8E-02 AI247505.1 EST_HUMAN gb:M13142 COAGULATION FACTOR XI PRECURSOR (HUMAN); qh56f01.x1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:1848697 3' similar to 4663 17668 30538 5.63 5.8E-02 AI247505.1 EST_HUMAN gb:M13142 COAGULATION FACTOR XI PRECURSOR (HUMAN); 4589 17694 2.93 5.8E-02 AF096264.1 NT Gallus gallus tyrosine kinase JAK1 (JAK1) mRNA, complete cds 5262 18248 31098 1.1 5.8E-02 Q61768 SWISSPROT KINESIN HEAVY CHAIN (UBIQUITOUS KINESIN HEAVY CHAIN) (UKHC) Mus musculus epidermal growth factor receptor (Egfr) gene, exons 5 through 28, and complete cds, 5272 18258 31109 0.67 5.8E-02 AF275366.1 NT altematively spliced Mus musculus epidermal growth factor receptor (Egfr) gene, exons 5 through 28, and complete cds, 5272 18258 31110 0.67 5.8E-02 AF275366.1 NT altematively spliced 6129 19188 32324 0.53 5.8E-02 AA190994.1 EST_HUMAN zp86a11.s1 Stratagene HeLa cell s3 937216 Homo sapiens cDNA clone IMAGE:627068 3' 8131 21041 34370 2.7 5.8E-02 M99150.1 NT Human polymorphic microsatellite DNA 8131 21041 34371 2.7 5.8E-02 M99150.1 NT Human polymorphic microsatellite DNA 9224 22152 35504 0.54 5.8E-02 AL163283.2 NT Homo sapiens chromosome 21 segment HS21C083 12431 25191 1.5 5.8E-02 AF220177.1 NT Drosophila melanogaster male fruitiess type-A (fru) mRNA, complete cds 12709 25949 4.96 5.8E-02 AA7604269.1 EST_HUMAN no75e11.s1 NCI_CGAP_AA1 Homo sapiens cDNA clone IMAGE:1112684 3' ou63b05.s1 NCI_CGAP Br2 Homo sapiens cDNA clone IMAGE:1632465 3' similar to WP:C37A2.2 3105 16156 29051 0.88 5.7E-02 AI081644.1 EST_HUMAN CE08611 ; 3119 16170 29055 1.58 5.7E-02 AF119117.1 NT Homo sapiens dopamine trtansporter (SLC6A3) gene, complete cds 3867 16896 29780 3.21 5.7E-02 AW966791.1 EST_HUMAN EST378866 MAGE resequences, MAGI Homo sapiens cDNA 6094 19155 0.75 5.7E-02 AF275946.1 NT Homo sapiens ABCA1 (ABCA1) gene, complete cds 7879 20805 34108 0.55 5.7E-02 BE871911.1 EST_HUMAN 601447937F1 NIH_MGC_65 Homo sapiens cDNA clone IMAGE:3851985 5' 7879 20805 34109 0.55 5.7E-02 BE871911.1 EST_HUMAN 601447937F1 NIH_MGC_65 Homo sapiens cDNA clone IMAGE:3851985 5' 4968 20890 34201 0.78 5.7E-02 D78003.1 NT Xenopus laevis mRNA for fouth component of complement, complete cds 4968 20890 34202 0.78 5.7E-02 D78003.1 NT Xenopus laevis mRNA for fouth component of complement, complete cds 8733 21663 35008 1.59 5.7E-02 AJ296090.1 NT Rattus norvegicus mRNA for potassium channel, alpha subunit (kvg.2 gene) 10364 23253 36673 0.72 5.7E-02 6681260 NT Mus musculue eot2 oncogene (Ect2), mRNA 11633 24539 38010 3.77 5.7E-02 AI752685.1 EST_HUMAN cn18b09.y1 Normal Human Trabecular Bone Cells Homo sapiens cDNA clone NHTBC_cn18b09 random Page 144 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 11633 24539 38011 3.77 5.7E-02 AI752685.1 EST_HUMAN cn18b09.y1 Normal Human Trabecular Bone Cells Homo sapiens cDNA clone NHTBC_cn18b09 random 11787 24709 1.75 5.7E-02 AL163303.2 NT Homo sapiens chromosome 21 segment HS21C103 12625 25775 8.52 5.7E-02 D50320.1 NT Pig DNA for SPAI-2, complete cds 12779 25408 1.59 5.7E-02 AJ271735.1 NT Homo sapiens Xq pseudoautosomel region; segment 1/2 12837 25839 3.1 5.7E-02 AF217490.1 NT Homo sapiens fragile 16D oxido reductase (FOR) gene, exons 8, 9, and partial cds 12971 25935 5.5 5.7E-02 AF261280.1 NT pan troglodytes spolipoprotein-E gene, complete cds 1549 14580 27540 1.35 5.6E-02 AF094455.1 NT Hydrocotyle rotundifolia ribosomal protein L16 (rpl16) gene, intron; chloroplast gene for chloroplast product 2752 17757 30617 1.08 5.6E-02 AB013100.1 NT Lycopersicon esculentum LE-ACS6 mRNA for 1-aminocyclopropans-1-carboxylate synthase, complete cds 4809 17810 30676 1.14 5.6E-02 AA290599.1 EST_HUMAN zs45c01.s1 NCG_CGAP_GCB1 Homo sapiens cDNA clone IMAGE:700416 3' xj02c10.x1 NCI_CGAP_Ut2 Homo sapiens cDNA clone IMAGE:2656050 3' similar to TR:O94979 O94979 6954 10983 33207 4.17 5.6E-02 AW172708.1 EST_HUMAN KIAA0905 PROTEIN. ; od47f12.s1 NCI_CGAP_CGB1 Homo sapiens cDNA clone IMAGE:1371119 3' similar to contains Alu 7218 20218 33465 0.76 5.6E-02 AA866182.1 EST_HUMAN repetitive element; contains element L1 repetitive element ; 7512 20451 33736 3.36 5.6E-02 BE008001.1 EST_HUMAN QV0-BN0147-290400-214-g07 BN0147 Homo sapiens cDNA wz34f05.x1 NCI_CGAP_Brn53 Homo sapiens cDNA clone IMAGE:2559969 3' similar to gb:X06409 RAF 7525 20464 33752 0.58 5.6E-02 AI983738.1 EST_HUMAN PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE (HUMAN); 8364 21268 34602 0.54 5.6E-02 AI183583.1 EST_HUMAN qd64g11.x1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1734308 3' 9360 22286 35652 2.4 5.6E-02 BE542663.1 EST_HUMAN 601067158F1 NH_MGC_10 Homo sapiens cDNA clone IMAGE:3453279 5' 9360 22286 35653 2.4 5.6E-02 BE542663.1 EST_HUMAN 601067158F1 NH_MGC_10 Homo sapiens cDNA clone IMAGE:3453279 5' nf49d07.s1 NCI_CGAP_Aiv1 Homo sapiens cDNA clone IMAGE:923245 similar to TR;G769859 G769859 10328 23217 1.07 5.6E-02 AA482864.1 EST_HUMAN LAMINA ASSOCIATED POLYPEPTIDE 1C. ; 11997 24639 2.43 5.6E-02 AF260225.1 NT Homo sapiens TESTIN 2 end TESTIN 3 genes, complete cds, alternatively spliced 2703 15597 28691 7.61 5.5E-02 X97869.1 NT H. sapiens gene encoding La autoantigen 3261 16309 29214 3.96 5.5E-02 6755501 NT Mus musculus SH3 domain protein 1B (Sh3d1B), mRNA 3882 16911 1.54 5.5E-02 BE968659.1 EST_HUMAN 601650078F1 NIH_MGC_74 Homo sapiens cDNA clone IMAGE:3033859 5' 4312 17325 30192 1.46 5.5E-02 L41551.1 NT Gallid herpesvirus mRNA fragment 4984 17983 30841 0.72 5.5E-02 AF161286.1 NT Murray Valley encephalitis virus strain MVE-1-51, complete genome 5856 18927 32044 2.87 5.5E-02 Q01174 SWISSPROT TROPOMYOSIN ALPHA CHAIN, NON MUSCLE 6258 18927 32044 3.95 5.5E-02 Q01174 SWISSPROT TROPOMYOSIN ALPHA CHAIN, NON MUSCLE 7770 20700 34000 1.61 5.5E-02 6755902 NT Mus musculus tuftelin 1 (Tuft1), mRNA 8697 21628 34972 0.74 5.5E-02 AF170911.1 NT Homo sapiens sodium-dependent vitamin C transporter 1 (SVCT1) mRNA, complete cds Page 145 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 8697 21628 34973 0.74 5.5E-02 AF170911.1 NT Homo sapiens sodium-dependent vitamin C transporter 1 (SVCT1) mRNA, complete cds 10180 23071 36470 0.61 5.5E-02 10947034 NT Homo sapiens eIF4E-transporter (4E-T), mRNA 10180 23071 36471 0.61 5.5E-02 10947034 NT Homo sapiens eIF4E-transporter (4E-T), mRNA 10270 23160 36570 1.27 5.5E-02 U69492.1 NT Mus musculus second IL11 receptor alpha chain (IL11Ra2) gene, exons 1 and 2 Citrobacter freundil DSM 30040 cyclopropane fatty acid synthase (cfa) gene, partial cds, dihydroxyacetone kinase (dhak), glycerol dehydrogenase (dhaD), transcriptional activator (dhaR), 1,3-proparendiol 11458 24373 37821 7.83 5.5E-02 U09771.1 NT dehydrogenase (dhaT), glycerol dehydratase (dhaB),> 13099 25901 31362 1.62 5.5E-02 11421332 NT Homo sapiens hypothetical protein SIRP-b2 (SIRP-b2), mRNA 3065 16117 0.88 5.4E-02 AJ277468.1 NT Orvza sativa rbbi3-1 gene for putative Bowman Birk trypsin inhibitor 3483 18410 8.2 5.4E-02 BE073468.1 EST_HUMAN RC5-BT0559-140200-012-C03 BT0559 Homo sapiens cDNA 8702 21633 1.14 5.4E-02 Z99116.1 NT Bacillus subtilis compiete genome (section 13 of 21); from 2395261 to 2613730 11085 24017 37458 1.76 5.4E-02 AU120889.1 EST_HUMAN AU120889 HEMBB1 homo sapiens cDNA clone HEMBB1001630 5' 11142 24071 37517 2.53 5.4E-02 U20790.1 NT Neurospora orassa ubiquinol-cytochrome c oxidoreductase subunit VIII (QCR8) mRNA, complete cds 12515 25770 2.17 5.4E-02 U44894.1 NT Rana catesbiana heat shock protein 30 (HSP30) mRNA, complete cds 1080 14124 27061 1.35 5.3E-02 AW391246.1 EST_HUMAN QV0-ST0213-021299-062-a09 ST0213 Homo sapiens cDNA 1080 14124 27062 1.35 5.3E-02 AW391246.1 EST_HUMAN QV0-ST0213-021299-062-a09 ST0213 Homo sapiens cDNA ye37f12.r1 Strategene lung (#937210) Homo sapiens cDNA sapiens cDNA clone IMAGE:119951 5' similar to gb:K01506 1525 14556 27517 10.63 5.3E-02 T94759.1 EST_HUMAN HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DP(1) ALPHA CHAIN (HUMAN); 2519 15520 28523 3.27 5.3E-02 AJ276408.1 NT Pseudomonas putida ttgS gene 2984 18036 28939 0.88 5.3E-02 M58417.1 NT Drosophlia melanogaster laminin B2 gene, complete cds 2984 18036 28940 0.88 5.3E-02 M58417.1 NT Drosophlia melanogaster laminin B2 gene, complete cds 3195 16243 29138 4.2 5.3E-02 AJ276408.1 NT Pseudomonas putida ttgS gene 4721 17726 30589 1.05 5.3E-02 AJ011048.1 NT Arabidopsis thaliana eli5 gene, exons 1-11 5223 18212 31957 9.91 5.3E-02 M80463.1 NT Mus musculus caudal type homeobox-1 (Cdx-1) gene, complete cds 5502 18581 31429 1.98 5.3E-02 AE000527.1 NT Helicobacter pylori 26695 section 5 of 134 of the complete genome 5502 18581 31430 1.98 5.3E-02 AE000527.1 NT Helicobacter pylori 26695 section 5 of 134 of the complete genome 6340 19390 32559 1.11 5.3E-02 M85289.1 NT Homo sapiens sulfate proteglycan (HSPG2) mRNA, complete cds 7211 20211 33456 4.08 5.3E-02 9695413 NT Lymphocystis dissese virus 1, complete genome 7451 20392 33662 1.47 5.3E-02 U32832.1 NT Haemophilus influenzae Rd section 147 of 163 of the complete genome 7752 20682 2.51 5.3E-02 S78221.1 NT nuclear protein TIF1 isoform [mice, mRNA, 4053 nt] 8457 21318 34650 0.63 5.3E-02 P38742 SWISSPROT HYPOTHETICAL 130.0 KD PROTEIN IN SNF6-SPO11 INTERGENIC REGION 8976 21096 0.7 5.3E-02 U10098.1 NT Mus musculus 129/Sv cystatin C (cst3) gene, complete cds 9670 22596 35970 1.88 5.3E-02 X03127.1 NT Podospora anserina mitochondrial epsilon-sen DNA Page 146 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 10631 23517 36951 0.67 5.3E-02 AB022605.1 NT Homo sapiens hCMT1b mRNA for mRNA (guanine-7-)methyltransferase, complete cds 10631 23517 36952 0.67 5.3E-02 AB022605.1 NT Homo sapiens hCMT1b mRNA for mRNA (guanine-7-)methyltransferase, complete cds 10749 23635 0.68 5.3E-02 Y07907.1 NT D. rario mRNA for zp-23 POU gene, splice variant (neurula, 9-16 hpf and postsomitogenesis, 20-28 hpf) 10821 23707 37134 1.34 5.3E-02 X68432.1 NT b. rerio pou[c] mRNA for transcritpion factor 2304 15312 246.31 5.2E-02 5031908 NT Homo sapiens meprin A, alpha (PABA peptide hydroclase) (MEP1A) mRNA 3160 16210 29100 2.51 5.2E-02 AJ277661.1 NT Homo sapiens partial LMO1 gene for LIM domain only 1 protein, exon 1 3160 16210 29101 2.51 5.2E-02 AJ277661.1 NT Homo sapiens partial LMO1 gene for LIM domain only 1 protein, exon 1 4016 17043 29933 0.69 5.2E-02 AF236101.1 NT Arabidopsis thaliana putative dicarboxylate diron protein (Crd1) mRNA, complets cds 4376 17390 30253 3.69 5.2E-02 U07132.1 NT Human sterold hormone receptor ner-1 mRNA, complete cds 5322 18306 31156 0.72 5.2E-02 AB035201.1 NT Rattus norvegicus mRNA for thyrogiobulin, complete cds 6140 19199 32336 0.49 5.2E-02 U14731.1 NT Saccharomyces cerevisies Cdc53p (CDC54) gene, complete cds wj80e04.x1 NCI_CGAP_Lym12 Homo sapiens cDNA clone IMAGE:2409150 3' similar to contains MER16.b1 6345 19395 1.19 5.2E-02 AI830965.1 EST_HUMAN MER15 repetitive element ; DNA POLYMERASE PROCESSIVITY FACTOR (POLYMERASE ACCESSORY PROTEIN) (PAP) (DNA- 7650 20584 33881 1.12 5.2E-02 p36311 SWISSPROT BINDING GENE 18 PROTEIN 8773 21703 2.58 5.2E-02 AL163204.2 NT Homo sapiens chromosome 21 segmental HS21C004 10250 23141 36547 2.08 5.2E-02 D10927.1 NT Turnip mosaic virus genomic RNA for Capsid protein, complete cds 10250 23141 36548 2.08 5.2E-02 D10927.1 NT Turnip mosaic virus genomic RNA for Capsid protein, complete cds 12748 25387 2.04 5.2E-02 Q03030 SWISSPROT OXALOACETATE DECARBOXYLASE ALPHA CHAN 2387 15392 0.98 5.1E-02 AL134071.1 EST_HUMAN DKFZp547D073_r1 547 (synonym hfbr1) Homo sapiens cDNA clone DKFZp547D073 5' 4906 17905 30775 0.96 5.1E-02 AF085167.1 NT Hordeum vulgare receptor-like kinase ARK1AS gene, partial cds 5126 18122 0.96 5.1E-02 AB031740.1 NT Homo sapiens PBII gene for sailvary proline-rich protein P-B, complete cds 5181 18173 31018 1.1 5.1E-02 BE957423.2 EST_HUMAN 601653565R2 NIH_MGC_55 Homo sapiens cDNA clone IMAGE:3638361 3' 6969 19997 33225 0.74 5.1E-02 AF280369.1 NT HIV-1 patient 96 from Italy protease (pol) gene, complete cds 7180 18452 31321 1.45 5.1E-02 BF378625.1 EST_HUMAN QV0-UM0051-250800-350-b08 UM0051 Homo sapiens cDNA 8828 21758 35102 1.08 5.1E-02 M26434.1 NT Human hypoxanthine phosphoribosyltransferase (HPRT) gene, complete cds 8828 21758 35103 1.08 5.1E-02 M26434.1 NT Human hypoxanthine phosphoribosyltransferase (HPRT) gene, complete cds 8921 21851 36206 1.65 5.1E-02 AJ131966.1 NT Spodoptera littoralis mRNA for 3-dehydroecydysone 3beta-reductase 9442 22370 35733 0.84 5.1E-02 P02533 SWISSPROT KERATIN, TYPE I CYTOSKELETAL 14 (CYTOKERATIN 14) (K14) (CK 14) 9442 22370 35734 0.84 5.1E-02 P02533 SWISSPROT KERATIN, TYPE I CYTOSKELETAL 14 (CYTOKERATIN 14) (K14) (CK 14) 10325 23214 36826 8.81 5.1E-02 AF012898.1 NT Candida albicans protein phosphatase Ssd1 homolog (SSD1) gene, complete cds 10678 23564 36994 2.93 5.1E-02 P40603 SWISSPROT ANTER-SPECIFIC PROLINE-RICH PROTEIN APG (PROTEIN CEX) 11269 24191 37640 2.49 5.1E-02 AF083930.1 NT Homo sapiens ES18 mRNA, partial cds Page 147 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 11269 24191 37641 2.49 5.1E-02 AF083930.1 NT Homo sapiens ES18 mRNA, partial cds 12756 25390 1.75 5.1E-02 AF062457.1 NT Cucumis melo polygalacturonase precursor (MPG3) mRNA, complete cds 605 13576 26491 2.29 5.0E-02 Af098004.1 NT Mus musculus fatty acid amide hydrolase gene, exon 10 1232 14268 27211 7.54 5.0E-02 Z99104.1 NT Bacillus subtilis complete genome (section 1 of 21); from 1 to 213080 SALIVARY ACIDIC PROLINE-RICH PHOSPHOPROTEIN 1/2 PRECURSOR (PRP-1/PRP-3) (PRP-2/PRP- 2007 15025 28016 4.26 5.0E-02 P02810 SWISSPROT 4) (PIF-F/PIF-S) (PROTEIN C) [CONTAINS; PEPTIDE P-C] 2866 14063 27007 1.71 5.0E-02 U72742.1 NT Oryctolagus cuniclus UDP-glucuronosyltransferase (UGT2B13) mRNA, complete cds 3386 16429 1.67 5.0E-02 7305610 NT Mus musculus Unc-51 like kinase 2 (C, elegans) (Ulk2), mRNA 3656 16692 1.15 5.0E-02 U32782.1 NT Haemophilus influenzae Rd section 97 of 163 of the complete genome 3750 16782 29671 6.07 5.0E-02 U12769.2 NT Antheraea pernyi period clock protein homolog mRNA, complete cds 4934 17933 1.02 5.0E-02 P40232 SWIsSPROT CASEIN KINASE II BETA CHAIN (CK II) 5087 18084 30935 0.91 5.0E-02 AF188530.1 NT Homo sapiens ubiquitous tetratricopeplide containing protein RoXaN mRNA, partial cds 6370 19419 32585 0.73 5.0E-02 AF096264.1 NT Gallus gallus tyosine kinase JAK1 (JAK1) mRNA, complete cds 6563 19604 1.09 5.0E-02 AJ242625.1 NT Mus musculus Dmp-1 gene, exone 1-6 7329 18497 31273 0.52 5.0E-02 P35616 SWISSPROT NEUROFILAMENT TRIPLET L PROTEIN (NEUROFILAMENT LIGHT POLYPEPTIDE) (NF-L) 7967 20889 34200 10.25 5.0E-02 P35616 SWISSPROT NEUROFILAMENT TRIPLET L PROTEIN (NEUROFILAMENT LIGHT POLYPEPTIDE) (NF-L) 8199 21105 0.49 5.0E-02 AW062464.1 EST_HUMAN MR0-CT0064-100899-002-g10 CT0064 Homo sapiens cDNA 10695 23572 36912 1.55 5.0E-02 AF305238.1 NT Mus musculus Fas-interacting serine/threonine kinase 3 (Fist3) mRNA, complete cds 11923 24768 38265 2.4 5.0E-02 U67600.1 NT Methanococcus jannaschii section 142 of 150 of the complete genome 12312 25807 6.67 5.0E-02 Q04047 SWISSPROT NO-ON-TRANSIENT A PROTEIN 241 13338 17.96 4.9E-02 M14230.1 NT Chicken 28-kDa vitamin D-dependent calcium-binding protein (CaBP-28) mRNA, complete cds 390 13474 26393 2.19 4.9E-02 AF275849.1 NT Homo sapiens ABCA1 (ABCA1) gene, complete cds 390 13474 26394 2.19 4.9E-02 AF275849.1 NT Homo sapiens ABCA1 (ABCA1) gene, complete cds 2917 15970 28867 0.76 4.9E-02 U32636.1 NT Zea mays phytoene synthase (Y1) gene, complete cds 3332 16378 29278 1.65 4.9E-02 P54258 SWISSPROT ATROPHIN-1 (DENTATORUBRAL-PALLDOLUYSIAN ATROPHY PROTEIN) zq48a12.s1 Stratagene hNT neuron (#937233) Homo sapiens cDNA clone IMAGE:P632926 3' similar to 3630 16666 0.72 4.9E-02 AA188940.1 EST_HUMAN contans Alu repetitive element; contains element MSR1 repetitive element ; 3652 16688 29582 0.88 4.9E-02 AA400914.1 EST_HUMAN zt78a03.s1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:728428 3' 3652 16688 29583 0.88 4.9E-02 AA400914.1 EST_HUMAN zt78a03.s1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:728428 3' 4320 17334 30196 1.06 4.9E-02 AF135438.1 NT Danio rario de novo DNA methyltransferase 3 (dnmt3) mRNA, partial cds 4320 17334 30197 1.06 4.9E-02 AF135438.1 NT Danio rario de novo DNA methyltransferase 3 (dnmt3) mRNA, partial cds 4391 17405 1 4.9E-02 M23629.1 NT Drosophila melanogaster developmental protein (rough) gene, complete cds 4954 17952 30810 1.55 4.9E-02 AW167821.1 EST_HUMAN xg56g10.x1 NCI_CGAP_Ut4 Homo sapiens cDNA clone IMAGE;2632386 3' 4954 17952 30811 1.55 4.9E-02 AW167821.1 EST_HUMAN xg56g10.x1 NCI_CGAP_Ut4 Homo sapiens cDNA clone IMAGE;2632386 3' Page 148 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 5335 18319 31167 2.64 4.9E-02 7662616 NT Homo sapiens PRO1848 protein (PRO1848), mRNA 5555 18633 31512 1.76 .49E-02 L00122.1 NT Rat elastase II gene, exon 6 5555 18633 31513 1.76 .49E-02 L00122.1 NT Rat elastase II gene, exon 6 7602 20441 33724 1.16 4.9E-02 AE000980.1 NT Archaeoglobus fulgidus section 127 of 172 of the complete genome 9175 22103 1.16 4.9E-02 AE002309.1 NT Chiamydia muridarum, section 40 of 95 of the complete genome 9314 22242 35604 0.86 4.9E-02 AL161559.2 NT Arabldopsis thaliana DNA chromosome 4, contig fragment No. 59 10782 23668 37097 0.58 4.9E-02 P19532 SWISSPROT TRANSCRIPTION FACTOR E3 11839 24690 38179 3.68 4.9E-02 AF008303.1 NT Homo sapiens prepro placental TGF-beta gene, complete cds 12681 25341 1.62 4.9E-02 8923880 NT Homo sapiens CS box-containing WD protein (LOC55884), mRNA 12924 25499 2.96 4.9-02 M19364.1 NT Human gemma-B-crystallin (gamma 1-2) and gamma-C-crystallin (gamma2-1) genes, complete cds 350 13438 26352 1.24 4.8E-02 D16471.1 NT Human mRNA, Xq terminal portion 351 13438 26352 2.14 4.8E-02 D16471.1 NT Human mRNA, Xq terminal portion 511 13582 26496 6.29 4.8E-02 AF003100.1 NT Arabidopsis thaliana AP2 domain containing protein RAP27 mRNA, partial cds zc49b02.s1 Soares_senescent_fibroblasts_NbHSF Homo sapiens cDNA clone IMAGE:325611 3' similar to 2292 15300 28306 2.06 4.8E-02 W51983.1 EST_HUMAN gb:M30938 LUPUS KU AUTOANTIGEN PROTEIN P86 (HUMAN); 3254 16302 29208 1.72 4.8E-02 X17144.1 NT Tetrahymena rostrata histone H311 and histone H411 intergenic DNA 5278 18264 31114 0.86 4.8E-02 U91914.1 NT Streptococcus constellatus D-alanina:D-alanine ligase gene, partial cds 8716 21647 34993 1.33 4.8-02 AW388497.1 EST_HUMAN MR2-ST0129-221099-012-b02 ST0129 Homo sapiens cDNA 9674 22600 35973 0.84 4.8E-02 AJ001398.1 NT Fugu rubripes rps24 gene 9674 22600 35974 0.84 4.8E-02 AJ001398.1 NT Fugu rubripes rps24 gene yz97f09.r1 Soares melanocyte 2NbHM Homo sapiens cDNA clone IMAGE:291017 5' simllar to contains Alu 7143 20251 33503 3.42 4.7E-02 W01153.1 EST_HUMAN repetitive element; 7212 20212 33457 0.79 4.7E-02 BF686625.1 EST_HUMAN 602143554F1 NIH_MGC_46 Homo sapiens cDNA clone IMAGE:4304772 5' 7212 20212 33458 0.79 4.7E-02 BF686625.1 EST_HUMAN 602143554F1 NIH_MGC_46 Homo sapiens cDNA clone IMAGE:4304772 5' 7247 20156 33396 1.59 4.7E-02 M62752.1 NT Rat statin-related protein (s1) gene, complete CDS 8181 21088 0.52 4.7E-02 1143 1896 NT Homo sapiens protein x 0001 (LOC51185), mRNA 8826 21756 35100 9.98 4.7E-02 X15543.1 NT B.taurus mRNA for RF-36-DNA-binding protein 9508 22435 35799 1.23 4.7E-02 X89211.1 NT H.sapiens DnA for endogenous retroviral like element 9527 22454 3.03 4.7E-02 AB026678.1 NT Gallus gallus Wpkci-8 gene, complete cds 9768 22692 36078 8.73 4.7E-02 X15543.1 NT B. taurus mRNA for RF-36-DNA-binding protein 10173 23064 36461 0.53 4.7E-02 BF305237.1 EST_HUMAN 601892692F1 NIH_MGC_17 Homo sapiens cDNA clone IMAGE:4138414 5' 10255 23145 0.57 4.7E-02 AI873042.1 EST_HUMAN we79c10.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2347314 3' 11989 24832 38328 1.5 4.7E-02 U73621.1 NT Bos taurus paired box protein (pax-6) gene, partial cds Page 149 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 11989 24832 38329 1.5 4.7E-02 U73621.1 NT Bos taurus paired box protein (pax-6) gene, partial cds 12500 25951 1.89 4.7e-02 AV648521.1 EST_HUMAN AV648521 GLC Homo sapiens cDNA clone GLCBKD02 3' 290 13384 26300 1.01 4.6E-02 BE153583.1 EST_HUMAN PM0-HT0339-251190-003-g05 HT0339 Homo sapiens cDNA 763 13820 26749 2.82 4.6E-02 AE000445.1 NT Escherichia coli K-12 MG1655 section 335 of 400 of the complete genome am50d02.s1 Johnstan frontal cortex Homo sapiens cDNA clone IMAGE: 1538979 3' similar to TR:P90533 1318 14351 0.83 4.6E-02 A1014255.1 EST_HUMAN P90533 LIMA ;contains element LTR1 restitive element ; 1386 14417 27372 3.79 4.6E-02 AV727059.1 EST_HUMAN AV727059 HTC Homo sapiens cDNA cloe HTCBWC01 5' xn24f03.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2694653 3' similar to SW:GRF1_HUMAN 2511 15512 28515 2.84 4.6E-02 AW236023.1 EST_HUMAN Q12849 G-RICH SEQUENCE FACTOR-1; 2855 13384 26300 2.24 4.6E-02 BE153583.1 EST_HUMAN PM0-HT0339-251199-003-g05 HT0339 Homo sapiens cDNA 3378 16104 29008 0.67 4.6E-02 BE153583.1 EST_HUMAN PM0-HT0339-251199-003-g05 HT0339 Homo sapiens cDNA 5355 16104 29008 1.07 4.6E-02 BE153583.1 EST_HUMAN PM0-HT0339-251199-003-g05 HT03399 Homo sapiens cDNA 4219 17235 1.21 4.6E-02 AF220365.1 NT Mus musculus nucleolar RNA helicase II/Gu (ddx21) gene, complete cds Haplochromis burtoni gonadotropin-releasing homone and GnRH- associated peptide precurser (Gnrh2) 5936 19003 32122 1.49 4.6E-02 AF076962.1 NT gene, complete cds 6476 19521 92697 3.36 4.6E-02 X61624.1 NT C.reinharditii atp2 (atpB) mRNA 6476 19521 92698 3.36 4.6E-02 X61624.1 NT C.reinharditii atp2 (atpB) mRNA qc60b06.x1 Soares_placenta_8to9weeks_2NbHP8to9W Homo sapiens cDNA clone IMAGE:1713971 3' 7109 20313 33576 1.25 4.6E-02 AI149574.1 EST_HUMAN similar to contains L1.13 L1 repetitive element ; 8357 21262 34596 0.52 4.6E-02 6978720 NT Rattus norvegious Cathepsin H (Ctsh), mRNA 9214 22142 35497 3.8 4.6E-02 BE154006.1 EST_HUMAN PM0-HT0339-060400-009-G12HT0339 Homo sapiens cDNA 11840 24691 38180 4.09 4.6E-02 AA913328.1 EST_HUMAN ol27h09.s1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:1524737 3' 13016 25563 3.4 4.6E-02 X57808.1 NT Human gemline immunoglobulin lambda light chain gene 469 13540 26463 2.77 4.5E-02 P22448 SWISSPROT RETINOIC ACID RECEPTOR BETA (RAR-BETA) 1246 14282 27224 0.8 4.5E-02 AF005730.1 NT Marburg virus strain M/S.Africa/Johannesburg/1975/Ozolin VP35 gene, complete ods 1246 14282 27225 0.8 4.5E-02 AF005730.1 NT Marburg virus strain M/S.Africa/Johannesburg/1975/Ozolin VP35 gene, complete ods 1826 14849 27826 4.38 4.5E-02 P32182 SWISSPROT HEPATOCYTE NUCLEAR FACTOR 3-BETA (HNF-3B) 2122 15135 28141 1.85 4.5E-02 AE003964.1 NT Xylella fastidiosa, section 110 of 229 of the complete genome 3787 16818 29706 5.68 4.5E-02 AL163278.2 NT Homo sapiens chromosome 21 segment HS21C078 Homo sapiens ASCL3 gene, CEGP1 gene, C11orf14 gen, C11orf15 gene, C11orf16 gene and C11orf17 6478 19523 32701 1.5 4.5E-02 Aj40087.1 NT gene 6785 19818 33030 0.98 4.5E-02 AL163280.2 NT Homo sapiens chromosome 21 segment HS21C080 Methanosarcina frisia carbon monoxide dehydrogenase large subunit (cdhlA) gene; carbon monoxide 7205 20205 33450 0.64 4.5E-02 L26487.1 NT dehydrogenase small subunit (cdh1B) gene, complete cds Page 150 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value Methanosarcina frisia carbon monoxide dehdrogenase large subunit (cdhlA) gene; carbon monoxide 7205 20205 33451 0.64 4.5E-02 L26487.1 NT dehydrogenase small subunit (cdhlB) gene, complete cds 8964 21894 35251 2.15 4.5E-02 AF036684.1 NT Arabidopsis thaliana CCAAT-box binding factor HAP3 homolog gene, complete ods 10456 23344 36761 4.29 4.5E-02 AA325216.1 EST_HUMAN EST28167 Gerebellum II Homo sapiens cDNA 5' end similar to similar to neuro-D4 protein 10712 23598 37025 0.95 4.5E-02 AB000470.1 NT Gallus gallus mRNA for alpha1 integrin, complete cds 12497 25237 31861 2.73 4.5E-02 11418013 NT Homo sapiens ret finger protein-like 3 (RFPL3), mRNA 12865 25846 31494 4.18 4.5E-02 AA191097.1 EST_HUMAN zq43f11.r1 Stratagene hNT neuron (#937233) Homo sapiens cDNA clone IMAGE:632493 5' 236 1334 4.12 4.4E-02 BE972733.1 EST_HUMAN 601652154F1 NIH_MGC_82 Homo sapiens cDNA clone IMAGE:3935388 5' 2108 15122 5.72 4.4E-02 P31568 SWISSPROT HYPOTHETICAL PROTEIN (ORF 2280) 2513 15514 28517 1.56 4.4E-02 AW875475.1 EST_HUMAN QV2-PT0012-010300-070-g02 PT0012 Homo saplens cDNA 3708 16740 29629 2 4.4E-02 AF159160.1 NT Myxococeus xanthus serine/threonine kinase Pkn10 (pkn10) gene, complete cds Homo sapiens S164 gene, partial cds; PS1 and hypothetical protein genes, complete cda; and S171 gene, 4740 17745 30605 1.51 4.4E-02 AF109907.1 NT partial cds Homo sapiens S164 gene, partial cds; PS1 and hypothetical protein genes, complete cds; and S171 gene, 4740 17745 30606 1.51 4.4E-02 AF109907.1 NT partial cds 5399 18381 31221 1.05 4.4E-02 AF081575.1 NT Petunia x hylorida flavonoid 3'5'-hydroxyiase (Hf1) gene, complete cds 7477 20417 33695 4.16 4.4E-02 AF95824.1 NT Canis familiaris matrix metalloproteinase 9 (MMP-9) mRNA, partial cds 7477 20417 33696 4.16 4.4E-02 AF95824.1 NT Canis familiaris matrix metalloproteinase 9 (MMP-9) mRNA, partial cds 8273 21178 34514 0.42 4.4E-02 11525868 NT Homo sapiens hypothetical protein PRO2492 (PRO2492), mRNA 8273 21178 34515 0.42 4.4E-02 11525868 NT Homo sapiens hypothetical protein PRO2492 (PRO2492), mRNA 9312 22240 35601 2.47 4.4E-02 AA736969.1 EST_HUMAN nw13h03.s1 NCI_CGAP_SS1 Homo sapiens cDNA clone IMAGE: 1239221 3' Hepatitis E virus strain HEV-US2 polyprotein (ORF1), (ORF3), and capsid protein (ORF2) genes, complete 11510 24420 37875 3.67 4.4E-02 AF060669.1 NT cds 11646 24552 38023 2.92 4.4E-02 AA496739.1 EST_HUMAN ae33f04.r1 Gessler Wilms tumor Homo saplens cDNa clone IMAGE:897631 5' 12248 25071 2.67 4.4E-02 AB040926.1 NT Homo sapiens mRNA for KIAA1493 protein, partial cds 12416 25960 1.9 4.4E-02 BF241245.1 EST_HUMAN 601878746F1 NIH_MGC_55 Homo sapiens cDNA clone IMAGE:4107418 5' 807 13863 26798 6.2 4.3E-02 AF003249.1 NT Morone saxatiliis myosin heavy chain FM3A (FM3A) mRNA, complete cds 2603 15601 28595 1.87 4.3E-02 AV704878.1 EST_HUMAN AV704878 ADB Homo sapiens cDNA clona ADBAOH08 5' 3491 16530 29430 10.72 4.3E-02 AL163210.2 NT Homo sapiens chromosome 21 segment HS21C010 3727 16759 1.33 4.3E-02 AF060568.1 NT Homo sapiens promyelocytic leukemia zinc finger protein (PLZF) gene, complete cds oy69g05.x1 NCI_CGAP_CLL1 Homo sapiens cDNA clone IMAGE:1671128 3' similar to contains Alu 5337 18321 31170 1.18 4.3E-02 AI075275.1 EST_HUMAN repetitive element, contains element MER3 repetitive element ; 6772 19806 33016 4.92 4.3E-02 P30427 SWISSPROT PLECTIN 6772 19806 33017 4.92 4.3E-02 P30427 SWISSPROT PLECTIN Page 151 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 7036 20062 33296 0.92 4.3E-02 AA652266.1 EST_HUMAN ns69c12.s1 NCI-CGAP_Pr2 Homo sapiens cDNA clone IMAGE:1188886 8368 21272 0.44 4.3E-02 L15299.1 NT Yeast pra-aminobenzoate synthase gene, complete cds 9079 22008 35364 0.9 4.3E-02 AF293359.1 NT Homo sapiens desmocollin 3 (DSC3) gene, complete cds, altematively spliced 9359 22287 35650 1.16 4.3E-02 x55322.1 NT H.sapiens NCAM mRNA for neural cell adhesion molecule 9359 22287 35651 1.16 4.3E-02 x55322.1 NT H.sapiens NCAM mRNA for neural cell adhesion molecule 847 13902 26842 2.67 4.2E-02 AU123327.1 EST_HUMAN AU123327 NT2RM2 Homo sapiens cDNA clone NT2RM2000020 5' 891 13944 2.51 4.2E-02 AU123327.1 EST_HUMAN AU123327 NT2RM2 Homo sapiens cDNA clone NT2M2000020 5' wx.34g01.x1 NCI_CGAP_Pit1 Homo sapiens cDNA clone IMAGE:2545584 3' similar to TR:Q63291 Q63291 921 13973 26920 0.67 4.2E-02 AW003645.1 EST_HUMAN L1 RETROPOSON, ORF2 MANA ; contains L1.t3 L1 L1 repetitive element; 1749 14776 1.24 4.2E-02 AL445066.1 NT Thermoplasma aoidophilum complete genome; segment 4/5 3732 16764 29651 1.53 4.2E-02 P23091 SWISSPROT TRANSFORMING PROTEIN MAF 4214 17231 30100 0.79 4.2E-02 BE262605,1 EST_HUMAN 601150933F1 NIH_MGC_19 Homo sapiens cDNA clone IMAGE:3503505 5' Homo sapiens cytochrome P450 polypeptide 43 (CYP3A43) gen, partial cds; cytochrome P450 polypeptide 4 (CYP3A4) and cytochrome P450 polypeptide 7 (CYP3A7) genes, complete cds; and oytoohrome P450 6812 18884 31993 0.73 4.2E-02 AF280107.1 NT polypeptide 5 (CYP3A5) gene, partial cds Homo sapiens cytochrome P450 polypeptide 43 (CYP3A43) gene, partial cds; cytochrome P450 polypeptide 4 (CYP3A4) and cytochrome P450 polypeptide 7 (CYP3A7) genes, complete cds; and cytochrome P450 5812 18884 31994 0.73 4.2E-02 AF280107.1 NT polypeptide 5 (CYP3A5) gene, partial cds 7323 18491 31264 0.79 4.2E-02 BE268285.1 EST_HUMAN 601124596F1 NIH_MGC_8 Homo sapiens cDNA clone IMAGE:2989319 5' 7950 20872 34183 4.63 4.2E-02 AF276752.1 NT Legionella pneumophila catelase-peroxidase (katA) gene, complete cds 7976 20897 34210 0.72 4.2E-02 AV730347.1 EST_HUMAN AV730347 HTF Homo sapiens cDNA clone HTFAVH04 5' 9369 22297 35660 4.41 4.2E-02 005095 SWISSPROT ALPHA-ACTIIN 3, NON MUSCULAR (F-ACTIN CROSS LINKING PROTEIN) 10660 23546 36980 1.74 4.2E-02 Q16650 SWISSPROT T-BRAIN-1 PROTEIN (T-BOX BRAIN PROTEIN 1) (TBR-1) (TES-56) 11752 24653 38134 2.3 4.2E-02 BE815822 1 EST_HUMAN PM3-BN0174-250500-009-d10 BN0174 Homo sapiens cDNA 11752 24653 38135 2.3 4.2E-02 BE815822 1 EST_HUMAN PM3-BN0174-250500-009-d10 BN0174 Homo sapiens cDNA 11938 24782 3279 1.69 4.2E-02 AF176458.1 NT PRRS isolate PRRSV36 envelope glycoprotein gene, complete cds 12751 25889 3.73 4.2E-02 AL983494.1 EST_HUMAN wt49g10.x1 NCI_CGAP_Pant Homo sapiens cDNA clone IMAGE:2610860 3' 533 13602 26513 0.67 4.1E-02 AF200629.1 NT Homo sapiens HPS1 gene, intron 5 2725 15718 28715 1.05 4.1E-02 AE002330.2 NT Chlamydia muldarum, section 60 of 85 of the complete genome 3969 16997 29882 0.69 4.1E-02 BE297236.1 EST_HUMAN 60177907F1 NIH_MGC_17 Homo sapiens cDNA clone IMAGE:3533353 5' 3969 16997 29883 0.69 4.1E-02 BE297236.1 EST_HUMAN 60177907F1 NIH_MGC_17 Homo sapiens cDNA clone IMAGE:3533353 5' 4585 17593 9.36 4.1E-02 AW893484.1 EST_HUMAN QV1-NN0012-180400-164-f06 NN0012 Homo sapiens cDNA 5839 18910 32025 0.94 4.1E-02 BE251894.1 EST_HUMAN 601107535F1 NIH_MGC_16 Homo apiens cDNA clone IMAGE:3343856 5' 5839 18910 32026 0.94 4.1E-02 BE251894.1 EST_HUMAN 601107535F1 NIH_MGC_16 Homo apiens cDNA clone IMAGE:3343856 5' Page 152 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 7209 20209 1.02 4.1e-02 x75881.1 NT A.thaliana mRNA for plasma membrane intrinsic protein 1a 7458 20398 33671 1.51 4.1E-02 AE002132.1 NT Ureaplasma urealyticum section 33 of 59 of the complete genome 7936 20858 34166 1.96 4.1E-02 7662347 NT Homo sapiens KIAA0867 protein (KIAA0867), mRNA Mus musculus proviral retroviral insertion in the cGMP-phosphodiesterase (rd beta PDE) gene, intron 1, with 8045 20958 34273 0.66 4.1E-02 L02110.1 NT the proviral insert encompassing the env pseudogene (3' end) and 3'LTR Fugu rubripes neural cell adhesion molecule L1 homolog (L1-CAM) gene, complete cds; putative protein 1 (PUT1) gene, partial cds; mltosis-speclfic chromosome segregation protein SMC1 homology (SMC1) gene, 8234 21139 34471 295 4.1E-02 AF026198.1 NT complete cds; and calclum channel alpha-1 subunt> ADAM-TS 1 PRECURSOR (A DISINTEGRIN AND METALLOPROTEINASE WITH THROMBOSPONOIN 8785 21715 35062 0.72 4.1E-02 P97857 SWISSPROT MOTIFS 1) (ADAMTS-1) (ADAM-TS1) 9203 22131 35487 0.76 4.1E-02 P34687 SWISSPROT CUTICLE COLLAGEN 34 9697 22622 36000 0.96 4.1E-02 AA372396.1 EST_HUMAN EST84291 Colon adenocarcinoma IV Homo sapiens cDNA 5' end 13040 25890 31479 12.28 4.1E-02 AJ271909.1 NT Brassica napus gln gene for plestid glutamine synthetase, exons 1-12 1669 14699 27659 1.32 4.0E-02 AI675392.1 EST-HUMAN wb98h01.x1 NCI_CGAP-Pr28 Homo sapiens cDNA clone IMAGE:2313745 3' 3290 16337 29240 4.8 4.0E-02 AB40904.1 NT Homo sapiens mRNA for KIAA1471 rpotein, partial cds 3864 16893 29777 1.39 4.0E-02 L11910.1 NT Huma retinoblastoma susceptibility gene exons 1-27, complete cds 5273 18259 31111 0.7 4.0E-02 AB042297.1 NT Homo sapiens PTS gene for 6-pyruvoyltetrahydropterin synthese, complete cds 5379 18361 31201 1.06 4.0E-02 BF242746.1 EST_HUMAN 601877607F1 NIH_MGC_55 Homo sapiens cDNA clone IMAGE:4106280 5' Homo sapiens cytochrome P450 jpolypeptide 43 (CYP3AA43) gene, partial cds; cytochrome P450 polypeptide 4 (CYP3A4) and cytochrome P450 polhypeptide 7 (CYP3A7) gene, complete cds; and cytochrome P450 5564 18642 31520 5.92 4.1E-02 AF280107.1 NT polypeptide 5 (CYP3A5) gene, partial cds 7n52h07.x1 NCI_CGAP_Lu24 Homo sapiens cDNA clone IMAGE:3568380 3' similar to TR:O75296 O75296 6458 19503 32678 1.61 4.1E-02 RE110434.1 EST_HUMAN R29124_1. ; Strangylocentrotus purpuratus homolog of human bone morphogenetic protein (submp) mRNA, complete 8143 21052 34384 6.09 4.1E-02 L23838.1 NT cds 8217 21122 0.42 4.1E-02 AL161535.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 35 8235 21140 34472 0.88 4.0E-02 AB000381.1 NT Homo sapiens DNA for GPI-anchored molecule-like protein, oomplete cds 8235 21140 34473 0.88 4.0E-02 AB000381.1 NT Homo sapiens DNA for GPI-anchored molecule-like protein, oomplete cds 8292 21196 34533 0.48 4.0E-02 AF288153.1 NT Homo sapiens erythrocyte tropomodulin (E-TMCD) gene, exon 7 GLUCOMAMYLASE S1/S2 PRECURSOR (GLUCAN 1,4-AL PHA-GLUCOSIDASE) (1.4-ALPHA-D-GLUCAN 9276 22204 35561 241 4.0E-02 P08610 SWISSPROT GLUCOHYDROLASE) 10170 23061 0.72 4.0E-02 BF679376.1 SET_HUMAN 602153884F1 NIH_MGC_83 Homo sapiens cDNA clone IMAGE:4294724 5' 10193 23084 36486 2.36 4.0E-02 AJ000941.1 NT Methanobacterium themoautotrophicum strain Marburg, Thiol.fumarate reductace subunit A 10490 23378 0.9 4.0E-02 D43949.1 NT Human mRNA for KIAA082 gene, partial cds Page 153 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 12186 25022 1.76 4.0E-02 AJ001018.1 NT Kluyveromyces lactis gene for Ca++ ATPase 12403 25730 31668 14.22 4.0E-02 AJ001056.1 NT Ovis aries mRNA for acetyi-coA carboxylase 1147 14189 27128 2.57 3.9E-02 BF516149.1 EST HUMAN UI-H-BW1-anx-h-08-0UI.s1 NCI_CGAP_Sub7 Homo sapiens cDNA clone IMAGE:3084134 3' 1373 14405 27358 1.89 3.0E-02 P41047 SWISSPROT FAS ANTIGEN LIGAND 1975 14993 27976 287 3.9E-02 AJ403386.1 NT M.musculus DNA for desmin-binding fragment DesD7 Homo sapiens succhinate dehydrogenase complex, subunit C, integral membrane protein, 15kD (SDHC) 2754 15745 1.98 3.9E-02 4506862 NT mRNA 5684 18757 31680 0.76 3.9E-02 D50608.1 NT Rat gene for cholecystokinin type-A receptor (CCKAR), complete cds 5684 18757 31681 0.76 3.9E-02 D50608.1 NT Rat gene for cholecystokinin type-A receptor (CCKAR), complete cds 5933 19000 32120 1.15 3.9E-02 BE968841.1 EST_HUMAN 601649874F1 NIH_MGC_74 Homo sapiens cDNA clone IMAGE:3933642 5' 6071 19132 32266 0.53 3.9E-02 BF675203.1 EST_HUMAN 602138132F1 NIH_MGC_83 Homo sapiens cDNA clone IMAGE:4274910 5' 7411 20110 33344 1.21 3.9E-02 BE271437.1 EST_HUMAN 601140729F1 NIH_MGC_9 Homo sapien cDNA cvlone IMAGE:3049830 5' 8409 21312 34644 0.44 3.9E-02 P48778 SWISSPROT ANTIGEN GOR 8422 21354 34692 1.67 3.9E-02 BF239613.1 EST_HUMAN 601906848F1 NIH_MGC_54 Homo sapiens cDNA clone IMAGE:4134779 5' 8638 21569 34907 0.81 3.9E-02 AJ229041.1 NT Homo sapiens 959 kb contig between AML1 and CBR1 on chromosome 21q22; segment 1/3 8638 21569 34908 0.81 3.0E-02 AJ229041.1 NT Homo sapiens 959 kb contig between AML1 and CBR1 on chromosome 21q22; segment 1/3 11844 21312 34644 1.81 3.9E-02 P48778 SWISSPROT ANTIGEN GOR 12271 25854 13.04 3.9E-02 AB042553.1 NT Felis catus G-CSF gene for granulocyte clony-stimulating factor, complete cds Human germline T-cell receptor beta chain TCRBV-17S1A1T, TCRBV17S1A1T, TCRBV2S1, TCRBV10S1P, TCRBV29S1P, TCRBV19S1P, TCRBV15S1, TCRBV11S1A1T, HVB relic, TCRBV28S1P, TCRBV34S1, TCRBV14S1, 12870 25472 2.28 3.9E-E02 U66061.1 NT TCRBV3S1, TCRBV4S1A1T, TRY4, TRY5, TRY6, TRY7, TRY8, TCRBD1, TCRBJ1S1, TCRBJ1S2,> Mue musculus chromosome X contigB; X-linke4d lymphocyte reguleted 5 gene, Zinc finger protein 275, Zinc 12986 25786 18.85 3.9E-02 AL049866.2 NT finger protein 92, mmxq28orf 2133 15146 0.94 3.8E-02 AJ251973.1 NT Homo sapiens partial steerin-1 gene 6040 18037 30893 1.24 3.8Ee-02 AU124122.1 EST_HUMAN AU124122 NT2RM2 Homo sapiens cDNA clone NT2RM2001698 5' 5626 18702 31601 1.01 3.8E-02 M11228.1 NT Human protein C gene, complete cds 6324 19374 32542 1.1 3.8E-02 P10284 SWISSPROT HOMEOBOX PROTEIN HOX-B4 (HOX-2.6) 7702 20634 33931 1.42 3.8E-02 6005700 NT Homo sapiens ATP-binding cassette, sub-family A (ABC1), member 8 (ABCA8), mRNA 8034 20949 0.43 3.8E-02 AA3E82700.1 EST_HUMAN EST96937 Testis I Homo sapiens cDNA 5' end 9222 22150 1.39 3.8E-02 M60675.1 NT Human von Willebrand factor gene, exons 23 through 34 11097 24028 37472 2.4 3.8E-02 AF143952.2 NT Homo sapiens PELOTA (PELOTA) gene, complete cds 1019 14068 27011 2.9 3.7E-02 P19137 SWISSPROT LAMININ ALPHA-1 CHAIN PRECURSOR (LAMININ A CHAIN) Page 154 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Aduit Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value Homo sapiens plasma membrane calclum ATPase Isoform 1 (ATP2B1) gene, alternative splice products, 1415 14446 27400 1.1 3.7E-02 L14561.1 NT partial cds 2252 15262 28271 5.12 3.7E-02 AI984806.1 EST_HUMAN wr85e08.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2494502 3' 2615 15613 28608 0.96 3.7E-02 AB018261.1 NT Homo sapiens mRNA for KIAA0718 protein, partial cds 3097 16148 29045 0.73 3.7E-02 P79944 SWISSPROT EOMESODERMIN 3099 16150 29046 5.51 3.7E-02 BF312963.1 EST_HUMAN 601896233F1 NIH_MGC_19 Homo sapiens cDNA clone eIMAGE:4125584 5' 6875 19906 33121 0.47 3.7E-02 AJ132405.1 NT Homo sapiens GDF-9B gene 7434 25980 0.86 3.7E-02 AP000063.1 NT Aeropyrum pernix genomic DNA, section 6/7 8146 21055 34387 0.57 3.7E-02 AE003975.1 NT Xylella fastidiosa, section 121 of 229 of the co9mplete genome 10518 23405 1.05 3.7E-02 AA782516.1 EST_HUMAN ai55c09.s1 Soares_parathyroid_tumor_NbHPA Homo sapiens cDNA clone 1360912 3' 12310 25116 38578 9.66 3.7E-02 bf124974.1 EST_UMAN 601762117F1 NIH_MGC_20 Homo sapiens cDNA clone IMAGE:4024973 5' 12928 25759 31574 2.33 3.7E-02 11418392 NT Homo sapiens solute carrier family 22 (organic cation transporter), member 1 (SLC22A1), mRNA 3722 16754 29642 0.88 3.6E-02 X73221.1 NT H.vulgare Ss1 gene for sucrose synthase Homo sapiens genomic region containing hypervariable minisatelites chromosome 10[10q26.3] of Homo 3730 16762 29649 0.88 3.6E-02 AL096806.1 NT sapeiens C.glutamicum gap, pgk and tol genes for glycereldehyde-3-phosphate, phosphoglycerate kinase eand 5612 18688 31568 0.65 3.6E-02 X59403.1 NT triosephosphate isomerase C.glutamicum gap, pgk and tpi genes for glyceraldehyde-3-phoshate, phoshoglycerate kinase and 5612 18688 31583 0.65 3.6E-02 X59403.1 NT triosephosphate isomerase 5690 18763 31688 0.54 3.6E-02 AF181722.1 NT Homo sapiens RU2AS (RU2) mRNA, complete cds 7004 20031 33262 5.25 3.6E-02 AW945516.1 EST_HUMAN CM2-EN0013-110500-192-b10 EN0013 Homo sapiens cDNA 7004 20031 33263 5.25 3.6E-02 AW945516.1 EST_HUMAN CM2-EN0013-110500-192-b10 EN0013 Homo sapiens cDNA 7294 18463 31333 0.46 3.6E-02 U67675.1 NT Methanococcus jannaschil section 117 of 150 of the complete genome 7444 20385 33654 1.58 3.6E-02 AF025962.1 NT CHromatium vincsum sulfur globule protein Cv2 precursor (sgp2) gene, complete cds nw20e05.s1 NCI_CGAP_GCB0 Homo sapiens cDNA clone IMAGE:1241024 3' similar to gb:J00314_rna2 7689 20622 33922 2.87 3.6E-02 aa714521.1 EST_HUMAN TUBULIN BETA-1 CHAIN (HUMAN); 8081 20993 34311 0.77 3.6E-02 BE43078.1 EST_HUMAN MR0-HT0158-030200-003-b08 HT0158 Homo sapiens cDNA Dictyostelium discoldeum.unknown spore germination-specific protein-like protein, orf1, arf2 and arf3 genes, 9928 22833 36220 2.52 3.6E-02 U20608.1 NT complete cds Dictyostelium discoldeum unknown spore germination-specific protein-like protein, orf1, orf2 and orf3 genes, complete odo 10139 23030 36427 0.8 3.6E-02 BF347586.1 EST_HUMAN 602020453F1 NCI_CGAP_Bm67 Homo sapiens cDNA clone IMAGE:4156116 5' 11625 24532 38000 1.57 3.6E-02 BF131609.1 EST_HUMAN 60 1820418F1 NIH_MGC_58 Homo sapiens cDNA clone IMAGE:4052570 5' 11625 24532 38001 1.57 3.6E-02 BF131609.1 EST_HUMAN 60 1820416F1 NIH_MGC_58 Homo sapiens cDNA clone IMAGE:4052570 5' Page 155 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 920 13972 26919 1.72 3.5E-02 U09506.1 NT Dresophila melanogaster tiggrin mRNA, complete cds 1036 14083 27023 1.29 3.5E-02 AF253417.1 NT Homo sapiens microsomal epoxide hydrolase (EPHX1) gene, complete cds 1584 14615 27577 2.74 3.5E-02 BF678085.1 EST_HUMAN 602085136F1 NIH_MGC_83 Homo sapiens cDNA clone IMAGE:4249377 5' 1584 14615 27578 2.74 3.5E-02 BF078085.1 EST_HUMAN 602085136F1 NIH_MGC_83 Homo sapiens cDNA clone IMAGE:4249377 5' 4309 17323 30190 2.4 3.5E-02 AE001773.1 NT Thermotoga maritima section 85 of 136 of the complete genome 4420 17431 30293 1.07 3.5E-02 P53780 SWISSPROT CYSTATHIONINE BETA-LYASE PRECURSOR (CBL) (BETA-CYSTATHIONASE) (CYSTEINE LYASE) 6466 19511 32686 1.62 3.5E-02 J01238.1 NT Maize actin 1 gene (MAc1), complete cds yp44a05.r1 Soares retina N2b5HR Homo sapiens cDNA clone IMAGE:190256 5' similar to contains Alu 8556 21487 0.8 3.5E-02 H29951.1 EST_HUMAN repetitive element; 9183 22111 35470 3.08 3.5E-02 BE958970.1 EST_HUMAN 601644701R2 NIH_MGC_56 Homo sapiens cDNA clone IMAGE:3929737 3' 10521 23408 36820 1.68 3.5E-02 X76642.1 NT Llactis MG1363 grpE and dnaK genes 10567 23453 36874 0.51 3.5E-02 BE561042.1 EST_HUMAN 601344661F1 NIH_MGC_8 Homo sapiens cDNA clone IMAGE:3677654 5' 11926 24771 38268 2.03 3.5E-02 AW861641.1 EST_HUMAN PM1-CT0326-291299-002-h03 CT0326 Homo sapiens cDNA 11926 24771 38269 2.03 3.5E-02 AW861641.1 EST_HUMAN PM1-CT0326-291299-002-h03 CT0326 Homo sapiens cDNA 12922 25795 6.42 3.5E-02 BE276948.1 EST_HUMAN 601178765F1 NIH_MGC_20 Homo sapiens cDNA clone IMAGE:3543833 5' 600 13667 26569 1.13 3.4E-02 AK024424.1 NT Homo sapiens mRNA for FLJ00013 protein, partial cds 600 13667 26570 1.13 3.4E-02 AK024424.1 NT Homo sapiens mRNA for FLJ00013 protein, partial cds 601 13667 26569 2.94 3.4E-02 AK024424.1 NT Homo sapiens mRNA for FLJ00013 protein, partial cds 601 13667 26570 2.94 3.4E-02 AK024424.1 NT Homo sapiens mRNA for FLJ00013 protein, partial cds xv26d07.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2814253 3' similar to 1077 14121 27058 2.46 3.4E-02 AW274020.1 EST_HUMAN SW:C211_HUMAN P53801 PUTATIVE SURFACE GLYCOPROTEIN C21ORF1 PRECURSOR; 1234 14270 6.05 3.4E-02 11345459 NT Homo sapiens hypothetical protein FLJ13220 (FLJ13220), mRNA ye20e06.r1 Stratagene lung (#937210) Homo sapiens cDNA clone IMAGE:81250 5' similar to contains 2415 15419 28420 2.11 3.4E-02 T57160.1 EST_HUMAN MER29 repetitive element 3492 16531 29431 1.83 3.4E-02 AL163208.2 NT Homo sapiens chromosome 21 segment HS21C008 3996 17023 29913 4.52 3.4E-02 AW794952.1 EST_HUMAN RC6-UM0015-210200-021-A10 UM0015 Homo sapiens cDNA 4708 17713 30576 2.88 3.4E-02 X59799.1 NT M.musulus S-antigen gene promoter region 5195 18187 3 3.4E-02 Q26457 SWISSPROT LA PROTEIN HOMOLOG (LA RIBONUCLEOPROTEIN)(LA AUTOANTIGEN HOMOLOG) 6212 18202 31046 1.82 3.4E-E02 AJ012469.1 NT Caenorhabditis elegans mRNA for DYS-1 protein, partial 6447 19493 0.62 3.4E-02 BF131628.1 EST_HUMAN 601820445F1 NIH_MGC_58 Homo sapiens sapiens cDNA clone IMAGE:4052434 5' 7173 18445 31314 5.04 3.4E-02 U24393.1 NT Human lysyl oxidase-like protein gene, exon 3 8837 21767 3.39e 3.4E-02 AI869629.1 EST_HUMAN wI99d04.x1 NCI_CGAP_Brn25 Homo sapiens cDNA clone IMAGE:2433031 3' Page 156 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value nu70f08.s1 NCI_CGAP_AIv1 Homo sapiens cDNA clone IMAGE:1216071 similar to contains Alu repetitive 9307 22235 35596 1.05 3.4E-02 AA664886.1 EST_HUMAN elementcontains element MER25 MER25 repetitive element; zq04f11.s1 Stratagene muscle 937209 Homo sapiens cDNA clone IMAGE:628749 3'similer to TR:G101725 G1017425 IPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGT TKAFINIVVLDRPG 9474 22402 5.03 3.4E-02 AA194306.1 EST_HUMAN PPT GPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSATVARTMMKVMKL ...; 10297 23187 0.65 3.4E-04 AI092719.1 EST_HUMAN oz99h08.x1 Soares_parathyroid_tumor_NbHPA Homo sapiens cDNA clone IMAGE:1683519 3' 393 13477 7.84 3.3E-02 AA398735.1 EST_HUMAN zt75e08.s1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:728198 3' 1194 14233 27172 10.27 3.3E-02 AB035867.1 NT Cricetulus griseus CYP2A17 mRNA for cytochrome P450 2A17, complete cds 1520 14551 27513 0.91 3.3E-02 L16870.1 NT Homo sapiens cytochrome P4502C18 (CYP2C18) gene, exons 2 and 3 1665 14695 27665 1.13 3.3E-02 af110763.1 NT Homo sapiens skeletalmuscle LIM-protein 1 (FHL1) gene, complete cds 1767 14793 0.97 3.3E-02 AE000700.1 NT Aquifex aeolicus section 32 of 109 of the complete genome 2097 15111 244 3.3E-02 R09112.1 EST_HUMAN yf25c09.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:127888 5' 2476 15478 28479 1.42 3.3E-02 6755862 NT Mus musculus tumor rejection antigen gp96 (Tra1), mRNA 3416 16458 29364 0.89 3.3E-02 H02389.1 EST_HUMAN yj35h02.1 Soares placenta eNb2HP Homo sapiens cDNA clone IMAGE:150771 5' 4273 14695 27665 3.48 3.3E-02 AF110763.1 NT Homo sapiens skeletal muscle LIM-protein 1 (FHL1) gene, complete cds 4579 17587 30449 271 3.3E-02 6755862 NT Mus musculus tumor rejection antigen gp96 (Tra1), mRNA 6698 19734 32935 19.31 3.3E-02 BF245995.1 EST_HUMAN 601853910F1 NIH_MGC_57 Homo sapiens cDNA clone IMAGE:4073787 5' 6698 19734 32936 19.31 3.3E-02 BF246995.1 EST_HUMAN 601853910F1 NIH_MGC_57 Homo sapiens cDNA clone IMAGE:4073787 5' 7931 20653 34161 0.53 3.3E-02 AF124162.1 NT Nicotiana plumbaginifolia molybdopterin synthase sulphurylase (cnx6) gene, partial cds 9862 22777 36164 0.84 3.3E-02 BF115621.1 EST_HUMAN 7m92d04.x1 NCI_CGAP_Bm23 Homo sapiens cDNA clone IMAGE:3562423 3' 9862 22777 36165 0.84 3.3E-02 BF115621.1 EST_HUMAN 7m92d04.x1 NCI_CGAP_Bm23 Homo sapiens cDNA clone IMAGE:3562423 3' ad08f09.s1 Soares_NbHFB Homo sapiens sapiens cDNA clone IMAGE:877673 3' similar to gb:X70944_cds1 9958 22863 36250 0.63 3.3E-02 AA488202.1 EST_HUMAN MYOBLAST CELL SURFACE ANTIGEN 24.1D5 (HUMAN); ad0af09.s1 Soares_NbHFB Homo sapiens cDNA clone IMAGE:877673 3' similar to gb:X70944_cds1 9958 22863 36251 0.63 3.3E-02 AA488202.1 EST_HUMAN MYOBLAST CELL SURFACE ANTIGEN 24.1D5 (HUMAN); 11067 23951 0.52 3.3E-02 H36109.1 EST_HUMAN yp51f11.s1 Soeres retina N2b4HR Homo sapiens cDNA clone IMAGE:190989 3' 11561 24470 37936 3.27 3.3E-02 BF691107.1 EST_HUMAN 602247171F1 NIH_MGC_62 Homo sapiens cDNA clone IMAGE:4332497 5' 12072 24913 38416 1.4 3.3E-02 AF077337.1 NT Zea mays heat shock protein 101 (HSP101) gene, complete cds 12484 25227 3.82 3.3E-02 T96545.1 EST_HUMAN ye49f11.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:121101 5' 12600 25296 1.66 3.3E-02 AF289665.1 NT Mus musculus EIF4H gene, partial cds; LIMK1 gene, complete cds; and ELN gene, partial cds 12628 25311 2.2 3.3E-02 ME81890.1 NT Humasn interleukin 11 (IL11) gene, complete mRNA 136 13238 26157 1.46 3.2E-02 AJ002005.1 NT Oryctolagus cuniculus gene encoding ileal sodium-dependent bile acid transporter 1153 14194 27132 8.71 3.2E-02 AF096275.1 NT Drosophila elanogaster heat shock protein 68 (hsp680 gene, hsp68d allele, complete cds Page 157 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 1153 14194 27133 8.71 3.2E-02 AF096275.1 NT Drosophila melanogaster heat shock protein 68 (hsp68) gene, hsp68d allele, complete cds 2131 15144 1.94 3.2E-02 P28955 SWISSPROT LARGE TEGUMENT PROTEIN 2885 13238 26157 1.01 3.2E-02 AJ002005.1 NT Orytolagus cuniculus gene encoding ileal sodium-dependent bile acid transporter 3179 16229 29123 17.23 3.2E-02 NBE867353.1 EST_HUMAN 601442431F1 NIH_MGC_65 Homo sapiens cDNA clone IMAGE:3E846727 5' 3777 16606 29696 1.42 3.2E-E02 AL163203.2 NT Homo sapiens chromosome 21 segment HS21C003 4315 17329 17.61 3.2E-02 X94768.1 NT H. sapiens RP3 gene (XLRP gene 3) 4880 17879 30744 3.77 3.2E-02 AF114182.1 NT Saxifrag nidifica maturase (matK) gene, chloroplast gene encoding chloroplast protein, partial cds Vitreoscilla sp. outer membrane protein homolog gene, complete cds; Trp repressor binding protein gene, 4941 17940 30797 0.69 3.2E-02 AF067063.1 NT partial cds; and unknown genes. Mus musculus MHC class III region RD gene, partial cds; Bf. C2, G9A, NG22, G9, HSP70, HSP70, HSC70t, 5061 18058 0.92 3.2E-02 AF109906.1 NT and smRNP genes, complete cds; G7A gene, partial cds; and unknown genes 5725 18798 31890 1.69 3.2E-02 X68709.1 NT S.griseocameum whlG-Stv gene 5725 18798 31891 1.69 3.2E-02 X68709.1 NT S.griseocameum whiG-Stv gene 6802 19835 33046 2.31 3.2E-02 M32437.1 NT Ret/polyomavirus left junction in cell line W98.14 yd33eh12.s1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:110087 3' similar to contains 6805 19838 27.99 3.2E-02 T39367.1 EST_HUMAN Alu repetitive element; contains LTR1 repetitive element; 6895 19925 33140 3.81 3.2E-02 aF173845.1 NT Sagutinus oedipus tissue kallikrein gene, complete cds 8231 21136 34468 0.9 3.2E-02 11424049 NT Homo sapiens cytochrome P450, subfamily IIB (phenobarbital-inducible)(CYP2B), mRNA n[07d11.s1 NCI_CGAP-Pr11 Homo sapiens cDNA clone IMAGE:1029621 similar to gb:X65923 UBIQUITIN- 8401 21304 34636 0.46 3.2E-02 AA55015.1 EST_HUMAN LIKE PROTEIN FUB (HUMAN); 8875 21805 35158 4.16 3.2E-02 6680565 NT Mus musculus kinesin family member 3c (Kif3c), mRNA 9496 22424 0.95 3.2E-02 AF109718.1 NT Homo sapiens chromosome 3 subtelomeric region 9766 22690 36075 1.32 3.2E-02 AI278971.1 EST_HUMAN qm17b04.x1 NCI_CGAP_Lu5 Homo sapiens cDNA clone IMAGE:1882063 3' 9766 22690 36076 1.32 3.2E-02 AI278971.1 EST_HUMAN qm17b04.x1 NCI_CGAP_Lu5 Homo sapiens cDNA clone IMAGE:1882063 3' zg54b12.s1 Soares_pineal_gland_N3HPG Homo sapiens cDNA clone IMAGE:39E7151 3'E similar to 10559 23445 4.52 3.2E-02 AA719795.1 EST_HUMAN gb:L08441 CYTOCHROME C OXDASE POLYPEPTIDE III (HUMAN); 10844 23730E 37153 1.15 3.2E-02 U96762.1 NT Macaca mulatta chemokine receptor CCR 5 mRNA, complete cds 12211 25045 1.43 3.2E-02 AL163302.2 NT Homo sapiens chromosome 21 segment HS21C102 1287 14320 2.17 3.1E-02 4503416 NT Homo sapiens dual specificity phosphafase 4 (DUSP4) mRNA 1331 14365 27314 1.12 3.1E-02 P18845 SWISSPROT NEURONAL ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA-3 CHAIN PRECURSOR (GF-ALPHA-3) 1910 14931 27908 1.41 3.1E-02 6671564 NT Mus musculus adaptor-related protein complex AP-3, delta subunit (Ap3d), mRNA 1990 15008 1.06 3.1E-02 Z50097.1 NT Drosophila melanogaster mRNA for headcase protein 5445 18526 31252 1.22 3.1E-02 U78104.1 NT Human leukemia inhibitory factor receptor (LIFR) gene, promoter and partial exon 1 Page 158 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 5545 16623 238 3.1E-02 AA278478.1 EST_HUMAN zs81a06.r1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE:703858 5' 5844 18915 32031 0.69 3.1E-02 BF687742.1 EST_HUMAN 602066783F1 NIH_MGC_57 Homo sapiens cDNA clone IMAGE:4065789 5' Naisseria meningibids DNA for region 2 (thaB-and fhaC-homologs, unknown genes) and flanking genes, 5916 25635 32104 0.42 3.1E-02 AJ391284.1 NT strain FAM18 10534 23420 36836 26 3.1E-02 AF03479.1 NT Ente occoccus faccalis surface protein precursor, gene, complete cds 1646 14677 1.74 3.0E-02 AF187125.1 NT Pityckteines minutus cytochrome oxidases I gene, partial cdes; mitochondrial gene for mitochondral product 2623 15621 28614 1.41 3.0E-02 AA402242.1 EST_HUMAN zt65h03.r1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:727253 5' 3625 16661 29661 1.22 3.0E-02 M94176.1 NT Saccharomycec cerevislae stem-loop mutation supressor SSL2 gene, complete cds 3721 16753 29641 3.17 3.0E-02 AF247644.1 NT Pseudomonas fluorescens family II aminotransferase gene, complete cds 3808 16638 0.78 3.0E-02 AW820223.1 EST_HUMAN QV2-ST0296-150200-040-e09 ST0296 Homo sapiens cDNA 4027 17054 0.95 3.0Ee-02 AA36403.1 EST_HUMAN EST74530 ePineal gland II Homo sapiens cDNA 5' and 5185 18177 31022 8.94 3.0E-02 AF281074.1 NT Homo sapiens neuropilin 2 (NRP2) gene, complete cds, alternatively spliced 5185 18177 31023 8.94 3.0E-02 AF281074.1 NT Homo sapiens neuropilin 2 (NRP2) gene, complete cds, alternatively spliced 5576 16654 3.18 3.0E-02 NT Homo sapiens mRNA for KIAA1573 protein, partial cds za39a10.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:294906 5' similar to contains 6503 19547 32724 0.7 3.0E-02 N99615.1 EST_HUMAN element TAR1 repetitive element; za39ea10.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:294906 5'similar to contains 6503 19547 32725 0.7 3.0E-02 N99615.1 EST_HUMAN element TAR1 repetitive element; 7098 20304 33563 2.45 3.0E-02 AJ242906.1 NT Cyprinus carpio mRNA for inducible nitric oxide synthase (iNOS gene) 7235 20144 33363 2.96 3.0E-e02 BE889948.1 EST-HUMAN 601512206F1 NIH_MGC_71 Homo sapiens cDNA clone IMAGE;3913848 5' E7235 20144 33384 2.96 3.0E-02 BE889948.1 EST_HUMAN 601512206F1 NIH MGC 71 Homo sapiens cDNA clone IMAGE:3913848 5' Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 (NFKB1) gene, complete 7426 20125 33363 2.14 3.0E-02 AF213884.1 NT cds Homo sapiens nuclear factor of kappalight polypeptide gene enhancer in B-cells 1 (NFKB1) gene, complete 7426 20125 33364 2.14 3.0E-02 AF213884.1 NT ods 7601 20536 33825 1.19 3.0E-02 M86524.1 NT Human dystrophin gene 8019 20935 0.68 3.0E-02 BF246361.1 EST_HUMAN 601854981F1 NIH_MGC_57 Homo dystrophin gene 9180 22108 35456 0.55 3.0E-02 BV512670.1 EST_HUMAN 601171626F1 NIH_MGC_15 Homo sapiens cDNA clone IMAGE:3545047 5' 9200 22128 35484 0.83 3.0E-02 BF353889.1 EST_HUMAN IL5-HT0704-290600-108-c04 HT0704 Homo sapiens cDNA 9351 22279 1.66 3.0E-02 AF275654.1 NT Omithorhynchus anatinus coagulation factor X mRNA, complete cds 10939 23824 37251 1.94 3.0E-02 AE001797.1 NT Thermologa maritima section 109 fo 136 of the complete genome 11025 23909 37350 0.53 3.0E-02 Z21211.1 EST_HUMAN HSAAADTHS TEST1, Human adult Testis tissue Homo sapiens cDNA clone can test244(b) 11681 24586 38062 2.47 3.0E-02 M81357.1 NT Human coagulation factor VII (F7) gene exon 1 and factor X (F10) gene, exon 1 Page 159 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 12114 24955 38458 8.71 3.0E-02 AA483216.1 EST_HUMAN me87f04.s1 NCI_CGAP_Kid1 Homo sapiens cDNA clone IMAGE:911263 12581 25937 31373 2.56 3.0E-02 R32019.31 EST_HUMAN yh63d04.s1 soares placeta Nb2HP Homo sapiens cDNA clone IMAGE:134407 3' 12913 25496 7.82 3.0E-02 AW865565.1 EST_HUMAN QV4-NN0038-270400-187-h05 NN0038 Homo sapienx cDNA 12952 25931 4.22 3.0E-02 AF048687.1 NT Rattus norvegicus UDP-Gahglucosylceramide beta-1,4-galactosyltransferase mRNA, complete cds 3033 16085 28986 1.12 2.9E-02 BE565644.1 EST_HUMAN 601338428F1 NIH_MGC_53 Homo saplens cDNA clone IMAGE:3680695 5' 3033 16085 28987 1.12 2.9E-02 BE565644.1 EST_HUMAN 601338428F1 NIH_MGC_53 Homo saplens cDNA clone IMAGE:3680695 5' 4004 17031 29921 0.81 2.9E-02 H72805.1 EST_HUMAN yu07e10.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:233130 5' MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 5 (ABC TRANSPORTER MOAT-C)(PABC11) 4070 17096 29979 0.66 2.9E-02 O15440 SWISSPROT (SMRP) 5144 18139 30981 0.91 2.9E-02 X65137.1 NT S.vulgard pepC gene for PEP carboxylase 5144 18139 30982 0.91 2.9E-02 X65137.1 NT S.vulgard pepC gene for PEP carboxylase 5250 18414 3.66 2.9E-02 R09112.1 EST_HUMAN yf25c09.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:127888 5' 6298 19349 32517 1.31 2.9E-02 AF060221.1 NT Sus scrofa deoxyribonuclease II mRNA, complete cds 6545 19588 32775 6.16 2.9E-02 BF032233.1 EST_HUMAN 601452661F1 NIH_MGC_66Homo sapiens cDNA clone IMAGE:3856598 5' Neisseria meningitidis DNA for region 2 (fhaB- and fhaC-homologs, unknown genes) and flanking genes, 7286 20239 33489 0.57 2.9E-02 AJ391284.1 NT strain FAM18 7619 20554 33847 10.47 2.9E-02 BE271437.1 EST_HUMAN 601140729F1 NIH_MGC_9 Homo sapiens cDNA clone IMAGE:3049830 5' 7827 20755 34060 0.54 2.9E-02 D29214.1 EST_HUMAN HUMNK262 Human epidermal keratinocyte Homo sapiens cDNA clone 262 Buchnera aphidicola nalural-host Schiechtendalia chinensis gluconate-6-phosphate dehydrogenase (gnd) 8577 21508 34853 1.01 2.9E-02 AF129279.1 NT gene, partial cds Buchnera aphidicola nalural-host Schiechtendalia chinensis gluconate-6-phosphate dehydrogenase (gnd) 8577 21508 34854 1.01 2.9E-02 AF129279.1 NT gene, partial cds 10183 23074 36474 2.06 2.9E-02 AW875979.1 EST_HUMAN CM3-PT0014-071299-051-c04 PT0014 Homo sapiens cDNA 10183 23074 36475 2.06 2.9E-02 AW875979.1 EST_HUMAN CM3-PT0014-071299-051-c04 PT0014 Homo sapiens cDNA 10386 23275 0.85 2.9E-02 AW976597.1 EST_HUMAN EST388706 MAGE resequences, MAGN Homo sapiens cDNA 10832 23718 37143 1.17 2.9E-02 AP000064.1 NT Aeropyrum pernix genomic DNA, section 7/7 11485 18426 31350 2.04 2.9E-02 X55294.1 NT Sheep gene for ultra high-sulphur keratin protein 12583 25853 1.73 2.9E-02 AU135817.1 EST_HUMAN AU135817 PLACE1 Homo saplens cDNA clone PLACE1002962 5' 587 13655 0.78 2.8E-02 AW970153.1 EST_HUMAN EST382234 MAGE resequences, MAGK Homo sapiens cDNA 3425 16466 29373 1.77 2.8E-02 AF066063.1 NT Homo sapiens retinal fascin (FSCN2) gene, exon 2 3425 16466 29374 1.77 2.8E-02 AF066063.1 NT Homo sapiens retinal fascin (FSCN2) gene, exon 2 5676 18750 31672 10.93 2.8E-02 BE741083.1 EST_HUMAN 601594078F1 NIH_MGC_9 Homo sapienx cDNA clone IMAGE:3948067 5' 7120 20324 33588 1.05 2.8E-02 T78960.1 EST_HUMAN yd21b08.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:108855 5' Page 160 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 8903 21833 3518 1.61 2.8E-02 AJ005820.1 NT Craterostigma plantagineum mRNA for hoeodomain leucine zipper protein (hb-1) 9568 22495 35858 0.92 2.8E-02 AA280762.1 EST_HUMAN zs96c06.r1 NCI_CGAP0-GCB1 Homo sapiens cDNA clone IMAGE:711466 5' 9749 22673 36057 1.23 2.8E-02 AF187872.1 NT Cavia porcellus inwardly-rectifying potassium channel Kir2.1 (KCNJ2) gene, complete cds 9853 22768 36153 0.65 2.8E-02 AE001092.1 NT Archaeoglobus fulgidus section 15 of 172 of the complete genome 12204 25039 38542 1.49 2.8E-02 L33697.1 NT Chlarnydomonas reinhardtii kinesin-homologous protein (FLA10) mRNA, complete cds Human germline T-cell receptor beta chain Dopamine-beta-hydroxylase-like, TRY1, TRY2, TRY3, TCRBV27S1P, TCRBV22S1A2N1T, TCRBV9S1A1T, TCRBV7S1A1N25, TCRBV5S1A1T, TCRBV13S3, TCRBV6S7P, TCRBV7S3A2T, TCRBV13S2A1T, TRRBV9S2A2PT, TCRBV7S2A1N74T, 1507 14538 27500 1.38 2.7E-02 U66059.1 NT TCRBV13S9/13S> 3493 16532 29432 1.72 2.7E-02 AL161494.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 6 4298 17312 30178 2.1 2.7E-02 N47258.1 EST_HUMAN yy86h12.r1 Soares_multiple_sclerosis-2NbHMSP Homo sapiens cDNA clone IMAGE:280487 5' 4298 17312 30179 2.1 2.7E-02 N47258.1 EST_HUMAN yy86h12.r1 Soares_multiple_sclerosis-2NbHMSP Homo sapiens cDNA clone IMAGE:280487 5' yo39f04.c1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:120127 3' similar to contains 5383 18365 31204 1.22 2.7E-02 T950731. EST_HUMAN Alu repetitive element; 5428 18510 31234 0.51 2.7E-02 BF245672.1 EST_HUMAN 60186481F1 NIH_MGC_57 Homo sapiens cDNA clone IMAGE:4083075 5' yf33d09.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:128657 5' similar to 5627 18703 31602 1.16 2.7E-02 R12245.1 EST_HUMAN SP:JC2264 JC2264 TISSUE FACTOR PATHWAY INHIBITOR - RHESUS; 6120 19179 32314 0.68 2.7E-02 X61670.1 NT T.aestivum pTTH20 mRNA for wheat type V thionin 6204 19260 32407 0.52 2.7E-02 AB004799.1 NT Cryza sativa mRNA for ascorbate oxidase, partial cds 6886 19916 0.99 2.7E-02 X97580.1 NT A.bisporus pgkA gene 7421 20120 33357 1.92 2.7E-02 AA993571.1 EST_HUMAN ot96h03.s1 Soares_total_fetus_Nb2HF8 9w Homo sapiens cDNA clone IMAGE:1624661 3' 8363 21267 0.6 2.7E-02 AK024456.1 NT Homo sapiens mRNA for FLJ00048 protein, partial cds 8398 21301 34632 0.56 2.7E-02 9256542 NT Mus musculus G21 protein (G21), mRNA to28g08.x1 Soares_total_fetus_Nb2HF8-9w Homo sapiens cDNA clone IMAGE:2065982 3' similar to 8927 21857 1.26 2.7E-02 AI377036.1 EST_HUMAN contains Alu repetitive element; 593 13660 26563 1.12 2.6E-02 AL163282.2 NT Homo sapiens chromosome 21 segment HS21C082 2389 15394 28395 3.01 2.6E-02 AA490021.1 EST_HUMAN ab02b02.s1 Stratagene fetal retina 937202 Homo sapiens cDNA clone IMAGE:839595 3' 2391 15396 28398 2.97 2.6E-02 6754241 NT Mus musculus histidine rich calcium binding protein (Hrc), mRNA 2391 15396 28399 2.97 2.6E-02 6754241 NT Mus musculus histidine rich calcium binding protein (Hrc), mRNA Mus musculus MHC class III region RD gene, partial cds; Bf, C2, G9A, NG22, G9, HSP70, HSP70, H6C701, 2958 16010 1.3 2.6E-02 AF109906.1 NT and smRNP genes, complete cds; G7A gene, partial cds; adn unknown genes 4019 17046 1.25 2.6E-02 AA071307.1 EST_HUMAN zm73f09.s1 Stratagene neuroepithelium (#937231) Homo sapiens cDNA clone IMAGE:61305 3' 4392 17406 1.13 2.6E-02 Y07848.1 NT Homo sapiens EWS, gar22, rrp22 and bam22 genes 5013 18011 30869 3.87 2.6E-02 L12032.1 NT Chicken dorsalin-1 mRNA, complete cds Page 161 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 5199 18191 31033 1.29 2.6E-02 AE002014.1 NT Deinococcus radiodurans R1 section 151 of 229 of the complete chromosome 1 xa52b04.x1 NCI_CGAP_Ser4 Homo sapiens cDNA clone IMAGE:2570383 3' similar to SW:Y069_HUMAN 5227 18216 31062 2.49 2.6E-02 AW241154.1 EST_HUMAN Q15041 HYPOTHETICAL PROTEIN KIAA0089; 6058 19120 0.47 2.6E-02 AL161563.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 63 6107 19167 0.51 2.6E-02 AL161563.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 63 6464 19509 7.05 2.6E-02 AI206030.1 EST_HUMAN qg27f11.x1 NCI_CGAP_Kid3 Homo sapiens cDNA clone IMAGE:1762317 3' 6693 19729 32929 2.29 2.6E-02 BE1748.1 EST_HUMAN 601493473T1 NIH_MGC_70 Homo sapiens cDNA clone IMAGE:3895578 3' 7140 20248 33499 0.78 2.6E-02 Z99064.1 NT Vaccinia virus ORF1L, strain Wyeth 7140 20248 33500 0.78 2.6E-02 Z99064.1 NT Vaccinia virus ORF1L, strain Wyeth 7238 20147 33387 5.57 2.6E-02 6981271 NT Rattus norvegicus Nerve growth factor receptor, fast (Ngfr), mRNA 7678 20612 33911 0.7 2.6E-02 P21894 SWISSPROT ALANYL-TRNA SYNTHETASE (ALANINE-TRNA LIGASE)(ALARS) 9072 22001 35355 0.87 2.6E-02 AA850946.1 EST_HUMAN ak22f04.s1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1406719 3' 9898 22886 36270 1.45 2.6E-02 11432020 NT Homo sapiens KIAA1070 protein (KIAA1070), mRNA Saccharomyces dairenensis NRRL Y-12639(T) ATP synthase subunit 9(ATP9) gene, mitochondrial gene 10236 23127 36529 0.77 2.6E-02 AF114952.1 NT encoding mitochondrial protein, complete cds Saccharomyces dairenensis NRRL Y-12639(T) ATP synthase subunit 9(ATP9) gene, mitochondrial gene 10236 23127 36530 0.77 2.6E-02 AF114952.1 NT encoding mitochondrial protein, complete cds 10888 23773 37199 4.93 2.6E-02 AL163303.2 NT Homo sapiens chromosome 21 segment HS21C103 11825 24745 2.19 2.6E-02 AA279351.1 EST_HUMAN zs84c02.r1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE:704162 5' 11995 24837 38336 1.87 2.6E-02 AW500547.1 EST_HUMAN UI-HF-BN0-akj-e-10-0-UI.r1 NIH_MGC_50 Homo sapiens cDNA clone IMAGE:3077465 5' 555 13624 26532 1.51 2.5E-02 AI793130.1 EST_HUMAN on26f06.y5 NCI_CGAP_Lu5 Homo saplens cDNA clone IMAGE:1557827 5' 555 13624 26533 1.51 2.5E-02 AI793130.1 EST_HUMAN on26f06.y5 NCI_CGAP_Lu5 Homo saplens cDNA clone IMAGE:1557827 5' 835 13890 26827 13.09 2.5E-02 BE974314.1 EST_HUMAN 601680305R2 NIH_MGC_83 Homo sapiens cDNA clone IMAGE:3950665 3' 894 13947 26894 4.47 2.5E-02 BE974314.1 EST_HUMAN 601680305R2 NIH_MGC_83 Homo sapiens cDNA clone IMAGE:3950665 3' 2813 15802 2.54 2.5E-02 U12571.1 NT Rattus norvegicus rabphilin-3A mRNA, complete cds 2997 16049 28951 1.88 2.5E-02 X99697.1 NT H.carterae mRNA for fucoxanthin chlorophyl a/c binding protein, Fcp1 2997 16049 28952 1.88 2.5E-02 X99697.1 NT H.carterae mRNA for fucoxanthin chlorophyl a/c binding protein, Fcp1 4129 18403 30027 1.28 2.5E-02 Be701165.1 EST_HUMAN PM2-NN0128-080700-001-a12 NN0128 Homo sapiens cDNA 4129 18403 30028 1.28 2.5E-02 Be701165.1 EST_HUMAN PM2-NN0128-080700-001-a12 NN0128 Homo sapiens cDNA 4301 17315 3018 16.15 2.5E-02 AW592114.1 EST_HUMAN hf36h08.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2934015 3' 5381 18363 0.96 2.5E-02 BE277116.1 EST_HUMAN 601178625F1 NIH_MGC_20 Homo sapiens cDNA clone IMAGE:3543822 5' 5912 18981 32099 0.58 2.5E-02 AI732776.1 EST_HUMAN zx83c10.x5 Soares ovary tumor NbHOT Homo sapienx cDNA clone IMAGE:810354 5' 7e30e09.x1 NCI-CGAP_Lu24 Homo sapiens cDNA clone IMAGE:3284008 3' similar to contains L1.t1.L1 6434 19481 4.75 2.5E-02 BE670128.1 EST_HUMAN repetitive element; Page 162 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 6453 19498 4.42 2.5E-02 BE746888.1 EST_HUMAN 601579393F1 NIH_MGC_9 Homo sapiens cDNA clone IMAGE:3928054 5' 6593 19634 32816 0.83 2.5E-02 L29029.1 NT Chlamydomonas reinhardtii VSP-3 mRNA, complete cds 8116 21027 34353 1.72 2.5E-02 BF526722.1 EST_HUMAN 602070562F1 NCI-CGAP Brn64 Homo sapiens cDNA clone IMAGE:4213406 5' 8116 21027 34354 1.72 2.5E-02 BF526722.1 EST_HUMAN 602070562F1 NCI-CGAP Brn64 Homo sapiens cDNA clone IMAGE:4213406 5' 8360 21265 34600 0.48 2.5E-02 AF129458.1 NT Chlemydomonas reinhardtii class II DNA photolyase (PHR2) gene, complete cds 8558 21489 34829 0.63 2.5E-02 BE252469.1 EST_HUMAN 601108291F1 NIH_MGC_16 Homo sapiens cDNA clone IMAGE:3344278 5' 9384 22312 35674 0.73 2.5E-02 Q91713 SWISSPROT CHORDIN PRECURSOR (ORGANIZER-SPECIFIC SECRETED DORSALIZING FACTOR) 10588 23454 0.78 2.5E-02 x71303.1 NT D.radicum 28S ribosomal RNA, D2 domain 11055 23939 37377 0.66 2.5E-02 AI147615.1 EST_HUMAN qb22a08.x1 Soares-pregnant_uterus_NbHPU Homo sapiens cDNA clone IMAGE:1696982 3' 11249 24173 37620 2.37 2.5E-02 Q10335 SWISSPROT hypothetical 46.7 KD PROTEIN C19G10.05 IN CHROMOSOME I 11249 24173 37621 2.37 2.5E-02 Q10335 SWISSPROT hypothetical 46.7 KD PROTEIN C19G10.05 IN CHROMOSOME I 11299 24218 37668 4.26 2.5E-02 AJ237936.1 NT Bos taurus partial stat5B gene, exons 17-19 Mus musculus major histocompatibility locus class II region: major histocompatibility protein class II alpha chain (IAalpha) and major histocompatibility protein class II beta chain (IEbeta) genes, complete cds; 11318 24237 3.87 2.5E-02 AF050157.1 NT butyrophilin-like (NG9), butyrophilin-II> 12181 25017 1.74 2.5E-02 AB007546.1 NT Homo sapiens gene for LECT2, complete cds 12215 25049 1.43 2.5E-02 X98999.1 NT Pseudomonas sp. transposon TN5041 DNA 12477 25865 2.05 2.5E-02 11420078 NT Homo sapiens similar to ALEX3 protein (H. sapiens)(LOC63634), mRNA 12653 25749 1.7 2.5E-02 11433220 NT Homo sapiens mitogen-activated protein kinase kinase kinase 13 (MAP3K13), mRNA 12740 25380 2.18 2.5E-02 U60169.1 NT Dictyostelium discoideum putative protein kinase MkcA (mkcA) gene,c omplete cds 184 13283 26200 1.01 2.4E-02 AI378582.1 EST_HUMAN tc72c07.x1 Soares_HnHMPu_S1 Homo sapien cDNA clone IMAGE:2070156 3' 1621 14651 27614 1.4 2.4E-02 H65884.1 EST_HUMAN yr75f11.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:211149 5' 2058 15915 28075 1.71 2.4E-02 P01901 SWISSPROT H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN PRECURSOR (H-2K(B)) 2058 15915 28076 1.71 2.4E-02 P01901 SWISSPROT H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN PRECURSOR (H-2K(B)) 4475 17486 30345 2.53 2.4E-02 J05110.1 NT T.thermophila calcium-binding 25 kDa (TCBP 25) protein mRNA, complete cds 4641 17647 30511 1.5 2.4E-02 P01901 SWISSPROT H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN PRECURSOR (H-2K(B)) 4641 17647 30512 1.5 2.4E-02 P01901 SWISSPROT H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN PRECURSOR (H-2K(B)) 5294 18279 31129 1.1 2.4E-02 8922702 NT Homo sapiens hypothetical protein FLJ10844 9FLJ10844), mRNA 6459 19504 32679 1.05 2.4E-02 W86680.1 EST_HUMAN zh63h04.s1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:416791 3' 6620 19660 32844 0.51 2.4E-02 M31650.1 NT Chioken myristoylated slanino-rich C kinase substrate (MARCKS) mRNA, complete cds 6620 19660 32845 0.51 2.4E-02 M31650.1 NT Chioken myristoylated slanino-rich C kinase substrate (MARCKS) mRNA, complete cds 7590 20526 33815 0.79 2.4E-02 Z20573.1 EST_HUMAN HSAAACKVX T. Human adult Rhabdomyosarcoma cell-line Homo sapiens cDNA 7607 20542 33832 0.83 2.4E-02 X12925.1 NT Rat gene for uncoupling protein (UCP) 7607 20542 33833 0.83 2.4E-02 X12925.1 NT Rat gene for uncoupling protein (UCP) Page 163 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 8397 21300 34630 0.56 2.4E-02 P98092 SWISSPROT HEMOCYTIN PRECURSOR (HUMORAL LECTIN) 8397 21300 34631 0.56 2.4E-02 P98092 SWISSPROT HEMOCYTIN PRECURSOR (HUMORAL LECTIN) 8470 21401 0.74 2.4E-02 AW813007.1 EST_HUMAN RC3-ST0186-230300-019h06 ST0186 Homo sapiens cDNA 8522 21453 0.61 2.4E-02 M16780.1 NT Human retrotransposon 3' long terminal repeat yu12c05.s1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:233576 3' similar to contains 9009 21938 0.87 2.4E-02 H78376.1 EST_HUMAN Alu repetitive element;contains A3R repetitive element; za35g11.s1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:294595 3' similar to 9095 22024 35380 2.18 2.4E-02 N69442.1 EST_HUMAN gbjK02909#RATSR7K Rat (rRNA);contains A3R.b1 A3R repetitive element; 9538 22465 35826 0.6 2.4E-02 AE001125.1 NT Borrelia burgdorferi (section 11 of 70) of the complete genome zu91c06.s1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:745354 3' similar to gb:J04422 ISLET AMYLOID POLYPEPTIDE PRECURSOR (HUMAN);contains Alu repetitive element,contains element XTR 9561 22488 35849 0.99 2.4E-02 AA625660.1 EST_HUMAN XTR repetitive element; 10322 23211 36623 2.67 2.4E-02 AV692954.1 EST_HUMAN AV692954 GKC Homo sapiens cDNA clone KGCDSC03 5' nh07b12.s1 NCI)_CGA_Thy1 Homo sapiens cDNA clone IMAGE:943583 similar to contains Alu repetitive 10487 23375 36790 3.35 2.4E-02 AA493894.1 EST_HUMAN element;contains element PTR5 repetitive element; Mus musculus major histocompatibility locus class III regions Hsc70t gene, partial cds; smRNP, G7A, NG23, 12005 24847 38344 2.3 2.4E-02 AF109905.1 NT MutS homolog, CLCP, NG24, NG25, and NG26 genes, complete cds; and unknown genes Mus musculus major histocompatibility locus class III regions Hsc70t gene, partial cds; smRNP, G7A, NG23, 12005 24847 38345 2.3 2.4E-02 AF109905.1 NT MutS homolog, CLCP, NG24, NG25, and NG26 genes, complete cds; and unknown genes 12296 25106 4.99 2.4E-02 9627909 NT Bacteriophage bIL67, complete genome 12428 25190 31879 2.48 2.4E-02 6753635 NT Mus musculus DlnB homolog 1 (E. coll)(Dinb1), mRNA 12530 25253 31829 1.86 2.4E-02 U78167.1 NT Rattus norvegicus cAMP-regulated guanine nuclectide exchange factor 1 (cAMP-GEFI) mRNA, complete cds 12530 25253 31867 1.86 2.4E-02 U78167.1 NT Rattus norvegicus cAMP-regulated guanine nuclectide exchange factor 1 (cAMP-GEFI) mRNA, complete cds Caenorhabditis elegans mRNA for iron-sulfur subunit of mitochondrial succinate dehydrogenase, complete 12693 25350 13.1 2.4E-02 AB008569.1 NT cds 1895 14916 3.58 2.3E-02 W05340.1 EST_HUMAN za84g08.r1 Soares_fetal_lung_jung_NbHL19W Homo sapiens cDNA clone iMAGE:299294 5' 1907 14928 6.73 2.3E-02 U94165.1 NT 4 Homo sapiens Mammary tumor-associated protein INT6(INT6) gene, exon 4 2373 15378 28380 2.77 2.3E-02 Z74293.1 NT S.cerevisise chromosome IV reading frame ORF YDL245e 3749 16781 29670 5.63 2.3E-02 Z20377.1 EST_HUMAN HSAAACADH P, Human foetal Brain Whole tissue Homo sapiens cDNA 3778 16809 0.69 2.3E-02 L23429.1 NT Canis beta-galactosides-binding lectin (LGALS3) mRNA, 3'end Page 164 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 4248 17264 30130 0.91 2.3E-02 L24799.1 NT Gallus gallus connexin 45.6 (Cx45.6) gene, complete cds 4248 17264 30131 0.91 2.3E-02 L24799.1 NT Gallus gallus connexin 45.6 (Cx45.6) gene, complete cds 4527 17536 30398 1.12 2.3E-02 AW899107.1 EST_HUMAN CM4-NN0080-290400-160-b04 NN0080 Homo sapiens cDNA 4559 17568 30427 1.12 2.3E-02 BE935225.1 EST_HUMAN CM3-MT0118-010900-318-g07 MT0118 Homo sapiens cDNA 4559 17568 30428 1.12 2.3E-02 BE935225.1 EST_HUMAN CM3-MT0118-010900-318-g07 MT0118 Homo sapiens cDNA 4560 18405 30429 1.15 2.3E-02 AW593693.1 EST_HUMAN xs25d08.x1 NCI_CGAP_Ut2 Homo sapiens cDNA clone IMAGE:2770671 3' 4560 18405 30430 1.15 2.3E-02 AW693693.1 EST_HUMAN xs25d08.x1 NCI_CGAP_Ut2 Homo sapiens cDNA clone IMAGE:2770671 3' 4705 17710 30573 3.03 2.3E-02 BF026487.1 EST_HUMAN 601672279F1 NIH_MGC_20 Homo sapiens cDNA clone IMAGE:3955386 5' 4705 17710 30574 3.03 2.3E-02 BF026487.1 EST_HUMAN 601672279F1 NIH_MGC_20 Homo sapiens cDNA clone IMAGE:3955386 5' 5141 18136 30978 0.92 2.3E-02 AI793177.1 EST_HUMAN qz35c03.x5 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2028868 3' 5141 18136 30979 0.92 2.3E-02 AI793177.1 EST_HUMAN qz35c03.x5 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2028868 3' 5164 18156 31003 1.02 2.3E-02 AW844307.1 EST_HUMAN RC2-CN0051-290100-011-a07 CN0051 Homo sapiens cDNA Caulobacter crescentus toposiomerase IV ParE subunit (parE) gene, complete cds, and propionyl-CoA 5560 18638 31517 3.68 2.3E-02 U86303.1 NT carboxylase beta chain (pccB) homolog gene, partial cds 6483 19528 32706 0.5 2.3E-02 BF106464.1 EST_HUMAN 601822921R1 NIH_MGC_77 Homo sapiens cDNA clone IMAGE:4042829 3' 6908 19938 33157 4.37 2.3E-02 AL161505.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 17 7320 18488 31260 1.11 2.3E-02 BE141475.1 EST_HUMAN MR0-HT0080-011099-002-c09 HT0080 Homo sapiens cDNA 7867 20794 34096 0.43 2.3E-02 AL163303.2 NT Homo sapiens chromosome 21 segment HS21C103 8456 21388 34727 6.56 2.3E-02 U63610.1 NT Human plectin (PLEC1) gene, exons 3-32, and complete cds 9041 21970 35329 0.97 2.3E-02 AJ298105.1 NT Homo sapiens PDX1 gene for lipoyl-containing component X, exons 1-11 9041 21970 35330 0.97 2.3E-02 AJ298105.1 NT Homo sapiens PDX1 gene for lipoyl-containing component X, exons 1-11 9254 22182 35536 0.8 2.3E-02 AI685380.1 EST_HUMAN wa76h10.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2302147 3' 9254 22182 35537 0.8 2.3E-02 AI685380.1 EST_HUMAN wa76h10.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2302147 3' 9681 22607 35980 0.85 2.3E-02 P41996 SWISSPROT HYPOTHETICAL 5.6 KD PROTEIN B0280.5 IN CHROMOSOME III PRECURSOR 10373 23262 36684 0.79 2.3E-02 P50532 SWISSPROT CHROMOSOME ASSEMBLY PROTEIN XCAP-C 10533 23417 36834 1.63 2.3E-02 AE000199.1 NT Escherichia coli K-12 MG1655 section 89 of 400 of the complete genome 10533 23419 36835 1.63 2.3E-02 AE000199.1 NT Escherichia coli K-12 MG1655 section 89 of 400 of the complete genome GLUCOAMYLASE S1/S2 PRECURSOR (GLUCAN 1,4-ALPHA-GLUCOSIDASE) (1,4-ALPHA-D-GLUCAN 11221 24147 37598 2.04 2.3E-02 P08640 SWISSPROT GLUCOHYDROLASE) 12214 25048 1.41 2.3E-02 AF159132.1 NT Melapenaeus ensis fushi tarazu-factor 1 mRNA, complete cds 12408 25736 5.09 2.3E-02 BE278331.1 EST_HUMAN 601179958F1 NIH_MGC_21 Homo sapiens cDNA clone IMAGE:3546567 5' 12891 25481 31765 3.4 2.3E-02 U39394.1 NT Streptomyces sp. alpha-1,3/4-fucosidase precursor gene, complete cds 12939 25963 3.37 2.3E-02 U11077.1 NT Dictyostelium discoideum extracellular signal-regulated protein kinase (ERK1) mRNA, complete cds Page 165 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value Columba livia nucleoside diphosphate kinase (NDPK) gene, nuclear gene encoding mitochondrial protein, 761 13818 26747 2.85 2.2E-02 AF018267.1 NT complete cds 1773 14799 1.22 2.2E-02 4557448 NT Homo sapiens chromodomain helicase DNA binding protein 2 (CHD2) mRNA 2028 15045 28040 1.4 2.2E-02 Z82001.1 NT S.pneumoniae pcpA gene and open reading frames 2774 15933 28759 1.24 2.2E-02 AF109633.1 NT Mus muculus ets variant protein ER81 gene, exons 1 through 4 3496 16535 1.99 2.2E-02 AA577785.1 EST_HUMAN nn24a04.s1 NCI_CGAP_Gas1 Homo sapiens cDNA clone IMAGE:1084782 3' 3715 16747 4.46 2.2E-02 AF083094.1 NT Infectious bursal disease virus segment B strain IL4 VP1 gene, complete cds 3920 16948 29830 1.15 2.2E-02 AW601317.1 EST_HUMAN PM0-BT0340-170100-004-b03 BT0340 Homo sapiens cDNA 3995 17022 29912 0.65 2.2E-02 Z74293.1 NT S.cerevisiae chromosome IV reading frame ORF YDL245c 4726 17731 0.9 2.2E-02 P16759 SWISSPROT HYPOTHETICAL PROTEIN UL21 7I6b11.x1 Soares_NSF_F8_9W_OT_PA_P_S1 Homo sapiens cDNA clone IMAGE:3525836 3' similar to 6509 19553 32733 0.51 2.2E-02 BF109222.1 EST_HUMAN TR:Q12899 Q12899 ACID FINGER PROTEIN.; 7617 20552 33845 3.24 2.2E-02 AV699721.1 EST_HUMAN AV699721 GKB Homo sapiens cDNA clone GKBAND03 3' 8943 21873 35233 1.89 2.2E-02 AL161515.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 27 8943 21873 35234 1.89 2.2E-02 AL161515.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 27 9368 22296 35659 0.8 2.2E-02 X79468.1 NT P.vulgata alpha tub 2 mRNA Homo sapiens DNA, DLEC1 to ORCTL4 gene region, section 1/2 (DLEC1, ORCTL3, ORCTL4 genes, 10210 23101 36501 2.26 2.2E-02 AB026898.1 NT complete cds) Homo sapiens DNA, DLEC1 to ORCTL4 gene region, section 1/2 (DLEC1, ORCTL3, ORCTL4 genes, 10210 23101 36502 2.26 2.2E-02 AB026898.1 NT complete cds) 10701 23587 1.17 2.2E-02 6678140 NT Mus musculus Sjogren syndrome antigen A1 (Ssa1), mRNA 11654 24560 38031 1.69 2.2E-02 BE797601.1 EST_HUMAN 601584309F1 NIH_MGC_7 Homo sapiens cDNA clone IMAGE:3938571 5' ne47h07.s1 NCI_CGAP_Co3 Homo sapiens cDNA clone IMAGE:900541 3' similar to contains Alu repetitive 12656 25329 2.8 2.2E-02 AA503553.1 EST_HUMAN element; 442 13512 5.01 2.1E-02 AV761502.1 EST_HUMAN AV76102 MDS Homo sapiens cDNA clone MDSADG01 5' 471 13542 6.53 2.1E-02 AF029726.1 NT Dictyostelium discoidaum histidine kinase C (dhkC) mRNA, complete cds Bacillus subtilis cotKLM cluster, CotK (cotK), CotL (cotL), and spore coaf protein CotM (cotM) genes, 1290 14323 27269 5.86 2.1E-02 U72073.1 NT complete cds 1414 14444 27397 1.06 2.1E-02 AF204395.1 NT Mus musculus macrophage migration inhibitory factor (MIF) gene, 5' flanking region and partial cds 1414 14444 27398 1.06 2.1E-02 AF204395.1 NT Mus musculus macrophage migration inhibitory factor (MIF) gene, 5' flanking region and partial cds 1806 14832 27800 0.98 2.1E-02 P02438 SWISSPROT KERATIN, HIGH-SULFUR MATRIX PROTEIN, B2A 1806 14832 27801 0.98 2.1E-02 P02438 SWISSPROT KERATIN, HIGH-SULFUR MATRIX PROTEIN, B2A 1806 14832 27802 0.98 2.1E-02 P02438 SWISSPROT KERATIN, HIGH-SULFUR MATRIX PROTEIN, B2A 1977 14995 27979 1.02 2.1E-02 AF190899.1 NT Tegula aureotincta major acrosomal protein precursor (TMAP) mRNA, complete cds Page 166 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 2048 15065 28066 0.95 2.1E-02 BE072546.1 EST_HUMAN PM2-BT0546-120100-001-f11 BT0546 Homo sapiens cDNA 2048 15065 28067 0.95 2.1E-02 BE072546.1 EST_HUMAN PM2-BT0546-120100-001-f11 BT0546 Homo sapiens cDNA 2624 15622 28615 1.26 2.1E-02 AA225095.1 EST_HUMAN nc21g03.r1 NCI_CGAP_Pr1 Homo sapiens cDNA clone IMAGE:1008820 2863 13861 26796 3.42 2.1E-02 N29266.1 EST_HUMAN yx43h07.r1 Soares meianocyte 2NbHM Homo sapiens cDNA clone IMAGE;264541 5' 3192 15065 28066 0.95 2.1E-02 BE072546.1 EST_HUMAN PM2-BT0546-120100-001-f11 BT0546 Homo sapiens cDNA 3192 15065 28067 0.95 2.1E-02 BE072546.1 EST_HUMAN PM2-Bt0546-120100-001-f11 BT0546 Homo sapiens cDNA 3645 16681 29578 1.28 2.1E-02 AA461271.1 EST_HUMAN zx63b09.r1 Soares_total_fetus_Nb2HF8_ow Homo sapiens cDNA clone IMAGE:796121 5' 4227 17243 30111 0.72 2.1E-02 Z74293.1 NT S.cerevisia chromosome IV reading frame ORF YDL245c 4414 17425 30287 0.97 2.1E-02 BF343655.1 EST_HUMAN 602015306F1 NCI_CGAP_Brn64 Homo sapiens cDNA clone IMAGE:4151161 5' 4554 17563 30422 2.02 2.1E-02 U44914.1 NT BOrrelia burgdorferi plasmid cp32-2, erpC and erpD genes, complete cds; and unknown genes 4565 17573 30436 1.59 2.1E-02 AI768127.1 EST_HUMAN wg81d11.x1 Soares_NSF_F8_9W_OT_PA-P_S1 Homo sapiens cDNA clone IMAGE:2371509 3' 4823 17824 30693 6.16 2.1E-02 Y08501.1 NT A.thaliana mitochondrial genome, part A 4933 17932 30791 0.69 2.1E-02 AI823432.1 EST_HUMAN wh54a05.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2384528 3' 5836 18907 32022 0.61 2.1E-02 AW379529.1 EST_HUMAN CM4-HT0244-111199-040-h05 HT0244 Homo sapiens cDNA 7420 20119 33356 0.78 2.1E-02 BF086199.1 EST_HUMAN QV3-GN0058-120900-329-a12 GN0058 Homo sapiens cDNA 9084 22013 35370 0.92 2.1E-02 9790238 NT Mus musculus sorting nexin 1 (Snx1), mRNA am83e07.s1 Stratagene schizo brain S11 Homo sapiens cDNA clone IMAGE:1629732 3' similar to contains 10034 22934 36322 0.61 2.1E-02 AA984288.1 EST_HUMAN Alu repetitive elemtn;contains element MER11 repetitive element; 10157 23048 36447 2.31 2.1E-02 AJ243213.1 NT Homo sapiens partial 5-HT4 receptor gene, exons 2 to 5 10157 23048 36448 2.31 2.1E-02 AJ243213.1 NT Homo sapiens partial 5-HT4 receptor gene, exons 2 to 5 Streptococcus pneumoniae integrase, exicisionase, repressor protein, relaxas, UmC MucB homolog, and 10489 23377 36792 1.41 2.1E-02 L29324.1 NT UmuD MucA homolog genes, complete cds; and unknown genes am83e07.s1 Stratagene schizo brain S11 Homo sapiens cDNA clone IMAGE:1629732 3' similar to contains 10563 23449 36871 0.71 2.1E-02 AA984288.1 EST_HUMAN Alu repetitive element;contains element MeR11 repetitive element; 12638 18429 13.76 2.1E-02 Y19213.1 NT Homo sapiens putative psihHbA pseudogene for hair keratin, exons 2 to 7 13026 25567 31737 12.1 2.1E-02 AF183913.1 NT Azospirillum brasilense major outer membrane prtein OmaA precursor (omaA) gene, complete cds 7g51c08.x1 NCI_cGAP_Pr28 Homo sapiens cDNA clone IMAGE:3309998 3' similar to contains MEr1.t3 18 13134 26020 0.77 2.0E-02 BF002932.1 EST_HUMAN MER1 repetitive element; 10 13185 26021 7.06 2.0-02 AW805565.1 EST_HUMAN QV4-NN0038-270400-187-h05 NN0038 Homo sapiens cDNA 278 13373 26287 3.1 2.0E-02 6753635 NT Mus mucouluo DinB homolog (e. coli) (Dinb1), mRNA 315 13407 28325 2.79 2.0E-02 AA456538.1 EST_HUMAN aa15b10.r1 Scares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:813307 5' 825 13880 26817 1.99 2.0E-02 6753635 NT Mus musculus dinB homolog 1 (E. coli) (Dinb1), mRNA Page 167 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value Homo sapiens genomic region containing hypervariable minisatellites chromosome 1[1p36.33] of Homo 1114 14156 27095 135.42 2.0E-02 AL096805.1 NT sapiens 1227 14264 27207 1.04 2.0E-02 8922391 NT Homo sapiens hypothetical protein FLJ10379 (FLJ10379), mRNA 1227 14264 27208 1.04 2.0E-02 8922391 NT Homo sapiens hypothetical protein FLJ10379 (FLJ10379), mRNA 1896 14917 27895 1.45 2.0E-02 8922453 NT Homo sapiens hypothetical protein FLJ10486 (FLJ10486), mRNA 1896 14917 27896 1.45 2.0E-02 8922453 NT Homo sapiens hypothetical protein FLJ10486 (FLJ10486), mRNA 2846 15835 2.15 2.0E-02 AL161532.2 NT rabidopsis thaliana DNA chromosome 4, contig fragment No. 32 7g51c08.x1 NCI_CGAP_Pr28 Homo sapiens cDNA clone IMAGE:3309998 3' similar to contains MER1.t3 3128 1314 26020 1.76 2.0E-02 BF002932.1 EST_HUMAN MER1 repetitive element; Mus musculus sema domain, transmembrane domain (TM), and cytoplasmic domain (semaphorin) 6B 3187 16236 1.42 2.0E-02 7305474 NT (Sema6b), mRNA 3274 16322 1.54 2.0E-02 AF095588.1 NT Arabidopsis thaliana C2H2 zinc finger protein FZF mRNA, complete cds 4092 17117 29995 1.44 2.0E-02 M18095.1 NT P.vulgaris hydroxyproline-rich glycoprotein (HRGP) mRNA, 3' end 5285 18271 3119 0.65 2.0E-02 AA456538.1 EST_HUMAN aa15b10.r1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:813307 5' 5349 18332 31180 0.98 2.0E-02 Z21088.1 EST_HUMAN HSAAADMii TEST1, Human adult Testis tissue Homo sapiens cDNA clone CA 5370 18352 0.97 2.0E-02 BF085913.1 EST_HUMAN CM0-GN0038-150900-648-f09 GN0038 Homo sapiens cDNA 5831 18902 32017 0.41 2.0E-02 U34778.1 NT Caenorhabditis elegans sma-2 mRNA, complete cds 6115 19174 32308 0.6 2.0E-02 L35321.2 NT Dictyostelium discoideum class VII unconventional myosin (myol) gene, complete cds 7982 20903 34218 0.98 2.0E-02 AP000004.1 NT Pyrococcus horikoshii OT3 genomic DNA, 777001-994000 nt. position (4/7) 7982 20903 34219 0.98 2.0E-02 AP000004.1 NT Pyrococcus horikoshii OT3 genomic DNA, 777001-994000 nt. position (4/7) 10389 23278 2.21 2.0E-02 U70408.1 NT Japanese encephalitis virus envelope protein mRNA, partial ods 10847 23733 37156 2.12 2.0E-02 AI640342.1 EST_HUMAN wa17b02.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2298315 3' 11087 24019 37460 5.61 2.0E-02 Z73966.1 NT Myocbacterium tuberculosis H37Rv complete genome; segment 93/162 11810 24731 38222 2.1 2.0E-02 D88184.1 NT Equus caballus DNA for 17alpha-hydroxylasa/17.20-lyase, complete cds 12107 24948 38450 1.58 2.0E-02 10947055 NT Homo sapiens ankyrin 3, node of Ranvier (ankyrin G) (ANK3), transcript variant 1, mRNA 12107 24948 38451 1.58 2.0E-02 10947055 NT Homo sapiens ankyrin 3, node of Ranvier (ankyrin G) (ANK3), transcript variant 1, mRNA 12241 18271 31119 1.98 2.0E-02 AA456538.1 EST_HUMAN aa15b10.r1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:813307 5' 12673 15835 1.84 2.0E-02 AL161532.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 32 13085 25605 6.43 2.0E-02 T80037.1 EST_HUMAN yd04c09.r1 Soares infant brain 1NIB Homo sapiens cDNA clone IMAGE:24675 5' nf19a07.s1 NCI_CGAp_Pr1 Homo sapiens cDNA clone IMAGE:914916 similar to contains L1.t1 L1 717 13775 26695 1.72 1.9E-02 AA572764.1 EST_HUMAN repeititive element; 1639 14670 27633 1.13 1.9E-02 P18488 SWISSPROT EMPTY SPRIACLES HOMEOTIC PROTEIN 2053 15070 28070 3.41 1.9E-02 AL163303.2 NT Homo sapiens chromosome 21 segment HS21C103 2053 15070 28071 3.41 1.9E-02 AL163303.2 NT Homo sapiens chromosome 21 segment HS21C103 Page 168 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 2531 15532 28533 1.27 1.9E-02 AL161550.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 50 2949 15001 28902 10.55 1.9E-02 AA713856.1 EST_HUMAN nw04f05.s1 NCI_CGAP_SS1 Homo sapiens cDNA clone IMAGE:1238337 3' 2994 16046 28949 2.01 1.9E-02 AV648669.1 EST_HUMAN AV648669 GLC Homo sapiens cDNA clone GLCBLH07 3' 3304 16351 0.75 1.9E-02 AB033611.1 NT Urotichue talpoides mitochondrial gene for cytochrome b, complete cds 3675 16708 1.04 1.9E-02 N52250.1 EST_HUMAN yz28b02.s1 Soares_multiple_scierosis_2NbHMSP Homo sapiens cDNA clone IMAGE:284331 3' 3768 15800 5.45 1.9E-02 BE738088.1 EST_HUMAN 601572682F1 NIH_MGC_57 Homo sapiens cDNA clone IMAGE:3839564 5' 4131 17153 30030 1.86 1.9E-02 AF141940.1 NT Mycoplasma imitans VihA1 precursor (vihA1) and VihA2 precursor (vihA2) genes, partial cds 4289 17303 30171 1.76 1.9E-02 P09081 SWISSPROT HOMEOTIC BIOCOID PROTEIN (PRD-4) 4289 17303 30172 1.76 1.9E-02 P09081 SWISSPROT HOMEOTIC BIOCOID PROTEIN (PRD-4) tj46d04.x1 Soares_NSF_F8_9W-OT_PA_P_S1 Homo sapiens cDNA clone IMAGE:2144551 3' similar to 4657 17662 30530 3.58 1.9E-02 AI452999.1 EST_HUMAN contains Alu repetitive element; Homo sapiens lithum-sensitiva myo-inositol monophosphase A1 (IMPA1) gene, promoter region and partial 4851 17853 0.9 1.9E-02 AF178753.1 NT cds 5137 15532 28533 2.44 1.9E-02 AL161550.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 50 5499 18578 31426 1.09 1.9E-02 AF037352.1 NT Mus muscuius T cell receptor gamma locus, TCR gamma 1 and gamma 3 gene clusters 5655 18729 31634 1.41 1.9E-02 L47572.1 NT Meleagris galiopavo paraoxonase-2 (PON2) mRNA, complete cds 5998 19063 0.69 1.9E-02 AB09507.1 NT Drosophila kanekoi gene for glycerol-3-phosphate dehydrogenase, complete cds 7460 20400 33673 1.28 1.9E-02 U19241.1 NT Homo sapiens interferon-gamma receptor alpha chain gene, exon 1 7460 20400 33674 1.28 1.9E-02 U19241.1 NT Homo sapiens interferon-gamma receptor alpha chain gene, exon 1 9134 22062 1.42 1.9E-02 AL162754.2 NT Neisseria meningitidis serogroup A strain Z2491 complete genome; segment 3/7 9871 22786 36176 1.28 1.9E-02 BF316129.1 EST_HUMAN 601896130F1 NIH_MGC_19 Homo sapiens cDNA clone IMAGE:4125462 5' 10235 23126 36528 0.55 1.9E-02 L10114.1 NT Nicotiana tabacum type II phytochrome (phyB) gene, complete cds 10548 23434 36854 1.2 1.9E-02 BF695832.1 EST_HUMAN 601852385F1 NIH_MGC-56 Homo sapiens cDNA clone IMAGE:4076253 5' 10647 23533 36965 0.57 1.9E-02 N39160.1 EST_HUMAN yy46h08.s1 Soares_multiple_sclerosis_2NbHMSP Homo sapiens cDNA clone IMAGE:276639 3' 10746 23632 37065 0.64 1.9E-02 D64001.1 NT Synechocystis sp. PCC6803 complete genome, 20/27, 2539000-2644794 12438 25741 31671 3.54 1.9E-02 AF101065.1 NT Hirudo medicinalis intermeidate filament gliarin mRNA, complete cds hn52c06.x1 NCi_CGAP_Co17 Homo sapiens cDNA clone IMAGE:3027274 3' similar to contains element 366 13453 26365 1 1.8 E-02 AW771104.1 EST_HUMAN MER29 repetitive element; 709 13768 26684 1.12 1.8E-02 BF308122.1 EST_HUMAN 601894329F1 NIH_MGC_17 Homo sapiens cDNA clone IMAGE:4139983 5' 1187 14226 2765 1.12 1.8E-02 X17664.1 NT H.francisci mRnA for myelin basic protein (MBP) 2727 15720 28717 1.86 1.8E-02 AE004544.1 NT Pseudomonas aeruginosa PA01, section 105 of 529 of the complete genome 3257 16305 1.18 1.8E-02 AI805829.1 EST_HUMAN te52a09.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2090296 3' 3956 16984 29868 1.13 1.8E-02 AW879122.1 EST_HUMAN MR1-OT0011-280300-009-g04 OT0011 Homo sapiens cDNA 3956 16984 29869 1.13 1.8E-02 AW879122.1 EST_HUMAN MR1-OT0011-280300-009-g04 OT0011 Homo sapiens cDNA Page 169 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 4174 17195 1.29 1.8E-02 AA861446.1 EST_HUMAN ak24h04.s1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1406935 3' 4537 17546 30407 1.47 1.8E-02 AW936363.1 EST_HUMAN QV4-DT0021-301299-071-b11 DT0021 Homo sapiens cDNA 5070 18067 30917 1.71 1.8E-02 O60810 SWISSPROT HYPOTHETICAL PROTEIN DJ845O24.2 6648 19667 32878 0.63 1.8E-02 AE002516.1 NT Neisserie meningitidis serogroup B strain MC58 section 160 of 206 of the complete genome 6648 19687 32897 0.63 1.8E-02 AE002518.1 NT Neisseria meningitidis serogroup B strain MC58 section 160 of 206 of the complete genome 7121 20325 33589 9.91 1.8E-02 P14310 SWISSPROT HYPOTHETICAL 7.9 KD PROTEIN IN FIXW 5'REGION 7873 20800 34103 0.45 1.8E-02 BF125690.1 EST_HUMAN 601763268F1 NIH_MGC_20 Homo sapiens cDNA clone IMAGE:4026280 5' 7901 20800 34103 0.54 1.8E-02 BF125690.1 EST_HUMAN 601763268F1 NIH_MGC_20 Homo sapiens cDNA clone IMAGE;4026280 5' 8706 21637 34984 0.88 1.8E-02 U347091.1 NT Mus musculus carbonic anhydrase IV gene, complete cds 9037 21966 35325 0.87 1.8E-02 AW905327.1 EST_HUMAN QV2-NN1073-220400-159-h09 NN0173 Homo sapiens cDNA 9078 22007 35363 1.33 1.8E-02 6678943 NT Mus musculus microtubule-associated protein 2 (Mtap2), mRNA 10025 22925 36313 0.57 1.8E-02 BF241924.1 EST_HUMAN 601877026F1 NIH_MGC_55 Homo sapiens cDNA clone IMAGE:4105303 5' 10025 22925 36314 0.57 1.8E-02 BF241924.1 EST_HUMAN 601877026F1 NIH_MGC_55 Homo sapiens cDNA clone IMAGE:4105303 5' aj62f09.s1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1394921 3' similar to gb:L11672 ZINC 10168 23059 2.33 1.8E-02 AA897543.1 EST_HUMAN FINGER PROTEIN 91 (HUMAN); 10565 23451 36872 1.73 1.8E-02 BE778274.1 EST_HUMAN 601463545F1 NIH_MGC_67 Homo sapiens cDNA clone IMAGE:3866963 5' 10721 23607 37036 1.4 1.8E-02 X96933.1 NT L.stagnalis mRNA for myomodulin neuropeptide precursor HYALURONAN MEDIATED MOTILITY RECEPTOR (INTRACELLULAR HYALURONIC ACID BINDING 11037 23921 37363 0.59 1.8E-02 O75330 SWISSPROT PROTEIN) (RECEPTOR FOR HYALURONAN-MEDIATED MOTILITY) HYALURONAN MEDIATED MOTILITY RECEPTOR (INTRACELLULAR HYALURONIC ACID BINDING 11037 23921 37364 0.59 1.8E-02 O75330 SWISSPROT PROTEIN) (RECEPTOR FOR HYALURONAN-MEDIATED MOTILITY) 11869 23969 37405 1.96 1.8E-02 AB002337.2 NT Homo sapiens mRNA for KIAA0339 protein, partial cds 11869 23969 37406 1.96 1.8E-02 AB002337.2 NT Homo sapiens mRNA for KIAA0339 protein, partial cds 12040 24882 38388 2.8 1.8E-02 AP000006.1 NT Pyrococcus horikoshi OT3 genomic DNA, 1166001-1485000 nt. position (6/7) 12052 24893 38396 3.11 1.8E-02 U62749.1 NT Zea mays acidic ribosomal protein P2a-3 (rpp2a-3) mRNA, partial cds 13030 25720 1.93 1.8E-02 AF202180.1 NT Plasmodium falciparum erythrocyte membrane-associated glant protein antigen 332 (Ag332) gene, partial cds 931 13983 26928 1.36 1.7E-02 BE394859.91 EST_HUMAN 601310626F1 NIH_MGC_44 Homo sapiens cDNA clone IMAGE:3632190 5' hf34a03.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2933740 3' similar to contains 1813 14938 27810 2.31 1.7E-02 AW573183.1 EST_HUMAN L1.t1 L1 repetitive element; hf34a03.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2933740 3' similar to contains 1813 14838 27811 2.31 1.7E-02 AW573183.1 EST_HUMAN L1.t1 L1 repeititive element; 1894 14915 2.75 1.7E-02 AL163204.2 NT Homo sapiens chromosome 21 segment HS21C004 2125 15138 10.65 1.7E-02 AB004816.1 NT Oryctolagus cuniculus mRNA for mitsugumin29, complete cds Page 170 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession Top Hit Descriptor SEQ ID SEQ ID Database ID NO: Signal BLAST E No. NO: NO: Source Value 2312 15320 28321 1.05 1.7E-02 S741B6.1 NT (microsalellite INRA41) [Ovis aries=sheep, Genomic, 361 nt, segment 1 of 2] 2688 15682 44.07 1.7E-02 7657495 NT Homo sapiens putative Rab5 GDF/FTP exchange factor homologue (RABEX5), mRNA 3041 16093 28996 0.74 1.7E-02 AI147615.1 EST_HUMAN qb22a0.8x1 Soarges_pregnant_uterus_NbHPU Homo sapiens cDNA clone IMAGE:1696932 3' hm45a04.x1 NCI_CGAP_RDF1 Homo sapiens cDNA clone IMAGE:3015534 3' similar to contains 3571 16608 5.93 1.7E-02 AW827368.1 EST_HUMAN MER19.b1 MER19 repetitive element ; 3691 16724 0.72 1.7E-02 P04929 SWISSPROT HISTIDINE-RICH GLYCOPROTEIN PRECURSOR ac19f04.s1 Stratagene ovary (#937217) Homo sapeisn cDNA clone IMAGE:856927 3' similar to contains Alu 4265 17281 1.14 1.7E-02 AA669618.1 EST_HUMAN repetitive elementcontains element MER24 repetitive element ; 4296 17310 2.21 1.7E-02 R02506.1 EST_HUMAN ye86f08.r1 Soeres fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:124647 6' qm08g07.x1 NCI_CGAP_Lu6 Homo sapiens cDNA clone IMAGE:1881276 3' similar to gb:X52359 ZINC 4564 17572 30435 1.04 1.7E-02 AI305279.1 EST_HUMAN FINGER PROTEIN 30 (HUMAN); hf34a03.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2933740 3'similar to contains 4845 17851 30516 1.58 1.7E-02 AW573183.1 EST_HUMAN L1.t1 L1 repetitive element ; 4827 17828 30696 1.57 1.7E-02 V00641.1 NT Messenger RNA for anglerfish (Lophius americanus) somatostatin II 4927 17926 8.83 1.7E-02 AI015076.1 EST_HUMAN ov51e02.s1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1640858 3' 5200 18192 31034 0.65 1.7E-02 6981289 NT Rattus norvegicus N-arginine dibasic convertasee 1 (Nrd1), mRNA wg35f09.x1 Soares_NSF_F8_9W_OT_PA_P_S1 Homo sapiens cDNA clone IMAGE:2367113 3' similar to 6365 19414 32579 1.74 1.7E-02 AI769247.1 EST_HUMAN contains Alu repetitive element ; 6747 19781 0.49 1.7E-02 Z28383.1 NT T.niveum (ATCC34921) simA gene for cyclosporine synthetase 6861 19892 33106 1.8 1.7E-02 AI038280.1 EST_HUMAN oy85h03.xl Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:1672661 3' 7403 20102 33337 1.13 1.7E-02 AF190930.1 NT Macace fascicularis protein tyrosine phosphatase (PRL-1) mRNA, complete cds 7570 20506 33794 1.89 1.7E-02 8400716 NT Homo spaiens nebulin (NEB), mRNA 7748 20679 33977 0.98 1.7E-02 L07899.1 NT Human apolipoprotein (a) gene,exon 1 7748 20679 33978 0.98 1.7E-02 L07899.1 NT Human applipoprotein (a) gene,exon 1 8207 21113 2.17 1.7E-02 AJ010770.1 NT Homo sapiens hyperion gene, exons 1-50 9970 21328 34651 1.1 1.7E-02 U21854.1 NT Caenorhabditis elegans cCAF1 protein gene, complete cds 10221 23112 36514 1.31 1.7E-02 AL040554.1 EST_HUMAN DKFZµ434l0314_r1 434 (synomym: htes3) Homo sapiens cDNA clone DKFZp 43430314 5' 12199 25034 38534 1.66 1.7E-02 5902007 NT Homo sapiens serum constituent protein (MSE55), mRNA 12953 25891 31480 2.08 1.7E-02 AW903482.1 EST_HUMAN CM-NN1030-040400-130-f06 NN 1030 Homo sapiens cDNA oe08d04.s1 NCI_CGAP_Ov2 Homo sapeins cDNA clcne IMAGE:1385287 similar to conteins element MSR1 13073 25597 31729 1.63 1.7E-02 AA846926.1 EST_HUMAN repetitive element ; 534 13603 2.07 1.6E-02 AL021929.1 NT Mycobacterium tuberculosis H37Rv complete genome; segment 13/162 1683 14713 27675 3.49 1.6E-02 Y18889.1 NT Treponema maltophilum flaB2, flaB3 and filD genes for giagelin subunit proteins and CAP protein homologue Page 171 of 545<BR> Table 4<BR> Single Exon Probe Expressed in Adult Liver Nost Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 2264 16274 28279 1.1 1.6E-02 Q64176 SWISSPROT LIVER CARBOXYLESTERASE 22 PRECURSOR (EGASYN) (ESTERASE-22) 2264 15274 28280 1.1 1.6E-02 Q64176 SWISSPROT LIVER CARBOXYLESTERASE 22 PRECURSOR (EGASYN) (ESTERASE-22) 2600 15598 28593 1.31 1.6E-02 AJ006345.1 NT Homo sapiens KVLQT1 gene 2691 15685 28684 1.32 1.6E-02 AA484872.1 EST_HUMAN ne81d06.s1 NCI_CGAP_Ew1 Homo sapiens cDNA clone IMAGE:910667 2744 15737 1.42 1.6E-02 AB014534.1 NT Homo sapiens mRNA for KIAA0634 protein, partial cds 3587 16624 29527 6.8 1.6E-02 AW850652.1 EST_HUMAN IL3-CT0219-160200-063-0C07 CT0219 Homo sapiens cDNA Mus musculus major histocompatibility complex region NG27, NG28, RPS28, NADH oxidoreductase, NG29, KIFC1, Fas-binding protein, BING1, tapasin, RalGDS-like, KE2, BING4, beta 1,3-galactosyl transferase, and 4271 17287 2.09 1.6E-02 AF110520.1 NT RPS18 genes, complete cds; Sacm21 gene, partial> 4402 17414 30281 1.14 1.6E-02 AW875407.1 EST_HUMAN QV2-PT0012-140100-030-f07 PT0012 Homo sapiens cDNA ns71f12.s1 NCI_CGAP_Pr2 Homo sapiens cDNA clone IMAGE:1189103 similar to gb:M24902 5135 18131 30972 0.94 1.6E-02 AA653047.1 EST_HUMAN PROSTATIC ACID PHOSPHATASE PRECURSOR (HUMAN); ns71f12.s1 NCI_CGAP_Pr2 Homo sapiens cDNA clone IMAGE:1189103 similar to gb:M24902 5135 18131 30973 0.94 1.6E-02 AA653047.1 EST_HUMAN PROSTATIC ACID PHOSPHATASE PRECURSOR (HUMAN); 5203 18194 31036 1.06 1.6E-02 AI769132.1 EST_HUMAN wg34b09.x1 Soares_NSF_F8_9W_OT_PA_P_S1 Homo sapiens cDNA clone IMAGE:2366969 3' 434 18516 31241 0.52 1.6E-02 AI281385.1 EST_HUMAN qu42b09.x1 NCI_CGAP_Lym5 Homo sapiens cDNA clone IMAGE:1967417 3' 5818 18890 32003 1.29 1.6E-02 6671715 NT Mus musculus CD5 antigen (Cd5), mRNA 6934 19963 33184 2.06 1.6E-02 AB015281.1 NT Candida albicans CaGCR3 gene, complete cds 7261 20170 33410 0.65 1.6E-02 AB027571.1 NT Saccharomyces cerevisiae CAD2 gene for cadmium resistance protein, complete cds 7261 20170 33411 0.65 1.6E-02 AB027571.1 NT Saccharomyces cerevisiae CAD2 gene for cadmium resistance protein, complete cds 8170 21077 34407 0.86 1.6E-02 AL161508.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 20 8698 21629 34974 0.76 1.6E-02 AJ277662.1 NT Homo sapiens partial TUB gene for tubby (mouse) homolog and LMO1 gene for LIM domain only 1 protein 8757 21687 2.,09 1.6E-02 X0515.1 NT Human apoC-II gene for preproapolipoprotein C-II 10543 23429 2.79 1.6E-02 AF079764.1 NT Drosophila melanogaster enhancer of polycomb (E(Pc)) mRNA, complete cds nf19g03.s1 NCI_CGAP_Pr1 Homo sapiens cDNA clone IMAGE:914260 similar to SW:TELO_RABIT 10902 23787 37214 1.7 1.6E-02 AA572818.1 EST_HUMAN P29294 TELOKIN.[1]; nf19g03.s1 NCI_CGAP_Pr1 Homo sapiens cDNA clone IMAGE:914260 similar to SW:TELO_RABIT 10902 23787 37215 1.7 1.6E-02 AA572818.1 EST_HUMAN P29294 TELOKIN.[1]; 11347 25698 37706 2.4 1.6E-02 Z9482.1 NT G.gallus microstellite DNA (LEI0260 (=T16iiiE11)) 11661 24557 38040 2.39 1.6E-02 AL161508.2 NT Arabidopsis thaliana DNA chromosome 4, contig fregement No. 20 11661 24567 38041 2.39 1.6E-02 AL161508.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragement No. 20 11943 24787 38283 2.23 1.6E-02 AI373558.1 EST_HUMAN qz96e10.x1 Soares_pregnant_uterus_NbHPU Homo sapiens cDNA clone IMAGE:2042442 3' 12417 15274 28279 2.57 1.6E-02 Q64176 SWISSWPROT LIVER CARBOXYLESTERASE 22 PRECURSOR (EGASYN), (ESTERASE-22) Page 172 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similer Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 12417 15274 28280 2.57 1.6E-02 Q64176 SWISSPROT LIVER CARBOXYLESTERASE 22 PRCURSOR (EGASYN) (ESTERASE-22) 775 13832 35.52 1.5E-02 8923734 NT Homo sapiens transcription factor (HSA130894), mRNA 2157 15169 28171 1.69 1.5E-02 N39521. EST_HUMAN yv27b07.s1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:243925 3' 2188 15199 28204 1.21 1.5E-02 AL161594.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 90 3108 16159 29054 1.11 1.5E-02 AJ006216.1 NT Homo sapiens CACNA1F gene, exons 1 to 48 3108 16159 29055 1.11 1.5E-02 AJ006216.1 NT Homo sapiens CACNA1F gene, exons 1 to 48 3788 16819 29707 0.88 1.5E-02 BF092942.1 EST_HUMAN MR4-TN0115-080900-201-b12 TN0115 Homo sapiens cDNA 4239 17255 30121 0.83 1.5E-02 AA160967.1 EST_HUMAN zq40g10.r1 Stratagene hNT neuron (#937233) Homo sapiens cDNA clone IMAGE:632226 5' 5346 18329 31178 1.06 1.5E-02 4503534 NT Homo sapiens eukaryotic translation initiation factor 4E (EIF4E) mRNA 6547 19590 32777 1.92 1.5E-02 Q09711 SWISSPROT HYPOTHETICAL CALCIUM-BINDING PROTEIN C18B11.04 IN CHROMOSOME I 7703 20635 1.73 1.5E-02 1147282 NT Cyanophora paradox cyanelle, complete genome 7800 20729 34031 1.36 1.5E-02 11418713 NT Homo sapiens KIAA1009 protein (KIAA1009), mRNA 8315 21220 34556 0.47 1.5E-02 AE004347.1 NT Vibrio cholerae chrosome II, saction 4 of 93 of the complete chromosome 8454 21386 34726 1.7 1.5E-02 AL163303.2 NT Homo sapiens chromosome 21 segment HS21C103 8461 21392 34734 4.2 15.E-02 11417739 NT Homo sapiens valyl-tRNA Synthetase 2 (VARS2), mRNA 9389 22317 35679 0.88 1.5E-02 BF345554.1 EST_HUMAN 602019135F1 NCI_CGAP_Brn67 Homo sapiens cDNA clone IMAGE:4154604 5' 10001 22818 0.55 1.5E-02 AF096774.1 NT Homo sapiens kinase-relted protein isoform 1 mRNA, complete cds 10099 22948 36337 1.39 1.5E-02 D44506.1 NT Saccharomyces cerevisae chromosome VI plasmid GapC 10327 23216 36629 1.48 1.5E-02 R32667.1 EST_HUMAN yh54b10.r1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE:133531 5' 10327 23216 36630 1.48 1.5E-02 R32667.1 EST_HUMAN yh54b10.r1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE:133531 5' 11044 23928 37369 0.53 1.5E-02 BE965719.2 EST_HUMAN 601659778R1 NIH_MGC_70 Homo sapiens cDNA clone IMAGE:3896226 3' 11610 24518 37988 2.52 1.5E-02 L40609.1 NT Plasmodium falciparum (strain FCR3) variant-specific surface protein (var-2, var-3) genes, complete cds's 11650 24556 38025 1.73 1.5E-02 AL111238.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation 12616 25778 2.73 1.5E-02 AW750834.1 EST_HUMAN RC4-CN0049-140100-011-c11 CON0049 Homo sapiens cDNA 440 13511 1.51 1.4E-02 AE002230.2 NT Chlamydophila pneumoniae AR39, section 58 of 94 of the complete genome 1145 14187 27125 3.18 1.4E-02 7705980 NT Homo sapiens NESH protein (LOG51225), mRNA 1284 14317 1.27 1.4E-02 U328001. NT Haemophilus influenzae Rd section 115 of 163 of the complete genome 1324 14358 2.43 1.4E-02 U67779.1 NT Xenopus laevis neurogenin related 1b (X-NGNR-1b) mRNA, complete cds 1538 14568 1.2 1.4E-02 AV723785.1 EST_HUMAN AV723785 HTB Homo sapiens cDNA clone HTBAHH11 5' Bifidobacterium longum Na+/H+ antiporter (nhaB), cytosine deaminase, and alpha-galactosidase (aglL) 3259 16307 29211 2.05 1.4E-02 AF160969.2 NT genes complete ods; and N-aceytlglucosemine/xylse repressor protein (nagC/xyIR) gene, partial cds 3458 16499 29402 0.79 1.4E-02 AW074212.1 EST_HUMAN xb09d09.x1 NCI_CGAP_GU1 Homo sapiens cDNA clone IMAGE:2875793 3' Page 173 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession Top Hit Descriptor SEQ ID SEQ ID Database ID NO: Signal BLAST E No. NO: NO: Source Value 3543 16581 29484 6.95 1.4E-02 AL161586.2 NT Arabldopsis thaliana DNA chromosome 4, contig fragment No. 82 3543 16581 29485 6.95 1.4E-02 AL161586.2 NT Arabldopsis thaliana DNA chromosome 4, contig fragment No. 82 3580 16617 29520 0.95 1.4E-02 4503629 NT Homo sapiens coagulation factor XII (Hagment factor)(F12), mRNA 3724 16756 29644 6.32 1.4E-02 6996918 NT Mus musculus histocompatibility 2, complement component factor B (H2-Bf), mRNA 4602 17610 30468 10.61 1.4E-02 AW962688.1 EST_HUMAN EST374761 MAGE resequences, MAGG Homo sapiens cDNA 4602 17610 30469 10.61 1.4E-02 AW962888.1 EST_HUMAN EST374761 MAGE resequences, MAGG Homo sapiens cDNA 4773 17778 30646 0.97 1.4E-02 8922391 NT Homo sapiens hypothetical protein FLJ10379 (FLJ10379), mRNA 4773 17778 30647 0.97 1.4E-02 8922391 NT Homo sapiens hypothetical protein FLJ10379 (FLJ10379), mRNA 4983 17982 30839 8.31 1.4E-02 BE733142.1 EST_HUMAN 601567403F1 NIH_MGC_21 Homo sapiens cDNA clone IMAGE:3842280 5' 4983 17982 30840 8.31 1.4e-02 BE733142.1 EST_HUMAN 601567403F1 NIH_MGC_21 Homo sapiene cDNA clone IMAGE:3842280 5' 6001 25974 0.53 1.4E-02 X91338.1 NT H.sapiens La/SS-B pseudogene 3 nl11c04.s1 NCI_CGAP_Br2 Homo sapiens cDNA clone IMAGE:1029990 3' similar to contains Alu repetitive 6682 19718 32918 4.54 1.4E-02 AA559030.1 EST_HUMAN element; nl11c04.s1 NCI_CGAP_Br2 Homo sapiens cDNA clone IMAGE:1029990 3' similar to contains Alu repetitive 6662 19718 32919 4.54 1.4E-02 AA559030.1 EST_HUMAN element; 8717 21648 1.59 1.4E-02 AL022073.,1 NT Mycobacterium tuberculosis H37Rv complte genome; segment 88/162 9455 22383 35745 1.01 1.4E-02 M81702.1 NT Candida boidinii methanol oxidase (AOD1) gene, complete cds 9698 22623 3601 1.12 1.4E-02 AJ272265.1 NT Homo sapiens SPP2 gene for secreted phosphoprotein 24 precursor, exons 1-8 9936 22841 36230 2.26 1.4E-02 BE544561.1 EST_HUMAN 601078239F1 NIH_MGC_12 Homo sapiens cDNA clone IMAGE:3464241 5' 11034 23918 0.77 1.4E-02 AL163218.2 NT Homo sapiens chromsome 21 segment HS21C018 11076 23960 37396 0.54 1.4E-02 X61308.1 NT Zimays Knotted-1 (Kn-1) gene 12337 25132 38166 4.93 1.4E002 X60459.1 NT Human IFNAR gene for Interferon alpha/beta recaptor 12669 25337 2.38 1.4E-02 AF324985.1 NT Arabidopsis thaliana F21J9.2 mRNA, complete cds 12926 25500 1.89 1.4E-02 11426968 NT Homo sapiens sperm associated antigen 7 (SPAG7), mRNA 1969 14987 27969 2.17 1.3E-02 AL163201.2 NT Homo SAPIENS CHROMOSOME 21 SEGMENT hs21c001 2466 15468 28467 1.07 1.3E-02 AE002445.1 NT Neisseria meningitidis serogroup B strain MC58 section 87 of 206 of the complete genome 3260 16308 29212 2.24 1.3E-02 BF697081.1 EST_HUMAN 602129475F1 NIH_MGC_56 Homo sapiens cDNA clone IMAGE:4286203 5' 3260 16308 29213 2.24 1.3E-02 BF697081.1 EST_HUMAN 602129475F1 NIH_MGC_58 Homo sapiens cDNA clone IMAGE:4286203 5' 4052 17079 1.23 1.3E-02 AF169288.1 NT Mus musculus beta-sarcoglycan gene, complete cds Human germline T-cell receptor beta chain TCRBV17S1A1T, TCRBV2S1, TCRBV10S1P, TCRBV29S1P, TCRBV19S1P, TCRB15S1, TCRBV11S1A1T, HVB relic, TCRBV28S1P, TCRBV34S1, TCRBV14S1, 5039 18036 30892 0.99 1.3E-02 U66061.1 NT TCRBV3S1, TCRBV4S1A1T, TRY4, TRY5, TRY6, TRY6, TRY8, TCRBD1, TCRBJ1S1, TCRBJ1S2,> 5314 18298 0.71 1.3E-02 D26547.1 NT Rice gene for thioredoxin h, complete cds Page 174 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Accession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value Mus musculus chromosome X contigB; X-linked lymphocyte regulated 5 gene, Zinc finger protein 275, Zinc 5426 18508 31284 1.31 1.3E-02 AL049866.2 NT finger protein 92, mmxq28orf Mue musculus chromosome X contigB; X-linked lymphocyte regulated 5 gene, Zinc finger protein 275, Zinc 5426 18508 31285 1.31 1.3E-02 AL049866.2 NT finger protein 92, mmxq28orf Homo sapiens basic transcription factor 2 p44 (btf2p44) gene, partial cds, neuronal apotosis inhibitory 6405 19453 32625 1.35 13.E-02 U80017.1 NT protein (nalp) and survlval motor neuron protein (smn) genes, complete cds 6439 19486 32662 0.83 1.3E-02 M62962. NT C.reinhardtii ribulose 1,5-bisphosphate carboxylase/oxygenase activase mRNA, complete cds 7298 18467 31287 1.64 1.3E-02 AL161546.2 NT Arabidopsis thaliana DNA chromosome 4, config fragment No. 46 7298 18467 31288 1.64 1.3E-02 AL161546.2 NT Arabldopsis thallana DNA chromosome 4, contig fragment No. 46 ow06g05.x1 Soares_parathyroid_tumor_NbHPA Homo sapiens cDNA clone IMAGE:1646072 3' similar to 8012 20929 34247 4.84 1.3E-02 AI031593.1 EST_HUMAN contains Alu repetitive element; 8418 21321 34654 0.48 1.3E-02 AF153980.1 NT Homo saplens exostoses-like proteln 1 (EXTL1) gene, exons 2 through 11, and complete cds 9051 21980 35337 1.91 1.3E-02 AF156961.1 NT Homo sapiens human endogenous retrovirus W gagC3.37 G gag (gag) gene, complete cds 10703 23589 37016 2.22 1.3E-02 M63707.1 NT Mouse kldney androgen-regulated protein (KAP) gene, complete cds 10771 23657 37086 0.84 1.3E-02 AE001304.1 NT Chlaydia trachomatis section 31 of 87 of the complete genome 11430 24346 37790 3.79 1.3E-02 AW268563.1 EST_HUMAN xv34e03.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2815036 3' 11430 24346 37791 3.79 1.3E-02 AW268563.1 EST_HUMAN xv34e03.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2815036 3' 12318 25914 2.51 1.3E-02 X51780.1 NT Yeast ABP1 gene for actin binding protein 12768 25397 1.86 1.3E-02 9633069 NT Human herpesvirus 6B, complete genome 12931 25712 74.42 1.3E-02 AF152238.1 NT Homo sapiene V1b vasopressin receptor (VPR3) gene, complete cds H.sapiens DMA, DMB, HLA-21, IPP2, LMP2, TAP1, LOMP7, TAP2, DOB, DQB2 and RING8, 9, 13 and 14 227 13325 16.45 1.2E-02 X87344.1 NT genes zf65g01.r1 Soares refina N2b4HR Homo sapiens cDNA clone IMAGE:381840 5' similar to contains element 375 13461 26376 2.66 1.2E-02 AA059299.1 EST_HUMAN L1 repetitive element ; 475 13546 26466 1.51 1.2E-02 P38898 SWISSPROT HYPOTHETICAL 17.1 KD PROTEIN IN PUR5 3'REGION qb68e12.x1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1734670 3' similar to contains L1.t1 L1 762 13819 26746 10.78 1.2E-02 AI183522.1 EST_HUMAN repetitive element; 2190 15201 26206 1.96 1.2E-02 AL163213.2 NT Homo sapiens chromosome 21 segment HS21C013 2467 15470 28470 1.63 1.2E-02 AW172350.1 EST_HUMAN xj37e09.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2659432 3' 2506 15507 28509 1.5 1.2E-02 AL163218.2 NT Homo sapiens chromosome 21 segment HS21C018 2520 15521 28524 1.29 1.2E-02 BE538310.1 EST_HUMAN 601068406F1 NIH_MGC_10 Homo sapiens cDNA clone IMAGE:3454608 5' 2520 15521 28525 1.29 1.2e-02 Be538310.1 EST_HUMAN 601068406F1 NIH_MGC_10 Homo sapiens cDNA clone IMAGE:3454608 5' 2682 15470 2870 1.85 1.2E-02 AW172350.1 EST_HUMAN xj37e09.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2659432 3' 3148 16198 8.7 1.2E-02 AA075418.1 EST_HUMAN zm88e03.r1 Stratagene ovarian cancer (#937219) Homo sapiens cDNA clone IMAGE:545020 5' Page 175 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 3331 16377 29277 2.38 1.2E-02 R62805.1 EST_HUMAN yi11b08.s1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE:138903 3' 4990 17989 30846 1.05 1.2E-02 6754367 NT Mus musculus interferon regulatory factor 5 (lrf5), mRNA Human hereditary haemochromatosis region, histone 2A-like protein gene, hereditary haemochromatosis 5025 18022 30880 2.33 1.2E-02 U91328.1 NT (HLA-H) gene, RoRet gene, and sodium phosphate transporter (NPT3) gene, complete cds 5172 18164 1.62 1.2E-02 AB019786.1 NT Cynops pyrrhogaster CpUbiqT mRNA, partial cds 5219 18209 31055 2.09 1.2E-02 V731704.1 EST_HUMAN AV731704 HTF Homo sapiens cDNA clone HTFBHG11 5' 5883 18952 0.47 1.2E-02 AA759018.1 EST_HUMAN ai29f10.s1 Soares_testis_NHT Homo sapiens cDNA clone 1344235 3' 5959 19026 32146 2.02 1.2E-02 D78589.1 NT Rana rugosa mRNA for calreticulin, complete cds Homo sapiens wbscr1 (WBSCR1) and wbscr5 (WBSCR5) genes, complete cds, alternatively spliced and 6355 19404 32571 0.65 1.2E-02 AF045555.1 NT replication factor C subunit 2 (RFC2) gene, complete cds 7351 20347 33615 5.06 1.2E-02 AF175412.1 NT Mus musculus DNA methyltransferase (Dnmt1) gene, exons 2, 3, 4, and 5 7672 20606 33905 1.09 1.2E-02 H02197.1 EST_HUMAN yj34h12.s1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE:150695 3' 7696 20628 33927 11.65 1.2E-02 AV732093.1 EST_HUMAN AV732093 HTF Homo sapiens cDNA clone HTFBJC09 5' 7988 20907 34223 0.57 1.2E-02 BF216650.1 EST_HUMAN 60 1882949F1 NIH_MGC_57 Homo sapiens cDNA clone IMAGE:4095253 5' CMP-N-ACETYLNEURAMINATE-BETA-GALACTOSAMIDE-ALPHA-2,3-SIALYLT RANSFERASE (BETA- GALACTOSICDE ALPHA-2,3-SIALYLTRANSFERASE) (ALPHA 2,3-ST) (GAL-NAC6S) (GAL-BETA-1,3- 8576 21507 34852 2.56 1.2E-02 Q11205 SWISSPROT GALNAC-ALPHA-2,3-SIALYLTRANSFERASE) (ST3GALA.2) (SIAT4-B) 8705 21636 34982 0.58 1.2E-02 R88831.1 EST_HUMAN yi43f06.s1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE:142019 3' 8705 21636 34983 0.58 1.2E-02 R88831.1 EST_HUMAN yi43f06.s1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE:142019 3' 8770 21700 35045 1.36 1.2E-02 AF193612.1 NT Homo sapiens fringe protein mRNA, partial cds 8770 21700 35046 1.36 1.2E-02 AF193612.1 NT Homo sapiens fringe protein mRNA, partial cds 9447 22375 0.9 1.2E-02 T76987.1 EST_HUMAN yd72c08.s1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:113774 3' 10165 23056 36455 2.49 1.2E-02 AB031013.1 NT Norwalk-like virus genogroup 2 gene for capsid protein, complete cds 10196 23087 36488 1.4 1.2E-02 AJ246003.1 NT Homo sapiens Spast gene for spastin protein 12938 25506 5.97 1.2E-02 C18119.1 EST_HUMAN C18119 Human placenta cDNA (TFujiwara) Homo sapiens cDNA clone GEN-557G06 5' 1296 14329 27276 1.49 1.1E-02 AA070364.1 EST_HUMAN zm69e11.s1 Stratagene neuroelthelium (#937231) Homo sapiens cDNA clone IMAGE 530924 3' 1735 14762 27732 1.22 1.1E-02 X75491.1 NT H.sapiens LIPA gene, exon 4 1735 14762 27733 1.22 1.1E-02 X75491.1 NT H.sapiens LIPA gene, exon 4 2052 15069 28069 4.39 1.1E-02 BF345263.1 EST_HUMAN 602018037F1 NCI_CGAP_Bm67 Homo sapiens cDNA clone IMAGE:4153808 5' 2920 15973 4.58 1.1E-02 N99523.1 EST_HUMAN za40e05.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:295040 5' tq95b10.x1 NCI_CGAP_Ov23 Homo sapiens cDNA clone IMAGE2216539 3' similar to SW:XPF_HUMAN 3584 16621 29525 2.58 1.1E-02 AI653508.1 EST_HUMAN Q92889 DNA-REPAIR PROTEIN COMPLEMENTING XP-F CELL; 4200 17219 0.71 1.1E-02 AW813796.1 EST_HUMAN RC3-ST0197-120200-015-g11 ST0197 Homo sapiens cDNA Page 176 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 4944 17943 30801 2.43 1.1E-02 AL048383.2 EST_HUMAN DKFZp586E0924_s1 586 (synonym: hute1) Homo sapiens cDNA clone DKFp586E0924 Bacillus subtilis SpoVK (spoVK), YnbA (ynbB(ynbB), GinR (glnR), glutamine synthetase (glnA), YnaA (ynaA), YnaB (ynaB), YnaC (ynaC), YnaD (ynaD), YnaE (ynaE), YnaF (ynaF), YnaG(ynaG), YnaH 6389 19438 32606 0.84 1.1E-02 U66480.1 NT (ynaH), Ynal (ynal), YnaJ (ynaJ), xyian beta-1,4-xylosi> 8040 20954 34269 2.63 1.1E-02 BE149611.1 EST_HUMAN RC1-HT0256-100300-016-h07 HT0256 Homo sapiens cDNA 8316 21221 34557 0.88 1.1E-02 9631294 NT Melanoplus sanguinipes entomopoxvirus, complete gencome 8832 21782 35108 0.53 1.1E-02 P80394 SWISSPROT METALLOTHIONEIN (MT-1/MT-2) 8832 21782 35109 0.53 1.1E-02 P80394 SWISSPROT METALLOTHIONEIN (MT-1/MT-2) 9199 22127 35483 0.7 1.1E-02 AW996160.1 EST_HUMAN QV3-BN0045-220300-128-h02 BN0045 Homo sapiens cDNA 9381 22309 35670 0.79 1.1E-02 C04803.1 EST_HUMAN C04803 Human heart cDNA (YNakamura) Homo sapiens cDNA clone 3NHC4040 9459 22387 35750 7.8 1.1E-02 Q61982 SWISSPROT NEUROGENIC LOCUS NOTCH 3 PROTEIN 10439 23328 36746 2.31 1.1E-02 AA082578.1 EST_HUMAN zn24a01.r1 Stratagene neuroepithelium NT2RAMI 937234 Homo spaiens cDNA clone IMAGE:548328 5' 10596 23482 36911 5.32 1.1E-02 AA314665.1 EST_HUMAN EST186494 Colon carcinoma (HCC) cell line II Homo sapiene cDNA 5' end 11417 24333 37782 2.52 1.1E-02 11435505 NT Homo sapiens T-box 5 (TBX5), mRNA ab77f11.s1 Statagene fetal retina 937202 Homo sapiens cDNA clone IMAGE:853005 3' similar to contains 12281 25095 3.66 1.1E-02 AA668239.1 EST_HUMAN Alu repetitive element, 7 13122 26010 7.5 1.0E-02 AW846120.1 EST_HUMAN MR3CT0176-111099-003-e10 CT0176 Homo sapiens cDNA 1545 14575 27536 1.31 1.0E-02 AW846128.1 EST_HUMAN CM2-HT0177-041099-017-h12 HT0177 Homo sapiens cDNA 2607 15605 1.97 1.0E-02 AA806389.1 EST_HUMAN oc22h08.s1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE;1350495 3' 3139 16189 29082 3.21 1.0E-02 BE835556.1 EST_HUMAN RC0-FN0025-250500-021-d02 FN0025 Homo sapiens cDNA 3307 16354 29256 0.99 1.0E-02 BE968999.1 EST_HUMAN 601649967R1 NIH_MGC_74 Homo sapiens cDNA clone IMAGE:3933689 3' 3567 16604 0.75 1.0E-02 AW845621.1 EST_HUMAN MR0-CT0060-081099-003-h10 CT0060 Homo sapiens cDNA 3950 16978 29862 0.66 1.0E-02 AI085086.1 EST_HUMAN HA0921 Human fetal liver cDNA library Homo sapiens cDNA 4607 17615 30476 0.67 1.0E-02 Q61982 SWISSPROT NEUROGENIC LOCUS NOTCH 3 PROTEIN 4805 17806 30672 0.91 1.0E-02 AV696614.1 EST_HUMAN AV696614 GKC Homo sapiens cDNA clone GKCDOG05 5' 4889 17888 30753 5.61 1.0E-02 6753521 NT Mus musculus corticotropin releasing hormone receptor 2 (Crhr2), mRNA 4957 17955 30813 5.9 1.0E-02 R96567.1 EST_HUMAN yq54h01.r1 Soares fetal liver spieen 1NFLS Homo sapiens cDNA clone IMAGE:199633 5' 5142 18137 30980 0.69 1.0E-02 L05632.1 NT Human glycoprotein hormone alpha-subunit (GCA) gene, 5 flank 5601 18677 31555 0.84 1.0E-02 H52681.1 EST_HUMAN yu36h11.r1 Soares ovary tumor NbHOT Homo sapiens cDNA clone IMAGE:235941 5' 5953 19020 32140 0.67 1.0E-02 AF309388.1 NT Mus musculus transcription complex subunit NF-ATc4 (Nfatc4) gene, exons 1 and 2 6354 19403 32570 1.17 1.0E-02 AF257303.1 NT Mus musculus synaptotagmin il (Syt2) gene, complete cds 6422 19469 32642 2.64 1.0E-02 AW577113.1 EST_HUMAN MR4-BT0356-070100-201-h01 BT0356 Homo sapiens cDNA 6422 19469 32643 2.64 1.0E-02 AW577113.1 EST_HUMAN MR4-BT0356-070100-201-h01 BT0356 Homo sapiens cDNA Page 177 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 7067 20273 33529 1.52 1.0E-02 Z29642.1 NT Z.mays U3snRNA pseudogene 9929 22834 36222 8.21 1.0E-02 BF036331.1 EST_HUMAN 601459570F1 NIH_MGC_66 Homo sapiens cDNA clone IMAGE:3863177 5' 9929 22834 36223 8.21 1.0E-02 BF036331.1 EST_HUMAN 601459570F1 NIH_MGC_66 Homo sapiens cDNA clone IMAGE:3863177 5' Orithidia fasciculata 27 kD a guide RNA-binding protein mRNA, complete cds; mitochondrial gene for 11710 24612 2.1 1.0E-02 AF157559.1 NT mitochondrial product tg55h07.x1 NCI_CGAP_Pr28 Homo sapiens cDNA clone IMAGE:2112733 3' similar to gb:X15183_cds1 HEAT SHOCK PROTEIN HSP 90-ALPHA (HUMAN);contains Alu repetitive element;contains element MERS 11739 24641 1.41 1.0E-02 AI417961.1 EST_HUMAN repetitive element; 11806 24727 38219 1.89 1.0E-02 AV760016.1 EST_HUMAN AV760016 MDS Homo sapiens cDNA clone MDSBDC10 5' 12356 25971 1.97 1.0E-02 Q62203 SWISSPROT SPLICEOSOME ASSOCIATED PROTEIN 62 (SAP 62) (SPLICING FACTOR 3A SUBUNIT 2) (SF3A66) 12409 25756 31572 3.12 1.0E-02 AW935521.1 EST_HUMAN RC2-DT0007-120200-016-h02 DT0007 Homo sapiens cDNA 12422 25805 4.23 1.0E-02 S70330.1 NT Homo sapiens renal dipeptidase (RDP) gene, complete cds 12917 25865 2.94 1.0E-02 X62654.1 NT H.sapiens gene for Me491/CD63 antigen wh42f09.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2383433 3' similar to contains element 918 13970 26917 1.44 9.0E-03 AI796126.1 EST_HUMAN MER22 MER22 repetitive element; 1291 14324 1.51 9.0E-03 BE781889.1 EST_HUMAN 601470242F1 NIH_MGC_87 Homo sapiens cDNA clone IMAGE:3873346 5' 2418 15422 28423 2.29 9.0E-03 AL161559.2 NT Arabldopsis thallana DNA chromosome 4, contig fragment No. 59 2427 15431 28432 1.25 9.0E-03 AF099934.1 NT Mus musculus MHC class III protein RP1 (Rp1) mRNA, partial cds 2950 16002 28903 1.06 9.0E-03 AI251744.1 EST_HUMAN qh90f09.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:184281 3' 2950 16002 28904 1.06 9.0E-03 AI251744.1 EST_HUMAN qh90f09.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:184281 3' 3693 16002 28903 0.74 9.0E-03 AI251744.1 EST_HUMAN qh90f09.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:184281 3' 3693 16002 28904 0.74 9.0E-03 AI251744.1 EST_HUMAN qh90f09.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:184281 3' 3736 16768 29654 0.83 9.0E-03 J05184.1 NT S.ac@docaldarius thermopsin gene, complete cds 5380 18362 31202 0.91 9.0E-03 AJ278120.1 NT Homo sapiens mRNA for putative ankyrin-repeat containing protein (ORF1) 6021 19083 1.01 9.0E-03 AI809792.1 EST_HUMAN wf77f04.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2361631 3' 6920 19950 4.43 9.0E-03 BE745988.1 EST_HUMAN 601573438F1 NIH_MGC_9 Homo sapiens cDNA clone IMAGE:3834752 5' 7872 20799 34102 0.59 9.0E-03 AI242219.1 EST_HUMAN qh87o12.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:1853974 3' 7891 20817 34123 0.9 9.0E-03 8922570 NT Homo sapiens hypothetical protein FLJ10650 (FLJ10650), mRNA 8455 21387 0.64 9.0E-03 AL039991.1 EST_HUMAN DKFZp434L0412_r1 434 (synonym: htes3) Homo sapiens cDNA clone DKFZp434L0412 5' Homo sapione oaloium obannel alpha1E subunit (CACNA1E) gene, exons 7-49, and pertial ods, altornatively 8824 21754 0.59 9.0E-03 AF223391.1 NT spliced 10376 23265 36687 1.71 9.0E-03 P20908 SWISSPROT COLLAGEN ALPHA 1(V)CHAIN PRECURSOR 11424 24340 2.36 9.0E-03 Y18000.1 NT Homo sapiens NF2 gene 11451 24367 37817 1.8 9.0E-03 BE395380.1 EST_HUMAN 601310881F1 NIH_MGC_44 Homo sapiens cDNA clone IMAGE:3632181 5' Page 178 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 12079 24920 38421 1.47 9.0E-03 L11144.1 NT Homo sapiens preprogalanin (GAL1) gene, exons 1, 2, and 3 12079 24920 38422 1.47 9.0E-03 L11144.1 NT Homo sapiens preprogalanin (GAL1) gene, exons 1, 2, and 3 12545 25972 1.93 9.0E-03 BF351141.1 EST_HUMAN PM1-HT0452-291299-001-e09 HT0452 Homo sapiens cDNA 12745 25965 23.57 9.0E-03 BE348385.1 EST_HUMAN hw17b09.x1 NCI_CGAP_Lu24 Homo sapiens cDNA clone IMAGE:3183161 3' 13014 25561 33.64 9.0E-03 BF351141.1 EST_HUMAN PM1-HT0452-29299-001-e09 HT0452 Homo sapiens cDNA zh30e03.s1 Soeres_pineal_gland_N3HPG Homo sapiens cDNA clone IMAGE:413596 3' similar to conteins 524 13594 2.38 8.0E-03 AA723007.1 EST_HUMAN Alu repatitive element 1016 14066 27009 23.53 8.3E-03 AF106656.1 NT Homo sapiens adenylosuccinate lyase gene, complete cds 2172 15184 28189 1.85 8.0E-03 AL163283.2 NT Homo sapiens chromosome 21 segment HS21C083 RETROVIRUS-RELATED POL POLYPROTEIN [CONTAINS: REVERSE TRANSCRIPTASE; 2584 15583 28575 1.03 8.0E-03 P10266 SWISSPROT ENDONUCLEASE] 3412 16454 29360 1.04 8.0E-03 AJ131016.1 NT Homo sapiens SCL gene locus 3743 16775 29662 1.75 8.0E-03 P32644 SWISSPROT HYPOTHETICAL 127.0 KD PROTEIN IN RAD24-BMH1 INTERGENIC REGION 3743 16775 29663 1.75 8.0E-03 P32644 SWISSPROT HYPOTHETICAL 127.0 KD PROTEIN IN RAD24-BMH1 INTERGENIC REGION 4355 17369 30233 1.16 8.0E-03 BE840049.1 EST_HUMAN QV0-FN0181-140700-304-g10 FN0181 Homo sapiens cDNA 4490 17501 30364 5.73 8.0E-03 BF383327.1 EST_HUMAN CM4-NN0119-300600-223-b05 NN0119 Homo sapiens cDNA 4830 17831 30700 0.71 8.0E-03 P03181 SWISSPROT HYPOTHETICAL BHLF1 PROTEIN 4830 17831 30701 0.71 8.0E-03 P03181 SWISSPROT HYPOTHETICAL BHLF1 PROTEIN 5343 18326 31175 1.07 8.0E-03 U02970.1 NT Prototheca wickerhamii 263-11 complete mitochondrial DNA Mus musculus major histocompetibility complex region NG27, NG28, PRS28, NADH oxidoreductace, NG29, KIFC1, Fas-binding protein, BING, tapasin, RalGDS-like, KE2, BING4, beta 1,3-galactosyl transferase, and 5713 18786 31717 4.02 8.0E-03 AF110520.1 NT RPS18 genes, complete cds; Sacm21 gene, partial> 6440 25648 32663 1.26 8.0E-03 AP000002.1 NT Pyrococcus horikoshii OT3 genomic DNA, 287001-54400 nt. position (2/7) 7054 20080 33313 4.22 8.0E-03 P55577 SWISSPROT PROABLE PEPTIDASE Y4NA 7246 20157 1.2 8.0E-03 V01109.1 NT Human BK virus (strain MM) genome. (Closely related to SV40.) 7574 20510 33798 1.71 8.0E-03 M17197.1 NT A.califomica (marine gastropod molluse) neuropeptide gene (bag cell), exon 1, 5' end 7972 20894 1.76 8.0E-03 AB038267.1 NT Tursiops truncatus mRNA for p40-phox, complete cds BASEMENT MEMBRANE-SPECIFIC HEPARAN SULFATE PROTEOGLYCAN GORE PROTEIN 9440 22368 35730 0.76 8.0E-03 P98160 SWISSPROT PRECURSOR (HSPG) (PERLECAN) (PLC) 9467 22395 35757 3.94 8.0E-03 AW808692.1 EST_HUMAN MR1-ST0111-111199-011-h06 ST0111 Homo sapiens cDNA 9531 22458 35821 0.84 8.0E-03 9789956 NT Mus musculus fusion 2 (human) (Fus2), mRNA 10455 23343 6.49 8.0E-03 BE086509.1 EST_HUMAN QV1-BT0677-040400-131-g03 ET0677 Homo sapiens cDNA 11205 24131 37579 1.76 8.0E-03 BE788441.1 EST_HUMAN 601475519F1 NIH_MGC_68 Homo sapiens cDNA clone IMAGE:3878405 5' 11423 24339 275 8.0E-03 Z49652.1 NT S.cerevisiae chromosome X reading frame ORF YJR152w Page 179 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 12137 24977 38478 4.04 8.0E-03 AF064589.1 NT Homo sapiens melanoma-associated antigen (MAGE-C1) gene, complete cds 12291 25102 2.46 8.0E-03 M69035.1 NT Oryctolagus cuniculus elF-2a kinase mRNA, complete cds Homo sapiens ABCG1 gene for ABC transporter (ATP-binding cassette, sub-family G (WHITE), member 1), 12334 25130 5.42 8.0E-03 AB038161.1 NT complete cds 718 18776 26696 9.8 7.0E-03 AF097183.1 NT Cryptosporidium parvum HC-10 gene, complete cds 718 18776 26697 9.8 7.0E-03 AF097183.1 NT Cryptosporidium parvum HC-10 gene, complete cds 1003 14052 26996 3.55 7.0E-03 AF243376.1 NT Glycine max glutathione S-transferase CST 21 mRNA, partial cds 1143 14185 27123 2.85 7.0E-03 AV731712.1 EST_HUMAN AV731712HTF Homo sapiens cDNA clone HTFAZF10 5' FORKHEAD BOXPROTEIN D3 (HNF3/FH TRANSCRIPTION FACTOR GENESIS) (HEPATOCYTE 1391 14422 1.34 7.0E-03 Q61060 SWISSPROT NUCLEAR FACTOR 3 FORKHEAD HOMOLG 2) (HFH-2) 1422 14453 27407 5.81 7.0E-03 AA668298.1 EST_HUMAN ab79b09.s1 Stratagene fetal retina 937202 Homo sapiens cDNA clone IMAGE:853145 3' 1522 14553 27514 3.36 7.0E-03 AW303599.1 EST_HUMAN xv21b02.x1 Scares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2813739 3' 2274 15020 28202 1.99 7.0E-03 P04929 SWISSPROT HISTIDINE-RICH GLYCOPROTEIN PRECURSOR 3831 16861 29744 0.97 7.0E-03 AW444463.1 EST_HUMAN UI-H-BI3-akb-c-10-0-UI.s1 NCI_CGAP_Sub5 Homo sapiens cDNA clone IMAGE:2733691 3' 3880 16909 29790 0.98 7.0E-03 AF196344.1 NT Rattus norvegicus neuronal nicotinic acetylcholine receptor subunit (Alpha10) mRNA, complete cds 4105 16861 29744 0.7 7.0E-03 AW444463.1 EST_HUMAN UI-H-BI3-akb-c-10-0-UI.s1 NCI_CGAP_Sub5 Homo sapiens cDNA clone IMAGE:2733691 3' 4709 17714 1.02 7.0E-03 AW630888.1 EST_HUMAN hh89a05.y1 NCI_CGAP_GU1 Homo sapiens cDNA clone IMAGE:2969936 5' 5110 18107 1.98 7.0E-03 AL163278.2 NT Homo sapiens chromesome 21 segment HS21C078 wr10b02.x1 NCI_CGAP_Lu 19 Homo sapiens cDNA clone IMAGE:2481099 3' similar to contains Alu 5334 18318 31166 0.96 7.0E-03 AI970415.1 EST_HUMAN repetitive element;contains element LTR5 repetitive element; yr82g01.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:211824 5' similar to 6031 19093 0.6 7.0E-03 H71106.1 EST_HUMAN gb:X14723 CLUSTEIN PECURSOR (HUMAN); 6350 25646 5.23 7.0E-03 AW861059.1 EST_HUMAN RC1-CT0286-050400-018-c08 CT0286 Homo sapiens cDNA 6569 19610 32796 1.56 7.0E-03 W68251.1 EST_HUMAN zd33f10.r1 Soares_fetal_heart_NbHH19W Homo sapiens cDNA clone IMAGE:342475 5' 6816 19849 33059 2.87 7.0E-03 AA327129.1 EST_HUMAN EST30674 Colon Homo sapiens cDNA 5' end 7g34b10.x1 NCI_CGAP_Brn23 Homo sapiens cDNA clone IMAGE:3308347 3' similar to TR:Q 13387 6846 19878 33092 0.93 7.0E-03 BE857385.1 EST_HUMAN Q13387 HYPOTHETICAL PROTEIN 384D8_2. ;contains TAR1.t2 TAR1 TAR1 repetitive element; 7438 20180 33423 1.98 7.0E-03 BBE928133.1 EST_HUMAN CM2-CT0478-230800-347-b11 CT0478 Homo sapiens cDNA 7943 20865 34176 5.7 7.0E-03 Z35833.1 NT S.cerevisiae chromosome II reading frame ORF YL077w 7943 20865 34177 5.7 7.0E-03 Z35833.1 NT S.cerevisiae chromosome II reading frame ORF YL077w 8430 21362 34701 0.57 7.0E-03 AJ229043.1 NT Homo sapiens 959 kb contig between AML1 and CBR1 on chromosome 21q22, segment 3/3 8430 21362 34702 0.57 7.0E-03 AJ229043.1 NT Homo sapiens 959 kb contig between AML1 and CBR1 on chromosome 21q22, segment 3/3 8689 21620 34962 3.04 7.0E-03 BE175667.1 EST_HUMAN RC5-HT0582-160300-011-D02HT0582 Homo sapiens cDNA Page 180 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 9933 22838 0.76 7.0E-03 AF111168.2 NT Homo sapiens serine palmitoyl transferase, subunit II gene, complete cds; and unknown genes yv49c10.s1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:246066 3' similar to contains 10122 23013 36410 0.67 7.0E-03 N52378.1 EST_HUMAN Alu repetitive element; 10242 23133 36536 2.9 7.0E-03 P48982 SWISSPROT BETA-GALACTOSIDASE PRECURSOR (LACTASE) 10242 23133 36537 2.9 7.0E-03 P48982 SWISSPROT BETA-GALACTOSIDASE PRECURSOR (LACTASE) 10795 23681 1.12 7.0E-03 AV687379.1 EST_HUMAN AV687379 GKC Homo sapiens cDNA clone GKCAFC07 5' 10965 23849 0.97 7.0E-03 AI799734.1 EST_HUMAN wc37e09.x1 NCI_CGAP_Pr28 Homo sapiens cDNA clone IMAGE:2320840 3' 11266 24189 37638 2.46 7.0E-03 AB008852.1 NT Bos taurus mRNA for NDP52, complete cds 11340 24259 37698 1.65 7.0E-03 AJ004862.1 NT Homo sapiens partial MUC58 gene, exon 1-29 11340 24259 37699 1.65 7.0E-03 AJ004862.1 NT Homo sapiens partial MUC5B gene, exon 1-29 12795 25422 1.53 7.0E-03 BE263253.1 EST_HUMAN 601145154F2 NIH_MGC_19 Homo sapiens cDNA clone IMAGE:3160476 5' 12881 25478 1.96 7.0E-03 Y17455.1 NT Homo sapiens LSFR2 gene, penultimate exon 13003 25955 2.11 7.0E-03 AL163300.2 NT Homo sapiens chromosome 21 segment HS21C100 hd22a05.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2910224 3' similar to 1268 14303 27250 8.83 6.0E-03 AW511148.1 EST_HUMAN SW:PXR_HUMAN O75469 ORPHIN NUCLEAR RECEPTOR PXR ; hd22a05.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2910224 3' similar to 1268 14303 27251 8.83 6.0E-03 AW511148.1 EST_HUMAN SW:PXR_HUMAN O75469 ORPHAN NUCLEAR RECEPTOR PXR ; 2933 15986 28884 4.43 6.0E-03 AA759135.1 EST_HUMAN ah78e11.s1 Soares_testis_NHT Homo sapiens cDNA clone 1321772 3' 2933 15986 28885 4.43 6.0E-03 AA759135.1 EST_HUMAN ah78e11.s1 Soares_testis_NHT Homo sapiens cDNA clone 1321772 3' 3291 16338 2.68 6.0E-03 H75690.1 EST_HUMAN yr77h04.r1 Soares fetal liver spleen 1FNLS Homo sapiens cDNA clone IMAGE:211351 5' 3350 16396 1.02 6.0E-03 AF190338.1 NT Notoncus sp. cytochrome c oxidase subunit II gene, partial cds; mitochondrial gene for mitochondrial product Fugu rubripes zinc finger protein, isotocin, fatty acid binding protein, sepiapterin reductase and vasotocin 3440 16481 29388 0.97 6.0E-03 U90880.1 NT genes, complete cds Fugu rubripes zinc finger protein, isotocin, fatty acid binding protein, seplaterin reductase and vasotocin 3440 16481 29389 0.97 6.0E-03 U90880.1 NT genes, complete cds 3605 16642 1.36 6.0E-03 W37985.1 EST_HUMAN zc13a11.r1 Soares_parathyroid_tumor_NbHPA Homo sapiens cDNA clone IMAGE:322172 5' 3278 16760 29647 2.47 6.0E-03 BF510986.1 EST_HUMAN UI-H-B14-apm-c-06-0-UI.s1 NCI_CGAP_Sub8 Homo sapiens cDNA clone IMAGE:3087754 3' 3844 16873 29756 1.05 6.0E-03 6754029 NT Mus musculus glucosamine-6-phosphate deaminase (Gnpi), mRNA 3997 17024 29914 0.65 6.0E-03 AW847284.1 EST_HUMAN RC0-CT0204-240999-021-b10 CT0204 Homo sapiens cDNA 4040 17067 1.34 6.0E-03 BE250108.1 EST_HUMAN 600942904F1 NIH_MGC_15 Homo sapiens cDNA clone IMAGE:2959513 5' Babesia bigemina RAP-1c (rap-1c) gene, complete cds, and YJR070c-like protein (YJR070c-like) gene, 4322 17336 30200 1.36 6.0E-03 aF026272.1 NT partial cds 4433 17444 0.92 6.0E-03 N58946.1 EST_HUMAN yy62h10.s1 Soares_multiple_sclerosis_2NbHMSP Homo sapiens cDNA clone IMAGE:278179 3' Page 181 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 4471 17482 2.1 6.0E-03 AI016833.1 EST_HUMAN ov33c11.x1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1639124 3' 4808 17809 30675 8.44 6.0E-03 AA324242.1 EST_HUMAN EST27116 Cerebellum II Homo sapiens cDNA 5' end similar to EST containing Alu repeat 5265 18251 1.08 6.0E-03 L34170.1 NT Human germline UBF1L gene similar to the gene for ubiquitin-activating enzyme, exons 1-22 5274 18260 31112 1.05 6.0E-03 AI652527.1 EST_HUMAN wb61b12.x1 NCI_CGAP_GC6 Homo sapiens cDNA clone IMAGE:2310143 3' 5340 18323 31172 0.86 6.0E-03 AA889972.1 EST_HUMAN aj95g09.s1 Scares_parathyroid_tumor_NbHPA Homo sapiens cDNA clone IMAGE:1402456 3' 6393 25647 32609 0.64 6.0E-03 9627521 NT Variola virus, complete genome 7128 20332 33596 0.79 6.0E-03 O14994 SWISSPROT SYNAPSIN III 7175 18447 31316 0.68 6.0E-03 BE253748.1 EST_HUMAN 601112353F1 NIH_MGC_16 Homo sapiens cDNA clone IMAGE:3353172 5' 7620 20555 33848 0.42 6.0E-03 aA299442.1 EST_HUMAN EST11949 Uterus tumor I Homo sapiens cDNA 5' end 7620 20555 33849 0.42 6.0E-03 AA299442.1 EST_HUMAN EST11949 Uterus tumor I Homo sapiens cDNA 5' end 8095 21007 34332 0.7 6.0E-03 AF128894.1 NT Homo sapiens telomerase reverse transcriptase (TERT) gene, exons 7-16 and complete cds 8308 21212 34549 0.61 6.0E-03 P17964 SWISSPROT RAS-RELATED PROTEIN RAP-2B 8359 21264 34599 0.49 6.0E-03 AJ243211.1 NT Homo sapiens DMBT1 candidate tumour suppressor gene, exons 1 to 55 ow13a04.x1 Soares_parathyroid_tumor_NbHPO Homo sapiens cDNA clone IMAGE:1646670 3' similar to 8440 21372 34713 14.27 6.0E-03 AI033980.1 EST_HUMAN contains MER10.b1 MER10 repetitive element ; 8552 21482 34824 2.83 6.0E-03 AW799337.1 EST_HUMAN RC0-UM0051-210300-032-g02 UM0051 Homo sapiens cDNA 8624 21555 1.74 6.0E-03 BF038198.1 EST_HUMAN 601454915F1 NIH_MGC_66 Homo sapiens cDNA clone IMAGE:3858626 5' 10083 22876 36264 9.14 6.0E-03 D10548.1 NT Subacute sclerosing panencephalitis (SSPE) virus mRNA for fusion protein ti22c02.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2131202 3' similar to SW:R13A_HUMAN 10546 23432 2.46 6.0E-03 AI432661.1 EST_HUMAN P40429 60S RIBOSOMAL PROTEIN L13A ; 10658 23544 36978 1.14 6.0E-03 AJ011849.1 NT Bacillus subtilis fenD gene Homo sapiens okadaic acid-inducible and cAMP-regulated phosphorotein 19 (ARPP-19) mRNA, complete 10785 23671 0.88 6.0E-03 AF084555.1 NT cds 10889 23774 37200 0.82 6.0E-03 X68366.1 NT M.thermoformiclcum complete plasmid pFV1 DNA 11185 24111 37559 1.71 6.0E-03 AW962164.1 EST_HUMAN EST374237 MAGE resequences, MAGG Homo sapiens cDNA 11250 24174 2.31 6.0E-03 11545814 NT Homo sapiens hypothetical zinc finger protein FLJ14011 (FLJ14011), mRNA 11420 24336 5.66 6.0E-03 U14556.1 NT Mus musculus zino-finger protein mRNA, complete cds 11421 24337 37785 4.02 6.0E-03 BE737895.1 EST_HUMAN 601572746F1 NIH_MGC_57 Homo sapiens cDNA clone IMAGE:3839747 5' 12394 25168 2.77 6.0E-03 AF010496.1 NT Rhodobacter capsulatus strain sB1003, partial genome Methanobacterium thermoautotrophicum from bases 429192 to 450296 (section 39 of 148) of the complete 12504 25742 7.19 6.0E-03 AE000833.1 NT genome 12577 25796 2.38 6.0E-03 U30790.1 NT Pneumocystis carinii f. sp. ratti guanine nucleotide binding protein alpha subunit (pcg1) gene, complete cds 12627 25310 1.75 6.0E-03 Q62209 SWISSPROT SYNAPTONEMAL COMPLEX PROTEIN 1 (SCP-1 PROTEIN) Page 182 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 12898 25487 2.9 6.0E-03 BE788019.1 EST_HUMAN 601482621F1 NIH_MGC_68 Homo sapiens cDNA clone IMAGE:3885388 5' 12914 25497 1.89 6.0E-03 AJ245480.1 NT Brassica napus slg gene for S-locus glycoprotein, cultivar T2 H.sapiens DMA, DMB, HLA-Z1, IPP2, LMP2, TAP1, LMP2, TAP2, DOB, DQB2 and RING8, 9, 13 and 14 228 13326 26243 4.89 5.0E-03 X87344.1 NT genec Chlamydia trachomatis partial ORFB; aminoacyl-tRNA synthase, complete cds; complete ORFA, and grpE- 692 13753 26669 1.93 5.0E-03 L25105.1 NT like protein, complete cds Chlamydia trachomatis partial ORFB; aminoacyl-tRNA synthase, complete cds; complete ORFA, and grpE- 692 13753 26670 1.93 5.0E-03 L25105.1 NT like protein, complete cds Chlamydia trachomatis partial ORFB; aminoacyl-tRNA synthase, complete cds; complete ORFA, and grpE- 693 13753 26669 2.31 5.0E-03 L25105.1 NT like protein, complete cds Chlamydia trachomatis partial ORFB; aminoacyl-tRNA synthase, complete cds; complete ORFA, and grpE- 693 13753 26670 2.31 5.0E-03 L25105.1 NT like protein, complete cds 1139 14181 27119 1.03 5.0E-03 AJ010457.1 NT Arabidopsis thaliana mRNA for DEAD box RNA helicase,RH3 1590 14621 1.11 5.0E-03 AI138977.1 EST_HUMAN qc79d05.x1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1735689 3' 2730 15723 28719 2.35 5.0E-03 AB033006.1 NT Homo sapiens mRNA for KIAA1180 protein, partial cds 2978 16030 28932 0.79 5.0E-03 BE266057.1 EST_HUMAN 601194796F1 NIH_MGC_7 Homo sapiens cDNA clone IMAGE:3538799 5' 3181 16231 29126 5.03 5.0E-03 T87623.1 EST_HUMAN yc81f09.s1 Soares infant brain 1NIB Homo sapiens cDNA clone IMAGE:22395 3' 3198 16246 2.2 5.0E-03 AL161491.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 3 3208 16256 29154 1.43 5.0E-03 R17194.1 EST_HUMAN yj86g02.s1 Soares breast 2NbHBst Homo sapiens cDNA clone IMAGE:155666 3' 3222 16368 0.97 5.0E-03 AJ297357.1 NT Homo sapiens partial LIMD1 gene for LIM domains containing protein 1 and KIAA0851 gene 3764 16796 29685 6.51 5.0E-03 AF147449.2 NT Pseudomonas aeruginosa strain PAO1 penicillin-binding protein 1B (ponB) gene, complete cds 3822 16852 29736 0.71 5.0E-03 U38914.1 NT Citrus sinensis seed storage protein citrin mRNA, complete cds 4026 17053 29943 1.09 5.0E-03 X66366.1 NT M.thermoformicium complet plasmid pFV1 DNA 4055 17082 1.95 5.0E-03 AA299675.1 EST_HUMAN EST12218 Uterus tumor I Homo sapiens cDNA 5' end 4408 17420 30284 0.84 5.0E-03 H78355.1 EST-hUMAN yu79g10.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:240066 5' 4410 16852 29736 0.99 5.0E-03 U38914.1 NT Citrus sinensis seed storage protein citrin mRNA, complete cds 4718 17723 30585 0.92 5.0E-03 AJ131016.1 NT Homo sapiens SCL gene locus 4832 17833 30703 1.53 5.0E-03 AI752367.1 EST_HUMAN cn15c02x1 Normal Human Trabecular Bone Cells Homo sapiens cDNA clone NHTBC_cn15c02 random 5045 18042 30898 1.1 5.0E-03 P15265 SWISSPROT SPERM MITOCHONDRIAL CAPSULE SELENOPROTEIN (MCS) 6006 19070 32196 5.58 5.0E-03 P35500 SWISSPROT SODIUM CHANNEL PROTEIN PARA (PARAYTICPROTEIN) Page 183 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value PROBABLE UBIQUITIN CARBOXYL-TERMINAL HYDRCLASE FAY-Y (UBIQUITIN THIOLESTERASE FAF-Y) (UBIQUITIN-SPECIFIC PROCESSING PROTEASE FAF-Y) (DEUBIQUITINATING ENZYME FAF- Y) (FAT FACETS PROTEIN RELATED, Y-LINKED) (UBIQUITIN-SPECIFIC PROTEASE 9, Y 6279 19330 32496 2.44 5.0E-03 O00507 SWISSPROT CHROMOSOME) 6316 19366 0.95 5.0E-03 AE002234.2 NT Chlamydophila pneumoniae AR39, section 62@f 94 of the complete genome 6879 19909 7.95 5.0E-03 BE30009.1 EST_HUMAN 600944564T1 NIH_MGC_17 Homo sapiens cDNA clone IMAGE:2960871 3' 7164 18436 31337 6.52 5.0E-03 AB025024.1 NT Mus musculus AMD1 gene for S-adenosylmethionine decarboxylase, complete cds 7391 20090 0.97 5.0E-03 AB038267.1 NT Tursiops truncatus mRNA for p40-phox, complete cds 7447 20388 33658 2.03 5.0E-03 6753651 NT Mus musculus dynein, axon, heavy chain 11 (Dnahc11), mRNA EST03012 Fetal brain, Stratagene (cat#936206) Homo sapiens cDNA clone HFBCR93 similar to EST 7905 20830 34133 0.68 5.0E-03 T05124.1 EST_HUMAN containing Alu repeat 8041 20955 1.2 5.0E-03 AW854327.1 EST_HUMAN RC3-CT0255-031099-011-f07 CT0255 Homo sapiens cDNA 8326 21141 34474 8.9 5.0E-03 AB016816.1 NT Homo sapiens MASL1 mRNA, complete cds ADMS-TS 5 PRECURSOR (A DISINTEGRIN AND METALLOPROTEINASE WITH THROMBOSPONDIN 8305 21209 34544 0.57 5.0E-03 Q9R001 SWISSPROT MOTIFS 5) (ADAMTS-5) (ADAM-TS5) (AGGRECANASE-2) (ADMP-2) (IMPLANTIN) ADAM-TS 5 PRECURSOR (A DISINTEGRIN AND METALLOPROTEINASE WITH THROMBOSPONDIN 8305 21209 34545 0.57 5.0E-03 Q9R001 SWISSPROT MOTIFS 5) (ADAMTS-5) (ADAM-TS5) (AGGRECANASE-2) (ADMP-2) (IMPLANTIN) 8815 21745 35093 1.9 5.0E-03 P48982 SWISSPROT BETA-GALACTOSIDASE PRECURSOR (LACTASE) 9172 22100 5.91 5.0E-03 M61132.1 N Mouse complement receptor (CR2) mRNA, 3' end 9365 22293 35658 1.46 5.0E-03 D90723.1 NT Escherichia coli genomic DNA. (19.1 - 19.4 min) 10354 23243 36663 1.21 5.0E-03 L21710.1 NT Plasmodium berghei 58 kDa phosphoprotein mRNA, partial cds 10477 23365 36778 0.61 5.0E-03 AW821888.1 EST_HUMAN RC0-ST0379-210100-032-c02 ST0379 Homo sapiens cDNA 10822 23708 37135 0.64 5.0E-03 766257 NT Homo sapiens PRO0471 protein (PRO0471), mRNA 10957 23841 0.58 5.0E-03 AA653261.1 EST_HUMAN ag49c10.s1 Gessier Wilms tumor Homo sapiens cDNA clone IMAGE:1126290 3' 11163 24091 5.13 5.0E-03 T19586.1 EST_HUMAN 694F Heart Homo sapiens cDNA clone 694 xn59g05.x1 Soares_NHCeC-cervical_tumor Homo sapiens cDNA clone IMAGE:2698040 3' similar to 11378 24294 37739 2.46 5.0E-03 AW170334.1 EST_HUMAN contains L1.t2 L1 repetitive element ; xn59g05.x1 Soares_NHCeC_cervical_tumor Homo sapiens cDNA clone IMAGE:2698040 3' similar to 11378 24294 37740 2.46 5.0E-03 AW170334.1 EST_HUMAN contains L1.t2 L1 repetitive element ; 11478 24391 37841 2.08 5.0E-03 T49153.1 EST_HUMAN yb09e04.r1 Stratagene placenta (#937225) Homo sapiens cDNA clone IMAGE:70686 5' 11523 24433 37891 1.76 5.0E-03 10946753 NT Mus musculus hypothetical protein, MNCb-4760 (LOC58212), mRNA 11775 24674 4.05 5.0E-03 BE048055.1 EST_HUMAN tz46c04.y1 NCI_CGAP_Brn52 Homo sapiens cDNA clone IMAGE:2291622 5' 12519 25917 7.51 5.0E-03 AF047874.1 NT Gallus gallus glyceraldehyde-3-phosphate dehydrogenase mRNA, complete cds 12649 25324 19.86 5.0E-03 AF067253.1 NT Brugia malayi Y chromosome marker Page 184 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 12742 25382 231 5.0E-03 L10347.1 NT Human pro-alpha1 type II collagen (COL2A1) gene exons 1-54, complete cds zx75a03.s1 Soares ovary tumor NbHOT Homo sapiens cDNA clons IMAGE:809548 3' similar to 12772 25401 2.16 5.0E-03 AA456597.1 EST_HUMAN SW:DXA2_MOUSE P14685 PROBABLE DIPHENOL OXIDASE A2COMPONENT ; 12796 25750 4.71 5.0E-03 BF572332.1 EST_HUMAN 602077774F1 NIH_MGC_62 Homo sapiens cDNA clone IMAGE:4252002 5' 12964 25522 31743 2.44 5.0E-03 AW449109.1 EST_HUMAN UI-H-BI3-akf-f-08-0-UI.s1 NCI_CGAP_Sub5 Homo sapiens cDNA clone IMAGE:2734215 3' 251 13349 26262 2.07 4.0E-03 AW500196.1 EST_HUMAN UI-HF-BN0-akc-h-04-0-UI.r1 NIH_MGC_50 Homo sapiens cDNA clone IMAGE:3076831 5' 341 13431 26345 1.75 4.0E-03 R46482.1 EST_HUMAN yg51e04.s1 Soares infant brain 1NIB Homo sapiens cDNA clone IMAGE:35988 3' 466 13537 26459 0.69 4.0E-03 P54675 SWISSPROT PHOSPHATIDYLINOSITOL 3-KINASE 3 (PI3-KINASE) (PTDINS-3-KINASE) (PI3K) 624 13689 26592 2.29 4.0E-03 AA939339.1 EST_HUMAN on75g12.s1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:1562566 3' 902 13954 26903 1.77 4.0E-03 R46482.1 EST_HUMAN yg51e04.s1 Soares infant brain 1NIB Homo sapiens cDNA clone IMAGE:35988 3' 936 13988 3.87 4.0E-03 AW749101.1 EST_HUMAN RC3-BT0333-110100-012-f01 BT0333 Homo sapiens cDNA 1178 14218 27157 20.65 4.0E-03 AA099777.1 EST_HUMAN zlB1a08.r1 Stratagene colon (#937204) Homo sapiens cDNA clone IMAGE:510998 5' 1197 14236 27176 1.67 4.0E-03 aW794740.1 EST_HUMAN RC6-UM0014-170400-023-G01 UM0014 Homo sapiens cDNA 1329 14363 27311 1.09 4.0E-03 AA284374.1 EST_HUMAN zs59a01.r1 NCI_CGAP-GCB1 Homo sapiens cDNA clone IMAGE:701736 5' 1609 14639 1.26 4.0E-03 AV708305.1 EST_HUMAN AV708305 ADC Homo sapiens cDNA clone ADCAKB06 5' 1771 14797 27767 1.98 4.0E-03 U33472.1 NT Rattus norvegicus type 1 astrocyte and olfactory-limbic associated protein AT1-46 mRNA, complete cds 2031 15048 28045 10.26 4.0E-03 AA099777.1 EST_HUMAN zl81a08.r1 Stratagene colon (#937204) Homo sapiens cDNA clone IMAGE:510998 5' 2262 15272 1.67 4.0E-03 BE410556.1 EST_HUMAN 601304161 F1 NIH_MGC_21 Homo sapiens cDNA clone IMAGE:3638510 5' 2297 15305 28311 1.48 4.0E-03 AW794740.1 EST_HUMAN RC6-UM0014-170400-023-G01 UM0014 Homo sapiens cDNA Homo sapiens X28 region near ALD locus containing dual specificity phosphatase 9 (DUSP9), ribosomal protein L18a (RPL18a), Ca2+/Calmodulin-dependent protein kinase I (CAMKI), creatine transporter (CRTR), 2609 15607 28601 2.01 4.0E-03 U52111.2 NT CDM protein (CDM), adrenoleukodystrophy protein > Homo sapiens X28 region near ALD locus containing dual specificity phosphatase 9 (DUSP9), ribosomal protein L18a (RPL18a), Ca2+/Calmodulin-dependent protein kinase I (CAMKI), creatine transporter (CRTR), 2609 155607 28602 2.01 4.0E-03 U52111.2 NT CDM protein (CDM), adrenoleukodystrophy protein > 2741 15734 28728 2.8 4.0E-03 AJ277365.1 NT Homo sapiens polyglutamine-containing C14ORF4 gene 2741 15734 28729 2.8 4.0E-03 AJ277365.1 NT Homo sapiens polyglutamine-containing C14ORF4 gene 2747 15739 28732 1.28 4.0E-03 AL163284.2 NT Homo sapiens chromosome 21 segment HS21C084 3272 16320 29224 1.4 4.0E-03 BE154134.1 EST_HUMAN PM1-HT0340-151299-003-h08 HT0340 Homo sapiens cDNA 3272 16320 29225 1.4 4.0E-03 BE154134.1 EST_HUMAN PM1-HT0340-151299-003-h08 HT0340 Homo sapiens cDNA 3592 16629 29532 0.93 4.0E-03 AW188426.1 EST_HUMAN xj98f04.x1 NCI_CGAP_Co18 Homo sapiens cDNA clone IMAGE:2665279 3' 3592 16629 29533 0.93 4.0E-03 AW188426.1 EST_HUMAN xj98f04.x1 NCI_CGAP_Co18 Homo sapiens cDNA clone IMAGE:2665279 3' 3689 16722 29615 0.68 4.0E-03 Q13606 SWISSPROT OLFACTORY RECEPTOR 5@1 (OFACTORY RECEPTOR-LIKE PROTEIN OLF1) Page 185 of 545<BR> Table 4<BR> Single Exon Probes Expressed In Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 3701 16733 29624 0.8 4.0E-03 AV646253.1 EST_HUMAN AV646253 GLC Homo sapiens cDNA clone GLCALDO2 3' 3985 16722 29615 0.7 4.0E-03 Q13606 SWISSPROT OLFACTORY RECEPTOR 5I1 (OLFACTORY RECEPTOR-LIKE PROTEIN OLF1) 4005 17032 29922 0.8 4.0E-03 AF060868.1 NT Mus musculus tumor susceptibility protein 101 (tsg101) gene, complete cds 4081 17106 2.28 4.0E-03 AJ011712.1 NT Homo sapiens TNNT1 gene, exons 1-11 (and joined CDS) ab18a08.x5 Stratagene lung (#937210) Homo sapiens cDNA clone IMAGE:841142 3' similar to contains Alu 4723 17728 30592 0.98 4.0E-03 AI732754.1 EST_HUMAN repetitive element; 5325 18309 31159 1.59 4.0E-03 AA699995.1 EST_HUMAN zi69b01.s1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:436009 3' 5386 18368 1.02 4.0E-03 AW816104.1 EST_HUMAN MR3-ST0220-10100-026-d05 ST0220 Homo sapiens cDNA 5458 18539 31381 1.67 4.0E-03 AF005859.1 NT Drosophila melanogaster anon2D7 (anon2D7) mRNA, complete cds 5584 18661 31536 20.71 4.0E-03 AF169825.1 NT Rattus norvegicus beta-catenin binding protein mRNA, complete cds 6004 19068 32195 2.46 4.0E-03 P04196 SWISSPROT (HPRG) 6008 19072 32197 1.6 4.0E-03 P21849 SWISSPROT MAJOR SURFACE-LABELED TROPHOZOITE ANTIGEN PRECURSOR 6098 19159 32292 0.85 4.0E-03 AL133871.1 EST_HUMAN DKFZP761I1014_r1 761 (synonym: hamy2) Homo sapiens cDNA clone DKFZp761I1014 5' 6321 19371 3.62 4.0E-03 U22180.1 NT Rattus norvegicus opsin gene, complete cds 6481 19526 32704 0.98 4.0E-03 AW590572.1 EST_HUMAN hg46c07.x1 NCI_CGAP-GC6 Homo sapiens cDNA clone IMAGE:2948652 3' 6564 19605 32790 1.66 4.0E-03 BE548453.1 EST_HUMAN 601076015F1 NIH_MGC_12 Homo sapiens cDNA clone IMAGE:3461954 5' 6966 19994 33222 1.34 4.0E-03 AA813222.1 EST_HUMAN al32f11.s1 Soares-testis_NHT Homo sapiens cDNA clone 1392045 3' 7082 20288 33547 1.49 4.0E-03 U76408.1 NT Lycopersicon esculentum knotted 3 protein (TKn3) mRNA, complete cds 7425 20124 33361 1.01 4.0E-03 AL163278.2 NT Homo sapiens chromosome 21 segment HS21C078 7425 20124 33362 1.01 4.0E-03 AL163278.2 NT Homo sapiens chromosome 21 segment HS21C078 7562 20499 33787 4.55 4.0E-03 Q02817 SWISSPROT MUCIN 2 PRECURSOR (INTESTINAL MUCIN 2) 7835 20763 34066 1.04 4.0E-03 AI681483.1 EST_HUMAN bx37g12.x1 NCI_CGAP_Lu24 Homo sapiens cDNA clone IMAGE:2271814 3' 7837 20765 34068 0.59 4.0E-03 BE670170.1 EST_HUMAN 7e31b02.x1 NCI_CGAP_Lu24 Homo sapiens cDNA clone IMAGE:3284043 3' 7948 20870 0.79 4.0E-03 X92109.1 NT H.sapiens hcgIX gene ADAM-TS 5 (A DISINTEGRIN AND METALLOPROTEINASE WITH THROMBOSOPONDIN MOTIFS 5) 8521 21452 34795 0.58 4.0E-03 Q9TT92 SWISSPROT (ADAMTS-5) (ADAM-TS5) (AGGRECANASE-2) (ADMP-2) (ADAM-TS 11) 8626 21557 34896 4.61 4.0E-03 AF111944.1 NT Dictyostelium discoideum AX4 development protein DG1122 (dG1122) gene, partial cds te49b11.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2090013 3' similar to contains Alu 9273 22201 35558 7.93 4.0E-03 AI553983.1 EST_HUMAN repetitive element; 9446 22374 3.38 4.0E-03 AL163209.2 NT Homo sapiens chromosome 21 segment HS21C009 9456 22384 35746 3.88 4.0E-03 AL163278.2 NT Homo sapiens chromosome 21 segment HS21C078 10437 23326 36743 0.52 4.0E-03 H30664.1 EST_HUMAN yp42g12r1 Soares retina N2b5HR Homo sapiens cDNA clone IMAGE:190150 5' 10864 23750 37175 0.84 4.0E-03 AL161555.2 NT Arabidopsis thaliana DNA chromosome 4, contig fragment No. 55 11041 23925 0.58 4.0E-03 AL163281.2 NT Homo sapiens chromosome 21 segment HS21C081 Page 186 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 11569 24478 37944 5.77 4.0E-03 AL163206.2 NT Homo sapiens chromosome 21 segment HS21C006 11949 24793 38291 1.57 4.0E-03 AI208703.1 EST_HUMAN qg56c05.x1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1839176 3' 11949 24793 38292 1.57 4.0E-03 AI208703.1 EST_HUMAN qg56c05.x1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1839176 3' 12185 25021 38523 1.4 4.0E-03 AE002102.1 NT Ureaplasma urealyticum section 3 of 59 of the complete genome 12490 25933 4.6 4.0E-03 BE815173.1 EST_HUMAN PM4-BN0138-180600-002-b08 BN0138 Homo sapiens cDNA 12510 25244 1.54 4.0E-03 BE298290.1 EST_HUMAN 601118164F1 NIH_MGC_17 Homo sapiens cDNA clone IMAGE:3028095 5' 12585 25284 3.2 4.0E-03 AW504273.1 EST_HUMAN UI_HF_BN0-alp-g-04-0-Ul.r1 NIH_MGC_50 Homo sapiens cDNA clone IMAGE:3080622 5' 7q74c09.x1 NCI_CGAP_Lu24 Homo sapiens cDNA clone IMAGE: 3' similar to containe Alu repetitive 12807 25430 3.15 4.0E-03 BF224125.1 EST_HUMAN element;contains element MER31 repetitive element ; hh02c07.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2953932 3' similar to contains element 12841 25848 2.93 4.0E-03 AW614596.1 EST_HUMAN LTR6 repetitive element ; 12855 25465 1.99 4.0E-03 AW819141.1 EST_HUMAN RC3-ST0281-240400-015-f03 ST0281 Homo sapiens cDNA 392 13476 26396 1.8 3.0E-03 AF011920.1 NT Homo sapiens protein kinase CK2 catalytic subunit alpha gene, exon 1 904 13956 26904 5.12 3.0E-03 AF011920.1 NT Homo sapiens protein kinase CK2 catalytic subunit alpha gene, exon 1 nc73c05.s1 NCI_CGAP-Pr2 Homo sapiens cDNA clone IMAGE:782984 similar to contains Alu repetitive 1688 14718 27679 4.85 3.0E-03 AA468110.1 EST_HUMAN element; 2275 15284 1.07 3.0E-03 AF055066.1 NT Homo sapiens MHC class 1 region 2313 15321 5.91 3.0E-03 Z32521.1 NT S.cereale (cv. Halo) mRNA for triosephosphate isomerase 2314 15322 28322 1.6 3.0E-03 U46858.1 NT Mus musculus Intestinal trefoil factor gene, partial cds 2314 15322 28323 1.6 3.0E-03 U46858.1 NT Mus musculus Intestinal trefoil factor gene, partial cds Homo sapiens glutathione S-transferase theta 2 (GSTT2) and glutathione S-transferase theta 1 (GSTT1) 2426 15430 28431 0.99 3.0E-03 AF240786.1 NT genes, complete cds 3034 16086 0.7 3.0E-03 Y09006.1 NT Arabidopsis thaliana rpoMt gene 3132 16182 29076 2.53 3.0E-03 BE379296.1 EST_HUMAN 601237982F1 NIH_MGC_44 Homo sapiens cDNA clone IMAGE:3809933 5' 3194 16242 29137 3.05 3.0E-03 AW802687.1 EST_HUMAN IL2-UM0076-240300-056-D03 UM0076 Homo sapiens cDNA 3478 16518 29417 2.31 3.0E-03 U34606.1 NT Mus musculus alpha-1(XVIII) collagen (COL 18A1) gene, exon 1 and 2 3487 16526 7.9 3.0E-03 Y12500.1 NT C.elegans samdc gene 4062 17088 29973 8.3 3.0E-03 AV762392.1 EST_HUMAN AV762392 MDS Homo sapiens cDNA clone MDSBSG01 5' 4062 17088 29974 8.3 3.0E-03 AV762392.1 EST_HUMAN AV762392 MDS Homo sapiens cDNA clone MDSBSG01 5' 4120 17143 30016 2.15 3.0E-03 AI792278.1 EST_HUMAN ah04f09.y5 Gessier Wilms tumor Homo sapiens cDNA clone IMAGE:1155689 5' 4502 17512 30378 10.13 3.0E-03 AJ011432.1 NT Rattus norveglcus gdnf gene 4638 17644 30508 6.24 3.0E-03 AI536141.1 EST_HUMAN xu8.P10.H3 conom Homo sapiens cDNA 3' ab18a08.x5 Stratagene lung (#937210) Homo sapiens cDNA clone IMAGE:841142 3' similar to contains Alu 4948 17947 30805 1.72 3.0E-03 AI732754.1 EST_HUMAN repetitive element; Page 187 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 4963 17961 30819 3.2 3.0E-03 BE787945.1 EST_HUMAN 601482715F1 NIH_MGC-68 Homo sapiens cDNA clone IMAGE:3885483 5' 5291 18276 31124 1.08 3.0E-03 4506414 NT Homo sapiens RAP1, GTPase activating protein 1 (RAP1GA1) mRNA 5291 18276 31125 1.08 3.0E-03 4506414 NT Homo sapiens RAP1, GTPase activating protein 1 (RAP1GA1) mRNA 5447 18528 31254 3.58 3.0E-03 8922499 NT HOmo sapiens hypothetical protein FLJ10539 (FLJ10539), mRNA 5747 18820 31917 1.86 3.0E-03 AJ249981.1 NT Mus musculus mRNA for hypothetical protein (ORF2 ortholog) Mus musculus H2-M alpha chaln (H2-Ma) gene, H2-M beta 2 chaln (H2-Mb2) gene, H2-M beta 1 chain (H2- 5821 18893 32006 1.02 3.0E-03 U35323.1 NT Mb1) gene, low molecular weight protein 2 Lmp2 (Lmp2) gene, complete cds 6834 19866 33080 10.99 3.0E-03 AA456701.1 EST_HUMAN aa13f10.r1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:813163 5' 7374 20368 33637 0.65 3.0E-03 D37977.1 NT Fugu rubripes mRNA for sodium channel alpha subunit, partial cds 7571 20507 33795 1.27 3.0E-03 AJ011419.1 NT Kluyveromyces marxianus pcpl3 gene for purine-cytosine pemease 7946 20868 34180 3.67 3.0E-03 AB021736.1 NT Oryza sativa gene for bZIP protein, complete cds 8376 21280 34611 0.47 3.0E-03 P26659 SWISSPROT DNA REPAIR HELIGASE RAD15 (RHP3) 8517 21448 31790 0.97 3.0E-03 BF333058.1 EST_HUMAN RC0-BT0812-250900-032-e07 BT0812 Homo sapiens cDNA 8517 21448 31791 0.97 3.0E-03 BF333058.1 EST_HUMAN RC0-BT0812-250900-032-e07 BT0812 Homo sapiens cDNA 8734 21664 35009 1.74 3.0E-03 N92580.1 EST_HUMAN zb27b04.s1 Soares_parathyroid_tumor_NbHPA Homo sapiens cDNA clone IMAGE:304783 3' 8890 21820 0.65 3.0E-03 M63498.1 NT S.cerevisiae UGA35 gene, complete cds 9029 21958 35318 1.18 3.0E-03 P51989 SWISSPROT HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN A2 HOMOLOG 1 (HNRNP A2(A)) 9052 21981 35338 1.61 3.0E-03 AL163268.2 NT Homo sapiens chromosome 21 segment HS21C068 9148 22076 1.4 3.0E-03 Q9QM81 SWISSPROT NONSTRUCTURAL PROTEIN V hh80f10.x1 NCI_CGAP_GU1 Homo sapiens cDNA clone IMAGE:2969131 3' similar to contains L1.t1 L1 9543 22470 11.53 3.0E-03 AW613774.1 EST_HUMAN repetitive element ; 9598 22524 35888 4.26 3.0E-03 AL161589.2 NT Arabldopsis thaliana DNA chromosome 4, contig fragment No. 85 ov03d12.x1 NCI_CGAP_Kid3 Homo sapiens cDNA clone IMAGE:1636247 3' similar to gb:X57138_rna1 9620 22546 35917 7.95 3.0E-03 AI016731.1 EST_HUMAN HISTONE H2b.2(HUMAN); 9943 22848 0.85 3.0E-03 D90901.1 NT Synechocystis sp. PCC6803 complete genome, 3/27, 271600-402289 10162 23053 0.77 3.0E-03 P03355 SWISSPROT POLPOLYPROTEIN [CONTAINS: PROTEASE ; REVERSE TRANSCRIPTASE ; RIBONUCLEASE H] 10229 23120 7.22 3.0E-03 P08672 SWISSPROT CIRCUMSPOROZOITE PROTEIN PRECURSOR (CS) RETROVIRUS-RELATED POL POLYPROTEIN [CONTAINS: REVERSE TRANSCRIPTASE ; 10407 23296 36716 1.65 3.0E-03 P11369 SWISSPROT ENDONUCLEASE] 10501 23389 36800 1.44 3.0E-03 P51989 SWISSPROT HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN A2 HOMOLOG 1 (HNRNP A2(A)) 10639 23525 36960 4.3 3.0E-03 AL163303.2 NT Homo sapiens chromosome 21 segment HS21C103 11283 24204 1.87 3.0E-03 5803028 NT Homo sapiens ATP/GTP-binding protein (HEAB), mRNA 11627 20868 34180 1.63 3.0E-03 AB021736.1 NT Oryza sativa gene for bZIP protein, complete cds 11819 24740 38231 1.96 3.0E-03 AF009222.1 NT Pneumocystis carinil kexin-like serine endoprotease mRNA, partial cds Page 188 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 11870 23970 37407 1.46 3.0E-03 P22531 SWISSPROT SMALL PROLINE RICH PRO TEIN II (SPR-II) (CLONE 930) 11880 23980 37418 2.66 3.0E-03 AF266285.1 NT Homo sapiens golgin-like protein (GLP) gene, complete cds 11912 24759 38255 2.98 3.0E-03 AF094481.1 NT Homo sapiens trinucleotide repeat DNA binding protein p20-CGGBP (CGGBP) gene, complete cds 11912 24759 38256 2.98 3.0E-03 AF094481.1 NT Homo sapiens trinucleotide repeat DNA binding protein p20-CGGBP (CGGBP) gene, complete cds RETROVIRUS-RELATED POL POLYPROTEIN [CONTAINS: REVERSE TRANSCRIPTASE ; 11987 24830 38327 1.76 3.0E-03 P11369 SWISSPROT ENDONUCLEASE] 12285 25762 2.16 3.0E-03 AI525056.1 EST_HUMAN promrna-5.E07.r bvtumor Homo sapiens cDNA 5' 12370 25877 1.68 3.0E-03 AB009668.1 NT Homo sapiens gene for CMP-N-acetylneuraminic acid hydroxylase, partial cds 12533 25256 31831 1.61 3.0E-03 AJ296282.1 NT Rattus norvegicus mRNA for connexin36 (cx36 gene) 538 13607 26516 0.77 2.0E-03 Q04652 SWISSPROT RING CANAL PROTEIN (KELCH PROTEIN) 538 13607 26517 0.77 2.0E-03 Q04652 SWISSPROT RING CANAL PROTEIN (KELCH PROTEIN) 812 15885 11.14 2.0E-03 T70874.1 EST_HUMAN yd 15h03.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:108341 5' 1390 14421 27376 1.75 2.0E-03 M20783.1 NT Human alpha-2-plasmin inhibitor gene, exone 6 and 7 1393 14424 27378 1.14 2.0E-03 AA661605.1 EST_HUMAN nu86f01.s1 NCI_CGAP_Alv1 Homo sapiens cDNA clone IMAGE:1217593 1402 14433 27388 13.79 2.0E-03 AF284446.1 NT Homo sapiens tumor-related protein DRC2 (DRC2) gene, complete cds PLATELET-ENDOTHELIAL TETRASPAN ANTIGEN 3 (PETA-3) (GP27) (MEMBRANE GLYCOPROTEIN 1508 14539 27501 1.7 2.0E-03 P48509 SWISSPROT SFA-1)(CD151 ANTIGEN) Homo sapiens procollegen-lysine, 2-oxoglutarate 5-dioxygenase (lysine hydroxyiase, Ehiers-Denlos syndrome 1537 14567 27526 1.8 2.0E-03 4557836 NT type VI)(PLOD) mRNA Homo sapiens procollegen-lysine, 2-oxoglutarate 5-dioxygenase (lysine hydroxyiase, Ehiers-Denlos syndrome 1537 14567 27527 1.8 2.0E-03 4557836 NT type VI)(PLOD) mRNA 1614 14644 6.77 2.0E-03 P29400 SWISSPROT COLLAGEN ALPHA 5(IV) CHAIN PRECURSOR 1796 14822 27790 1.28 2.0E-03 AA450138.1 EST_HUMAN zx42a10.r1 Soares_total_fetua_Nb2HF8_9w HOmo sapiens cDNA clone IMAGE:780114 5' 2011 15029 28022 1.35 2.0E-03 AF302691.1 NT Mus musculus myelin expression factor-3-like protein gene, partial cds 2265 15275 28281 0.92 2.0E-03 AL163302.2 NT Homo sapiens chromosome 21 segment HS21C102 2617 15615 5.66 2.0E-03 AW137782.1 EST_HUMAN UI-H-BI1-adi-9-10-0-Ul.s1 NCI_CGAP_Sub3 Homo sapiens cDNAclone IMAGE:2717010 3' 3477 16517 29416 4.74 2.0E-03 AA450136.1 EST_HUMAN zx42a10.r1 Soares_total_fetus_Nb2HFs_9w Homo sapiens cDNA clone IMAGE:769114 5' 3484 16523 29422 0.84 2.0E-03 BF568955.1 EST_HUMAN 602183960T1 NIH_MGC_42 Homo sapiens cDNA clone IMAGE:4300070 3' H.sapiens DMA, DMB, HLA-Z1, IPP2, LMP2, TAP1, LMP7, TAP2, DOB, DQB2 and RING8, 9, 13 and 14 genes 4031 17058 29947 0.65 2.0E-03 AB040802.1 NT Rattus norvegicus mRNA for SREB1, complete cds 4207 17224 30091 3.03 2.0E-03 P03374 SWISSPROT ENV POLYPROTEIN [CONTAINS: COAT PROTEIN GP52; COAT PROTEIN GP 36] 4270 17286 30154 1.01 2.0E-03 AA179693.1 EST_HUMAN zp13h01.r1 Stratagene fetal retina 937202 Homo sapiens cDNA clone IMAGE:609361 5' 4317 17331 11.71 2.0E-03 U68491.1 NT Rattus norvegicus 5-hydroxytryptamine7 receptor gene, partial cds Page 189 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 4519 17528 1.9 2.0E-03 L35079.1 NT Porcine rotavirus major outer capsid protein (VP7) mRNA, complete cds 4534 17543 1.19 2.0E-03 AW297380.1 EST_HUMAN UI-H-BW0-air-g-03-0-Ul.s1 NCI_CGAP_Sub6 Homo sapiens cDNA clone IMAGE:2730413 3' 4539 17548 30409 1 2.0E-03 AI064746.1 EST_HUMAN HA0507 Human fetal liver cDNA library Homo sapiens cDNA 4662 17667 30535 1.95 2.0E-03 L42512.1 NT Drosophila melanogaster shortsighted class 2 (shs) mRNA, complete cds 4662 17667 30536 1.95 2.0E-03 L42512.1 NT Drosophila melanogaster shortsighted class 2 (shs) mRNA, complete cds Homo sapiens calcium channel alpha1E subunit (CACNA1E) gene, exons 7-49, and partial cds, alternatively 4819 17820 30689 1.25 2.0E-03 AF223391.1 NT spliced 4824 17825 1.47 2.0E-03 R87773.1 EST_HUMAN yo45e02.s1 Soares adult brain N2b4HB55Y Homo sapiens cDNA clone IMAGE:180890 3' Homo sapiens X-linked anhidroitic ectodermal dysplasia prctein gene (EDA), exon 2 and flanking repeat 5147 18142 30987 0.93 2.0E-03 AF003528.1 NT regions 5176 18168 31013 0.71 2.0E-03 P45969 SWISSPROT HYPOTHETICAL 37.4 KD PROTEIN T09A5.9 IN CHROMOSOME III 5271 18257 31108 0.94 2.0E-03 AF187974.1 NT 8 Homo sapiens concentrative nucleoside transporter (CNT1) gene, exon 12 5279 18265 0.71 2.0E-03 AJ245167.1 NT Camelus dromedarius cvhp 19 gene for immunoglobulin heavy chain variable region 5363 18345 1.09 2.0E-03 BE019692.1 EST_HUMAN bb28h05.x1 NIH_MGC_5 Homo sapiens cDNA clone IMAGE:2964249 3' 5675 18749 31660 1.19 2.0E-03 BF241410.1 EST_HUMAN 601876385F1 NIH_MGC_55 Homo sapiens cDNA clone IMAGE:4104692 5' 5822 25633 32007 2.21 2.0E-03 AB014593.1 NT Homo sapiens mRNA for KIAA0693 protein, partial cds 5909 18978 32095 0.49 2.0E-03 AW796111.1 EST_HUMAN MR2-UM0025-300300-102-f02 UM0025 Homo sapiens cDNA 5909 18978 32096 0.49 2.0E-03 AW796111.1 EST_HUMAN MR2-UM0025-300300-102-f02 UM0025 Homo sapiens cDNA 5910 18979 32097 1.89 2.0E-03 U63711.1 NT Xenopus laevis xefiltin mRNA, complete cds 6348 19398 32564 4.92 2.0E-03 P23477 SWISSPROT ATP-DEPENDENT NUCLEASE SUBUNIT B 6348 19398 32565 4.92 2.0E-03 P23477 SWISSPROT ATP-DEPENDENT NUCLEASE SUBUNIT B 6603 19644 32826 2.23 2.0E-03 Q95203 SWISSPROT CARBONIC ANHYDRASE-RELATED PROTEIN 2 PRECURSOR (CARP 2) (CA-RP II) (CA-XI) 6603 19644 32827 2.23 2.0E-03 Q95203 SWISSPROT CARBONIC ANHYDRASE-RELATED PROTEIN 2 PRECURSOR (CARP 2) (CA-RP II) (CA-XI) 6605 19646 32829 7.88 2.0E-03 BF308187.1 EST_HUMAN 601887434F1 NIH_MGC_17 Homo sapiens cDNA clone IMAGE:4121408 5' ADAM-TS 7 PRECURSOR (A DISINTEGRIN AND METALLOPROTEINASE WITH THROMBOSPONDIN 6645 19684 32875 2.64 2.0E-03 Q9UKP4 SWISSPROT MOTIFS 7) (ADAMTS-7) (ADAM-TS7) 6646 19685 32876 0.65 2.0E-03 AV709075.1 EST_HUMAN AV709075 ADC Homo sapiens cDNA clone ADCAEF09 5' 6681 19717 32917 1.22 2.0E-03 X94451.1 NT L.esculentum mRNA for lysyl-tRNA synthetase (LysRS) wu36h09.x1 Soares_Dieckgraefe_colon_NHCD Homo sapiens cDNA clone IMAGE:2522177 3' similar to 6888 19918 1.29 2.0E-03 AI991089.1 EST_HUMAN SW:RL29_HUMAN P47914 60S RIBOSOMAL PROTEIN L29; contains element MSR1 repetitive element ; 6929 19958 33179 0.68 2.0E-03 AA677831.1 EST_HUMAN zi13a11.s1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:430652 3' 7295 18464 31334 1.21 2.0E-03 AB038502.1 NT Caenorhabditis elegans mRNA for gelectin LEC-11, complete cds 7441 20183 33427 3.29 2.0E-03 BE067986.1 EST_HUMAN CM4-BT0366-061299-054-d01 BT0366 Homo sapiens cDNA Page 190 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 7504 20443 33726 0.7 2.0E-03 AI298883.1 EST_HUMAN qm99d11.x1 NCI_CGAP_Lu5 Homo sapiens cDNA clone IMAGE:1896885 3' 7673 20607 33906 0.74 2.0E-03 T86559.1 EST_HUMAN yd77g10.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:114306 5' 8063 20976 34291 1.55 2.0E-03 P07354 SWISSPROT PROTEOGLYCAN LINK PROTEIN PRECURSOR (CARTILAGE LINK PROTEIN)(LP) hf37b06.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2934035 3' similer to TR:O60976 8629 21560 34898 2.84 2.0E-03 AW592004.1 EST_HUMAN Q60976 JERKY.; yx42g06.s1 Soares melanocyle 2NbHM HOmo sapiens cDNA clone IMAGE:264442 3' similar to conteins 8796 21726 35074 5.05 2.0E-03 N20287.1 EST_HUMAN L1.b2 L1 repetitive element ; yx42g06.s1 Soares melanocyle 2NbHM HOmo sapiens cDNA clone IMAGE:264442 3' similar to conteins 8796 21726 35075 5.05 2.0E-03 N20287.1 EST_HUMAN L1.b2 L1 repetitive element ; 8840 21770 35116 0.54 2.0E-03 Q92350 SWISSPROT HYPOTHETICAL 32.8 KD PROTEIN C6G9.05 IN CHROMOSOME I 8863 21793 35145 1.29 2.0E-03 P19137 SWISSPROT LAMININ ALPHA-1 CHAIN PRECURSOR (LAMININ A CHAIN) 8915 21845 35199 0.83 2.0E-03 6005855 NT Homo sapiens Retina-derived POU-domain factor-1 (RPF-1), mRNA 8915 21845 35200 0.83 2.0E-03 6005855 NT Homo sapiens Retina-derived POU-domain factor-1 (RPF-1), mRNA 8938 21868 35226 1.03 2.0E-03 AU136679.1 EST_HUMAN AU136679 PLACE1 Homo sapiens cDNA clone PLACE1004839 5' Homo sapiens ASCL3 gene, CEGP1 gene, C11orf14 gene, C11orf15 gene, C11orf16 gene and C11orf17 8990 21919 0.96 2.0E-03 AJ400877.1 NT gene 9737 18978 32095 0.76 2.0E-03 AW796111.1 EST_HUMAN MR2-UM0025-300300-102-f02 UM0025 Homo sapiens cDNA 9737 18978 32096 0.76 2.0E-03 AW796111.1 EST_HUMAN MR2-UM0025-300300-102-f02 UM0025 Homo sapiens cDNA Homo sapiens mannosidase, beta A, lysosomal (MANBA) gene, and ubiquitin-conjugeting enzyme E2D 3 9782 22706 36090 0.9 2.0E-03 AF224669.1 NT (UBE2D3) genes, complete cds 10056 22972 36361 0.98 2.0E-03 H50832.1 EST_HUMAN yp86a09.s1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:194296 3' 10056 22972 36362 0.98 2.0E-03 H50832.1 EST_HUMAN yp86a09.s1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:194296 3' TENASCIN PRECURSOR (TN) (HEXABRACHION)(CYTOTACTIN)(NEURONECTIN)(GMEM)(JI) (MIOTENDINOUS ANTIGEN) (GLIOMA-ASSOCIATED-EXTRACELLULAR MATRIX ANTIGEN)(GP 150- 10087 22880 36266 3.48 2.0E-03 P24821 SWISSPROT 225)(TENASCIN-C)(TN-C) 10192 23083 36484 1.19 2.0E-03 P48982 SWISSPROT BETA-GALACTOSIDASE PRECURSOR (LACTASE) 10192 23083 36485 1.19 2.0E-03 P48982 SWISSPROT BETA-GALACTOSIDASE PRECURSOR (LACTASE) 10244 23135 36539 0.65 2.0E-03 AF097732.1 NT Homo sapiens caspase recrultiment domain-confaining protein (BCL 10) gene, complete cds 10244 23135 36540 0.65 2.0E-03 AF097732.1 NT Homo sapiens caspase recrultiment domain-confaining protein (BCL 10) gene, complete cds 10426 23315 36732 1.09 2.0E-03 AW88469.1 EST_HUMAN QV3-OT0064-060400-144-e01 OT0064 Homo sapiens cDNA 10545 23431 6.4 2.0E-03 AA251376.1 EST_HUMAN zs10a06.s1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE:684754 3' 11454 24370 2.49 2.0E-03 M86524.1 NT Human dystrophin gene 11920 20976 34291 2.33 2.0E-03 P07354 SWISSPROT PROTEOGLYCAN LINK PROTEIN PRECURSOR (CARTILAGE LINK PROTEIN)(LP) 11975 24818 2.4 2.0E-03 BF330909.1 EST_HUMAN RC3-BT0333-310800-115-g04 BT0333 Homo sapiens cDNA Page 191 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 11982 24825 38321 11.38 2.0E-03 Z11740.1 NT H.sapiens variable number tandem repeat (VNTR)Locus DNA typ65h03.x1 NCI_CGAP_Kid11 Homo saplens cDNA clone IMAGE:2283989 3' similar to SW:VAT_MANSE 12267 25084 3.38 2.0E-03 AI625745.1 EST_HUMAN Q25532 VACUOLAR ATP SYNTHASE SUBUNT G; 12283 25097 38573 4.23 2.0E-03 AF157516.2 NT Homo sapiens SEL1L (SEL1L) gene, partial cds oy43g06.s1 Soares_parathyriod_tumor_NbHPA Homo saplens cDNA clone IMAGE:1668634 3' similar to 12306 25113 38577 9.27 2.0E-03 AI085325.1 EST_HUMAN TR:P97585 P97535 PS-PLA1 PRECURSOR. ; 12328 18265 8.68 2.0E-03 AJ245157.1 NT Camelua dromedarius cvhp19 gene for immunoglobulin heavy chain variable region 12614 25913 2.26 2.0E-03 AV697966.1 EST_HUMAN AV697966 GKC Homo saplens cDNA colone GKCYXD05 5' Homo sapiens MSH55 gene, partial cds; and CLIC1, DDAH, G6b, G6c, G5b, G6d, G6e, G6f, BAT5, G5b, 12869 25471 1.62 2.0E-03 AF129756.1 NT CSK2B, BAT4, G4, Apo M, BAT3, BAT2, AIF-1, 1C7, LST-1, LTB, TNF, anD LTA genes, complete cds 13025 25743 4.22 2.0E-03 Av697966.1 EST_HUMAN Av697966 GKC Homo sapiens cDNA clone GKGCXD05 5' 462 13534 26454 1.21 1.0E-03 H96471.1 EST_HUMAN yt98c08.r1 Soares_pineal_gland_N3HPG Homo sapiens cDNA clone IMAGE:232334 5' as70b03.x1 Barstead colon HPLRB7 Homo sapiens cDNA clone IMAGe:2334039 3' similar to TR:Q13825 854 13908 26852 1.63 1.0E-03 AI720263.1 EST-HUMAN Q13825 AU-BINDING PROTEIN/ENOYL-COA HYDRATASE.; as70b08.x1 Barstead colon HPLRB7 Homo sapiens cDNA clone IMAGE:2334039 3' similar to TR:Q13825 854 13908 26853 1.63 1.0E-03 AI720263.1 EST_HUMAn Q13825 AU-BINDING PROTEIN/ENOYL-COA HYDRATASE.; 1122 14164 27101 1.99 1.0E-03 AI865788.1 EST_HUMAN wk86a06.x1 NCI_CGAP_Pan1 Homo sapiens cDNA clone IMAGE:2422258 3' 1142 14184 27122 1.76 1.0E-03 AI865788.1 EST_HUMAN wx93e10.x1 NCI_CGAP_Pan15 Homo sapiens cDNA clone IMAGE:2551242 3' wd66a01.x1 NCI_CGAP_Lu24 Horno sapiens cDNA clone IMAGE:2338440 3' similar to contains Alu 1193 14232 27171 1.87 1.0E-03 AI692616.1 EST_HUMAN repetitive element; 2041 15058 28059 2.6 1.0E-03 P47808 SWISSPROT HIGH MOLECULAR WEIGHT FORM OF MYOSIN I (HMWMI) 2168 15180 28186 5.51 1.0E-03 AJ131016.1 NT homo sapiens SCL gene locus 3021 16073 28975 1.46 1.0E-03 AB033117.1 NT Homo sapiens mRNA for KIAA1291 protein, partial cds CARBONIC ANHYDRASE VI PRECURSOR (CARBONATE DEHYDRATASE VI) (CA-VI) (SECRETED 3234 16282 29182 1.05 1.0E-03 P18915 SWISSPROT CARBONIC ANHYDRASE) (SALIVARY CARBONIC ANHYDRASE) CARBONIC ANHYDRASE VI PRECURSOR (CARBONATE DEHYDRATASE VI) (CA-VI) (SECRETED 3234 16283 29182 1.05 1.0E-03 P18915 SWISSPROT CARBONIC ANHYDRASE) (SALIVARY CARBONIC ANHYDRASE) 3345 16391 29291 0.88 1.0E-03 P08547 SWISSPROT LINE-1 REVERSE TRANSCRIPTASE HOMOLOG 3733 16765 1.72 1.0E-03 AB044400.1 NT Homo sapiens SVMT gene for syndaptic vesicle monoaine transporter, exos 14, 15 4010 17037 29927 0.74 1.0E-03 z49649.1 NT S. cerevisiae chromoscme X reading frame ORF YJR149w 4541 17550 30410 1.46 1.0E-03 BE939162.1 EST_HUMAN RC1-TN0128-160800-021-g01 TN0128 Homo sapiens cDNA TCBAP1D4909 Pediatric pre-B cell acule lymphoblastic leukemia Baylor-HGSC project=TCBA Homo 4589 17597 30455 5.87 1.0E-03 BE246536.1 EST_HUMAN sapiens cDNA clone TCBAP4909 Page 192 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 4775 17780 30650 0.73 1.0E-03 U29449.1 NT Caenorhabditis elegans spliced leader RNA (SL3 alpha), (SL4), and (SL5) genes 4937 17936 30793 2.53 1.0E-03 AI073485.1 EST_HUMAN ov45c04.x1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1640262 3' 4937 17936 30794 2.53 1.0E-03 AI073485.1 EST_HUMAN ov45c04.x1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1640262 3' 4936 17937 4.81 1.0E-03 BE154067.1 EST_HUMAN PM0-HT0339-200400-010-D02 HT0339 Homo sapiens cDNA 5211 18201 31045 21.62 1.0E-03 O46409 SWISSPROT APOLIPOPROTEIN A-IV PRECURSOR (APO-AIV) 5491 18571 31417 1.8 1.0E-03 AA290961.1 EST_HUMAN zs44f01.r1 NCI_GCB1 Homo sapiens cDNA clone IMAGE:700345 5' 5587 18664 31640 3.24 1.0E-03 AJ006345.1 NT Homo sapiens KVLQT1 gene 5641 18716 31617 2.09 1.0E-03 K03332.1 NT Epstein-Barr virus (AG876 Isolate) U2-IR2 domain encoding nuclear protein EBNA2, complete cds 5641 18716 31618 2.09 1.0E-03 K03332.1 NT Epstein-Barr virus (AG876 Isolate) U2-IR2 domain encoding nuclear protein EBNA2, complete cds 5764 18837 31940 0.9 1.0E-03 BE796491.1 EST_HUMAN 601589841F1 NIH_MGC_7 Homo sapiens cDNA clone IMAGE:3943954 5' 5770 18843 31945 1.63 1.0E-03 Q02388 SWISSPROT COLLAGEN ALPHA 1(VII) CHAIN PRECURSOR (LONG-CHAIN COLLAGEN) (LC COLLAGEN) yy07h06.r1 Soares melanocyte 2NbHM Homo sapiens cDNA clone IMAGE:270587 5' similar to contains 5829 18900 32014 0.66 1.0E-03 N41974.1 EST_HUMAN element MER6 repetitive element; yy07h06.r1 Soares melanocyte 2NbHM Homo sapiens cDNA clone IMAGE:270587 5' similar to contains 5829 18900 32015 0.66 1.0E-03 N41974.1 EST_HUMAN element MER6 repetitive element; 6110 19170 32302 0.51 1.0E-03 AA773352.1 EST_HUMAN ab65g12.s1 Stratagene lung carcinoma 937218 Homo sapiens cDNA clone IMAGE:845734 3' 6133 19192 0.45 1.0E-03 BF541639.1 EST_HUMAn 602068042F1 NIH_MGC_58 Homo sapiens cDNA clone IMAGE:4066907 5' 6253 19306 3.24 1.0E-03 X07699.1 NT Mouse nucleolin gene 6294 19345 3251 1.06 1.0E-03 BE963939.2 EST_HUMAN 601657519R1 NIH_MGC_68 Homo sapiens cDNA clone IMAGE:3875693 3' 6433 19480 8.63 1.0E-03 11526176 NT Homo sapiens T-cell lymphoma invasion and metastasis 1 (TIAM1), mRNA 6591 19632 32814 1.11 1.0E-03 T87761.1 EST_HUMAN yd93a11.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:115772 5' 6674 19711 1.56 1.0E-03 AW902585.1 EST_HUMAN QV3-NN1024-260400-171-g05 NN1024 Homo sapiens cDNA 7060 20085 33318 1.5 1.0E-03 L77570.1 NT Homo sapiens DiGeorge syndrome critical region, centromeric end 7513 20452 33737 2.47 1.0E-03 D16826.1 NT Human gene for fourth somatostatin receptor subtype 7907 20832 2.62 1.0E-03 AJ229042.1 NT Homo saplens 959 kb contig between AML1 and CBR1 on chromsome 21q22, segment 2/3 Homo sapiens X28 region near ALD locus containing dual specificity phosphatase 9 (DUSP9), ribosomal Protein L18a (RPL18a), Ca2+/Calmodulin-dependent protein kinase I (CAMKI), creatine transporter (CRTR), 8088 21000 34322 1.82 1.0E-03 U52111.2 NT CDM protein (CDM), adrenodlaukodystromphy protein > 8167 21074 34404 3.28 1.0E-03 M63376.1 NT Human TRPM-2 protein gene, exons 1,2 and 3 8224 21129 34460 0.86 1.0E-03 BE880044.1 EST_HUMAn 601491081F1 NIH_MGC_69 Homo sapiens cDNA clone IMAGE:3893276 5' 8469 21400 34740 0.77 1.0E-03 AF274581.1 NT Homo sapiens prolactin-releasing peptide receptor gene, 5' flanking region 8528 21459 34802 5.56 1.0E-03 AJ251973.1 NT Homo sapiens partial steerin-1 gene zk97c09.s1 Soares_pregnat_uterus_NbHPU Homo sapiens cDNA clone IMAGE:490768 3' similar to 8722 21652 34999 0.87 1.0E-03 AA122270.1 EST_HUMAn contains L1.t1 L1 repetitive element; Page 193 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 8999 21928 35283 0.89 1.0E-03 U29397.1 NT Rattus norvegicus plasma membrane Ca2+ ATP ase isoform 3 (PMCA3) gene, 6' flanking region 9156 22084 35442 0.61 1.0E-03 AA001613.1 EST_HUMAn zh82e06.s1 Soares_felal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:427810 3' 9156 22084 35443 0.61 1.0E-03 AA001613.1 EST_HUMAn zh82e06.s1 Soares_felal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:427810 3' 8487 22425 1.62 1.0E-03 Y11204.1 NT V.carterl gene encoding volvoxcpein 9522 22449 35812 0.64 1.0E-03 AW840353.1 EST_HUMAN CM3-LT0079-170200-92-E07 LT0079 Homo saplens cDNA Homo saplens X28 region near ALD locus containing dual specificity phosphatase 9 (DUSP9), ribosomal protein L18a (RPL18a), Ca2+/Calmodulin-dependent protein kinase I (CAMKI), creatine transporter (CRTR), 9626 22552 0.68 1.0E-03 U52111.2 NT CDM protein (CDM), adreoleukodystrophy protein > 9663 22589 35961 3.11 1.0E-03 M30471.1 NT Human class III alcohol dehydrogenase (ADH5) chl subunit mRNA, complete cds 9663 22589 35962 3.11 1.0E-03 M30471.1 NT Human class III alcohol dehydrogenase (ADH5) chl subunit mRNA, complete cds 10134 23025 36420 1.98 1.0E-03 AF011400.1 NT Thermologa neapolilana alpha-1,6-galactosidase (agIA) gene, complete cds 10134 23025 36421 1.98 1.0E-03 AF011400.1 NT Thermologa neapolilana alpha-1,6-galactosidase (agIA) gene, complete cds BONE PROTEOGLYCAN II PRECURSOR (PG-S2) (DECORIN) (PG40) (DERMATAN SULFATE 10335 23224 36639 0.98 1.0E-03 Q01129 SWISSPROT PROTEOGLYCAN-II) (DSPG) 10659 23545 36969 0.64 1.0E-03 AF003529.1 NT Homo sapiens glypican 3 (GPC3) gene, partial cds and flanking repeat regions 10665 23551 0.79 1.0E-03 AF097485.1 NT Homo sapiens transducin beta-like 2(TBL2) gene, complete cds ov75f08.x1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1643175 3' similar to contains MER39.b1 10805 23691 37119 1 1.0E-03 AI024350.1 EST_HUMAN MER39 MER39 repetitive element; 11109 24040 37484 1.86 1.0E-03 AW362393.1 EST_HUMAN RC1-CT0279-181099-011-a09 CT0279 Homo sapiens cDNA 11109 24040 37485 1.86 1.0E-03 AW362393.1 EST_HUMAN RC1-CT0279-181099-011-a09 CT0279 Homo sapiens cDNA 11191 24117 37564 3.01 1.0E-03 BE170859.1 EST_HUMAN QV3-HT0543-220300-130-a03 HT0543 Homo sapiens cDNA tt73e12.x1 NCI_CGAP_HSC3 Homo sapiens cDNA clone IMAGE:2246446 3' simllar to TR:Q26195 Q26195 11262 24185 2.91 1.0E-03 AI583847.1 EST_HUMAN PVA1 GENE.; 11330 24249 37687 1.44 1.0E-03 AW237482.1 EST_HUMAN xm72d12.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2689751 3' 11597 24506 3.18 1.0E-03 AV759949.1 EST_HUMAN AV759949 MDS Homo sapiens cDNA clone MDSDDF11 5' 12262 25080 38571 3.88 1.0E-03 BE894488.1 EST_HUMAN 601433087F1 NIH_MGC_72 Homo sapiens cDNA clone IMAGE:3918524 5' tc05h11x1 NCI_CGAP_Co16 Homo sapiens cDNA clone IMAGE:2063013 3'aimilar to contains Alu 12707 25895 5.42 1.0E-03 AI347355.1 EST_HUMAN repeffitive element; 12805 25915 31369 4.03 1.0E-03 BE780572.1 EST_HUMAn 601468878F1 NIH_MGC_67 Homo sapiens cDNA clone IMAGE:3872035 5' 5342 18325 31174 2.04 9.0E-04 L11910.1 NT Human retinoblastoma susceptibility gene exons 1-27, complete cds 5389 18371 31210 1.33 9.0E-04 P08548 SWISSPROT LINE-1 REVERSE TRANSCRIPTASE HOMOLOG 5879 18948 1.82 9.0E-04 P06727 SWISSPROT APOLIPOPROTEIN A-IV PRECURSOR (APO-AIV) 6508 19552 0.7 9.0E-04 AJ006345.1 NT Homo sapiens KVLQT1 gene 6761 19795 33009 1.11 9.0E-04 P02381 SWISSPROT MITOCHONDRIAL RIBOSOMAL PROTEIN VAR1 Page 194 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 10169 23060 1.57 9.0E-04 AB037203.1 NT glycrrhiza glabra GgbAS1 mRNA for beta-amyrin synthase, complete cds 1506 14537 1.07 8.0E-04 X96469.1 NT X.laevis mRNA for C4SR protein 3993 17020 29910 0.65 8.0E-04 R07008.1 EST_HUMAn yf12h10.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:126691 5' 4276 17290 5.2 8.0E-04 P08547 SWISSPROT LINE-1 FEVERSE TRANSCRIPTASE HOMOLOG 4878 17877 30743 3.2 8.0E-04 U29185.1 NT Homo sapiens Prion protein (PrP) gene, compiete cds 11586 24495 2.53 8.0E-04 AA777084.1 EST_HUMAn zf24c10.s1 Soares_fetal_heart_NbHH19W Homo sapiens cDNA clone IMAGE:377874 3' 11742 24644 2.4 8.0E-04 AI671099.1 EST_HUMAn tn85a08.x1 NCI_CGAP_Ut2 Homo sapiens cDNA 1851 14873 27855 1.24 7.0E-04 L41825.1 NT Homo sapiens CYP17 gene, 5' end 2421 15425 28426 .93 7.0E-04 U29185.1 NT Homo sapiens prion protein (prP) gene, complete cds 2763 15755 28750 1.18 7.0E-04 AL163210.2 NT Homo sapiens chromosome 21 segment HS21C010 3324 16370 29271 1.05 7.0E-04 4885170 NT Homo sapiens chromosome X Dpen reding frame 6 (CXORF6) mRNA ng65g12.s1 NCI_CGAP_Lip2 Homo sapiens cDNA clone IMAGE:939718 similar to contains L1.b3L1L1 6333 19383 32551 0.73 7.0E-04 AA516212.1 EST_HUMAN repetitive element; qq08h05.x1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:1931961 3' similar to gb:X57025_ma1 INSULIN-LIKE GROWTHFACTOR IA PRECURSOR (HUMAN); contains Alu repetititve element;contains 6549 19591 32778 0.47 7.0E-04 AI333675.1 EST_HUMAN element MIR repetititve element; 6791 19824 2.27 7.0E-04 AI769331.1 EST_HUMAN wg36f09.x1 Soares_NSF_F8_9W_OT_PA_P_S1 Homo sapiens cDNA clone IMAGE:2367209 3' 7597 20533 0.8 7.0E-04 AK024445.1 NT Homo sapiens mRNA for FLJ00035 protein, partial cds 10320 23209 36620 0.65 7.0E-04 P13497 SWISSPROT BONE MORPHOGENETIC PROTEIN 1 PRECURSOR (BMP-1) 10320 23209 36621 0.65 7.0E-04 P13497 SWISSPROT BONE MORPHOGENETIC PROTEIN 1 PRECURSOR (BMP-1) Homo saplens Bruton's tyrosine kinase (BTK), alpa-D-gatactosidase A (GLA), L44-like ribosomal protein 11998 24840 2.33 7.0E-04 U7827.1 NT (L44L) and FTP (FTP3) genes, complete cds 12023 24865 38366 2.84 7.0E-04 Z40561.1 EST_HUMAN HSC28A072 normalized infan brain cDNA Homo sapiens cDNA clone c-28a07 3' 12746 25385 14.51 7.0E-04 BE077941.1 EST_HUMAN CM1-BT0614-110300-142-b12 BT0614 Homo sapiens cDNA 12963 25521 4.19 7.0E-04 R17336.1 EST_HUMAN yg13c06.r1 Soares infant brain 1NIB Homo sapiens cDNA clone IMAGE:32298 5' 12990 25546 4.96 7.0E-04 6005855 NT Homo sapiens Retina-derived POU_doain factor-1 (RPF-1), mRNA 2746 15738 0.96 6.0E-04 BF341360.1 EST_HUMAN 6202013339F1 NCI_CGAP_Brn 84 Homo sapiens cDNA clone IMAGE:4149297 5' 4044 17071 29957 1.77 6.0E-04 AI862525.1 EST_HUMAN wj15a11.x1 NCI_CGAP_Kid12 Homo sapiens cDNA clone IMAGE:2402876 3' 4281 17295 30161 4.06 6.0E-04 U45983.1 NT Homo sapiens CCR8 chemokine receptor (CMKBR8) gene, complete cds 4552 17561 30420 1.54 6.0E-04 BE173435.1 EST_HUMAN RC2-HT0560-190200-011-f09 HT0560 Homo sapiens cDNA 4552 17561 30421 1.54 6.0E-04 BE173435.1 EST_HUMAN RC2-HT0560-190200-011-f09 HT0560 Homo sapiens cDNA 5391 18373 31213 1.08 6.0E-04 P12259 SWISSPROT COAGULATION FACTOR V PRECURSOR (ACTIVATED PROTEIN C COFACTOR) 5391 18373 31214 1.08 6.0E-04 P12259 SWISSPROT COAGULATION FACTOR V PRECURSOR (ACTIVATED PROTEIN C COFACTOR) 8447 21379 3.72 6.0E-04 P46408 SWISSPROT GLUCOSE TRANSPRORTER TYPE 5, SMALL INTESTINE (FRUCTOSE TRANSPORTER) Page 195 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value yt94c11.s1 Soares_pineal_gland_N3HPG Homo sapiens cDNA clone IMAGE:231956 3' similar to contains 8594 21525 0.67 6.0E-04 H92947.1 EST_HUMAN LOR1 repetitive element; 10486 23374 4.07 6.0E-04 AL048507.2 EST_HUMAN DKFZp586M2024_r1 586 (synonym: uule1) Homo sapiens cDNA clone DKFZp586M2024 10582 23468 36894 2.41 6.0E-04 BF005850.1 EST_HUMAN RC2-BN0120-250400-012-h11 BN0120 Homo sapiens cDNA Lytechinus vasriegatus embryonic blastocoelar extraoellular matrix protein preursor (ECM3) mRNA, complete 10827 23713 0.65 6.0E-04 AF287478.1 NT cds 11916 24763 38260 2.68 6.0E-04 AJ229042.1 NT Homo sapiens 959 kb conig between AML1 end CBR1 on chromosome 21q22, segment 2/3 11999 24841 38337 4.62 6.0E-04 AW013847.1 EST_HUMan HI-H-BI0-aab-e-09-0-UI.s1 NCI_CGAP_Sub1 Homo sapiens cDNA clone IMAGE:2708825 3' 12064 24905 2.18 6.0E-04 Q01768 SWISSPROT HUCLEOSIDE DIPHOSPATE KINASE B (NDK B) (NDP KINASE B) (NMK23-M2) (P18) 12429 25810 3.04 6.0E-04 AW380519.1 EST_HUMAN RC1-HT-0269-261199-012-d08 HT0269 Homo sapiens cDNA 674 13736 26648 5.41 5.0e-04 o1041 SWISSPROT HYPOTHETICAL 29.3 KD PROTEIN (ORF92) 1521 4552 1.6 5.0E-04 AW651844.1 EST_HUMAN QV0-CT0225-0121099-030-a07 CT0225 Homo sapiens cDNA nk27e11.s1 NCI_CGAP_Co11 Homo sapiens cDNA clone IMAGE:1014764 3' similar to contains Alu 3474 16514 29413 1.67 5.0E-04 AA548931.1 EST_HUMAn repetitive element; ADAM-TS 7 PRECURSOR (A DISINTEGRIN AND METALLOPROTEINASE WITH THROMBOSPONDIN 3779 16810 29697 0.92 5.0E-04 Q9UKP4 SWISSPROT MOTIFS 7) (ADAMTS-7) (ADAM-TS7) 5660 18734 31641 2.62 5.0E-04 AF248054.1 NT Bos teurus micromolar calcium activated naurtral protease 1 (CAPN1) gene, exons 11-20, and partial cds 61919 19949 33170 5.5 5.0E-04 AA156-80.1 EST_HUMAn z033b08.r1 Stratagene colon (#937204) Homo sapiens cDNA clone IMAGE:588663 5' 7769 20699 33999 13.69 5.0E-04 M23604.1 NT Gorilla gorilla involucrin gene medium allele, complete cds qd13f06.x1 Soares_placenta_8to9weeks_2NbHP8to9W Homo sapiens cDNA clone IMAGE:1723619 3' similar to gb:X51602_cds1 VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 1 8534 21465 34806 5.87 5.0E-04 AI188382.1 EST_HUMAn (HUMAN); contains Alu repetitive element; ob96e02.s1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE;1339226 3' aimilar to contains element 8878 21808 35161 0.83 5.0E-04 AA814519.1 EST_HUMAN MER22 repetitive element; 9817 22723 36106 2.14 5.0E-04 5.0E-04 AA846545.1 EST_HUMAn gj56h03.s1 Soares_Testis_NHT Homo sapiens cDNA clone IMAGE:1394357 3' KK2745F Human fetal Heart, Lambda ZAP Express Homo sapiens cDNA clone KK2745 5' similar to 9910 22898 36285 0.69 5.0E-04 N83765.1 EST_HUMAn REPETITIVE ELEMENT 10136 23027 36424 4.44 5.0E-04 AW270938.1 EST_HUMAN xs06e02.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2768858 3' 10770 23656 0.63 5.0E-04 U50871.1 NT Human familial Alzheimer's disease (STM2) gene, complete cds 11413 24329 2.25 5.0E-04 AL048507.2 EST_HUMAN DKFzp586M2024_r1 586 (synonym: hute1) Homo sapiens cDNA clone DKFZp586M2024 12135 18734 31641 14.44 5.0E-04 AF248054.1 NT Bost taurus micromotar calcium etivated neutral protease 1 (CAPN1) gene, exons 11-20, and partial cds 12375 25751 2.07 5.0E-04 AA568513.1 EST_HUMAN nf15h02.s1 NCI_CGAP_Pr1 Homo sapiens cDNA clone IMAGE:913875 Page 196 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 413 13486 1.71 4.0E-04 BF241482.1 EST_HUMAN 601876534F1 NIH_MGC_55 Homo sapiens cDNA clone IMAGE:4104897 5' 696 13756 26673 1.2 4.0E-04 U32748.1 NT Haemophilus influenzae Rd section 63 of 163 of the complete genome as70b08.x1 Barstead colon HPLRB7 Homo sapiens cDNA clone IMAGE:2334039 3'similar to TR:Q13825 872 13925 26872 1.23 4.0E-04 AI720263.1 EST_HUMAN Q13825 AU-BINIDING PROTEIN/ENOYL-COA HYDRATASE.; as70b08.x1 Barstead colon HPLRB7 Homo sapiens cDNA clone IMAGE:2334039 3' similar to TR:Q13825 872 13925 26873 1.23 4.0E-04 AI720263.1 EST_HUMAN Q13825 AU-BINDING PROTEIN/ENOYL-COA HYDRATASE.; 1484 14515 27476 3.44 4.0E-04 AW753356.1 EST_HUMAN RC3-CT0254-130100-023-f01 CT0254 Homo sapiens cDNA 2096 15110 28114 1.23 4.0E-04 AL163278.2 NT Homo sapiens chromosome 21 segment HS21C078 2147 15160 1.23 4.0E-04 AL046704.1 EST_HUMAN DKFZp434D059_r1 434 (synonym: htes3) Homo sapiens cDNA clone DKFZp434D059 5' 2673 15669 28668 2.06 4.0E-04 O96615 SWISSPROT SERICIN-2 (SILK GUM PROTEIN 2) 3414 16456 29362 0.92 4.0E-04 AV696624.1 EST_HUMAN AV696624 GKC Homo saplens cDNA clone GKCFFH07 5' 3936 16964 1.13 4.0E-04 AL163267.2 NT Homo sapiens chromosome 21 segment HS21C067 nh10a10.@1 NCI_CGAP_Co1 Homo eaplene cDNA clone IMAGE:951930 3' oimilor to gb:M21121 T-CELL 4429 17440 30299 4.02 4.0E-04 AA576331.1 EST_HUMAN SPECIFIC RANTES PROTEIN PRECURSOR (HUMAN); nh10a10.s1 NCI_CGAP_Co1 Homo saplens cDNA clone IMAGE:951930 3' similar to gb:M21121 T-CELL 4429 17440 30300 4.02 4.0E-04 AA576331.1 EST_HUMAN SPECIFIC RANTES PROTEIN PRECURSOR (HUMAN); 4653 17659 30526 1.11 4.0E-04 AA086324.1 EST_HUMAN zn61c08.s1 Stratagene muscie 93720g Homo sapiens cDNA clone IMAGE:562670 3' 5222 18211 31057 3.87 4.0E-04 BE560660.1 EST_HUMAN 601345895F1 NIH_MGC_8 Homo sapiens cDNA clone IMAGE:3678910 5' 5309 18293 0.66 4.0E-04 BE178680.1 EST_HUMAN PM4-HT0506-030400-001-H11 HT0606 Homo saplens cDNA EXTRACELLULAR CALCIUM-SENSING RECEPTOR PRECURSOR (CASR) (PARATHYROID CELL 7644 20579 33874 1.25 4.0E-04 P48442 SWISSPROT CALCIUM-SENSING RECEPTOR) 7962 20884 4.7 4.0E-04 AL161566.2 NT Arabidopsis thallana DNA chromosome 4. contig fragment No. 66 8179 21086 34420 0.71 4.0E-04 AU122079.1 EST_HUMAN AU1222079 MAMMA1 Homo saplens cDNA clone MAMMA1001620 5' 9100 22029 35384 1.02 4.0E-04 BF2407121 EST_HUMAN 601875985F1 NIH_MGC_55 Homo saplens cDNA clone IMAGE:4099700 5' 9108 22036 35390 2.15 4.0E-04 N25507.1 EST_HUMAN yx39e12.r1 Soares melanceyte 2NbHM Homo sapiens cDNA clone IMAGE:264142 5' 10214 23105 36505 3.89 4.0E-04 AI025699.1 EST_HUMAN ov87h03.s1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1644341 3' 10355 23244 0.71 4.0E-04 AF022855.1 NT Mus mueculus neuropilin-2(a17) mRNA, alternatively spliced, complete cde 12716 25729 2.21 4.0E-04 AF2548221 NT Homo saplens SMARCA4 isoform (SMARCA4) gene, complete cds, alternatively spliced 166 13267 26184 3.52 3.0E-04 AL119426.1 EST_HUMAN DKFZp761J221_r1 761 (synonym: hamy2) Homo sapiens cDNA clone DKFZp761J221 5' 208 13307 26224 6.78 3.0E-04 P49259 SWISSPROT 180 KD SECRETORY PHOSPHOLIPASE A2 RECEPTOR PRECURSOR (PLA2-R) 905 13957 26905 1.67 3.0E-04 U83991.1 NT Humen chort chain acyl CoA dehydrogenase gene, exons 1 and 2 1863 14885 27865 1.36 3.0E-04 AI262100.1 EST_HUMAN qz28d03.y1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2028197 5' 1878 14899 0.91 3.0E-04 AI99674.1 EST_HUMAN th23a02.x1 NCI_CGAP_Pr28 Homo saplens cDNA clone IMAGE:2119082. 3' 3354 16399 29299 5.56 3.0E-04 P25147 SWISSPROT INTERNALIN B PRECURSOR Page 197 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 4047 17074 29960 3.18 3.0E-04 P49448 SWISSPROT GLUTAMATE DEHYDROGENASE 2 PRECURSOR (GDH) 4141 17162 1.67 3.0E-04 AJ271735.1 NT Homo saplens Xq pseudoautosomal region; segment 1/2 4182 17202 1.41 3.0E-04 BE140609.1 EST_HUMAN RC0-HT0014-310599-028 HT0014 Homo sapiens cDNA 4930 17929 6.87 3.0E-04 BE153778.1 EST_HUMAN PM0-HT0339-90200-007-g12 HT0339 Homo sapiens cDNA 4992 17991 30848 0.77 3.0E-04 AW937723.1 EST_HUMAN QV3-DT0045-221299-046-d09 DT0045 Homo sapiens cDNA 6383 19432 5.49 3.0E-04 AL163281.2 NT Homo saplens chromosome 21 segment HS21C081 7132 20240 33490 3.75 3.0E-04 AL163278.2 NT Homo sapiens chromosome 21 segment HS21C078 7331 18499 31275 0.62 3.0E-04 AW893981.1 EST HUMAN RC4-NN0027-060400-011-b08 NN0027 Homo saplens cDNA 8031 20947 34264 0.86 3.0E-04 P23468 SWISSPROT PROTEIN-TYPOSINE PHOSPHATASE DELTA PRECURSOR (R-PTP-DELTA) 8836 21766 35112 4.88 3.0E-04 P22607 SWISSPROT FIBROBLAST GROWTH FACTOR RECEPTOR 3 PRECURSOR (FGFR-3) zx48d08.r1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:795471 5' similar to gb:M62762 10431 23320 36737 1.19 3.0E-04 AA454055.1 EST_HUMAN VACUOLAR ATP SYNTHASE 16 KD PROTEOLIPID SUBUNIT (HUMAN); 10674 23560 36992 0.76 3.0E-04 AI992139.1 EST_HUMAN wt75a11.x1 Soares_thymus_NHFTh Homo sapiens cDNA clone IMAGE:2513276 3' aj24g05.e1 Soarec_taetie_NHT Homo eaplene cDNA clone 1391288 3' eimilar to gb:M36072 60S 10938 23823 37250 3.8 3.0E-04 AA781201.1 EST_HUMAN RIBOSOMAL PROTEIN L7A (HUMAN); nc38e04.r1 NCI_CGAP_Pr2 Homo saplens cDNA clone IMAGE:1010430 similar to contains L1.t2 L1 12332 25934 31372 4.37 3.0E-04 AA228301.1 EST_HUMAN repetitive element ; 12674 -25791 31578 2.8 3.0E-04 AB018292.1 NT Homo sapiens mRNA for KIAA0749 protein, partial cds 13041 25577 2.71 3.0E-04 AL134483.1 EST_HUMAN DKFZp547L185_r1 547 (synonym: hfbr1) Homo saplens cDNA clone DKFZp547L185 5' Homo sapiens SCG10 like-protein, helicase-like protein NHL, M68, and ADP-ribosylation factor related 186 13285 26201 1.65 2.0E-04 NT protein 1 (ARFRP1) genes, complete cds 501 13571 26489 2.25 2.0E-04 AU146707.1 EST_HUMAN AU146707 HEMBB1 Homo sapiens cDNA clone HEMBB1001253 3' 932 13984 26929 8.04 2.0E-04 M86524.1 NT Human dystrophin gene 932 13984 26930 8.04 2.0E-04 M86624.1 NT Human dystrophin gene qh98e11.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:1855052 3' similar to contains 1207 14246 3.43 2.0E-04 AI288021.1 EST_HUMAN MER3.b2 MER3 repetitive element ; 1214 14252 1.51 2.0E-04 AL163203.2 NT Homo sapiens chromosome 21 segment HS21C003 1856 14878 1.22 2.0E-04 AF224268.1 NT Mus musculus 5' flanking region of Pitx3 gene zu39b05.s1 Scares ovary tumor NbHOT Homo sapiens cDNA clone IMAGE:740337 3'similar to contains A/u 2199 15210 0.98 2.0E-04 AA478980.1 EST_HUMAN repetitive element; Human germline T-cell receptor beta chaln TCRBV17S1A1T, TCRBV2S1, TCRBV10S1P, TCRBV29S1P, TCRBV19S1P, TCRBV15S1, TCRBV11S1A1T, HVB relic, TCRBV28S1P, TCRBV34S1, TCRBV14S1, 2611 15609 28604 6.18 2.0E-04 U66061.1 NT TCRBV3S1, TCRBV4S1A1T, TRY4, TRY5, TRY6, TRY7, TRY8, TCRBD1, TCRBJ1S1, TCRBJ1S2,> Page 198 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 3029 16081 28982 0.98 2.0E-04 AI124529.1 EST__HUMAN am58c09.x1 Johnston frontal cortex Homo sapiens cDNA clone IMAGE:1539760 3' 3382 16425 29329 1.02 2.0E-04 5174736 NT Homo saplens tubulin, beta, 4 (TUBB4) mRNA 3497 16536 29434 3.47 2.0E-04 BE082317.1 EST_HUMAN QV2-BT0636-070500-194-b07 BT0636 Homo sapiens cDNA 3524 16562 29466 1.65 2.0E-04 U34374.1 NT Human tyrosine kinase TXK (txk) gene, exons 9 and 10 3986 17013 29902 0.75 2.0E-04 AW978441.1 EST_HUMAN EST390550 MAGE resequences, MAGP Homo saplens cdNA 4241 17257 7.68 2.0E-04 U01029.1 NT Phaseolus vulgaris nitrate reductase (PVNR2) gene, complete cds 4780 17785 30655 1.65 2.0E-04 H96265.1 EST_HUMAN yu01e11.r1 Soares_pineal_gland_N3HPG Homo sapiens cDNA clone IMAGE:232556 5' 4780 17785 30656 1.65 2.0E-04 H96265.1 EST_HUMAN yu01ei1.r1 Soares_pineal_gland_N3HPG Homo sapiens cDNA clone IMAGE:232556 5' 4911 19710 1.82 2.0E-04 U09226.1 NT Galius gallus proteasome 28 kDa subunit homolog mRNA, complete cds 5194 18186 31028 1.77 2.0E-04 AB037997.1 NT Danio rerio hagoromo gene, exons 1 to 6, partial cds 5247 18234 31084 1.03 2.0E-04 AF057019.1 NT Dlctyostelium discoideum interaptin (abpD) gene, complete cds 5302 18286 31138 1 2.0E-04 7262289 NT Homo sapiens ARP3 (actin-related protein 3, yeast) homolog (ACTR3), mRNA 5302 18296 31139 1 2.0E-04 7262289 NT Homo sapiens ARP3 (actin-related protein 3, yeast) homolog (ACTR3), mRNA 5735 18806 31902 2.43 2.0E-04 AV654352.1 EST_HUMAN AV654352 GLC Homo sapiens cDNA clone GLCDUH10 3' 5748 18821 31918 1.76 2.0E-04 AI690862.1 EST_HUMAN tq03b11.x1 NCI_CGAP_Ut3 Homo saplens cDNA clone IMAGE:2207709 3' 5956 19023 32143 0.96 2.0E-04 AA296652.1 EST_HUMAN EST11191 Uterus Homo saplens cDNA 5' end similar to EST containing O family repeat 6172 19229 32375 0.78 2.0E-04 4758179 NT Homo sapiens cell cycle progression 3 protein (DNJ3) mRNA 6486 19531 32709 1.63 2.0E-04 AF140708.1 NT Mus musculus G protein coupled receptor gene, complete cds; and unknown gene 7599 20535 2.37 2.0E-04 AU121712.1 EST_HUMAN AU121712 MAMMA1 Homo sapiens cDNA clone MAMMA1000798 5' 7709 20641 0.74 2.0E-04 AW860963.1 EST_HUMAN QV0-CT0387-180300-167-e10 CT0387 Homo saplens cDNA 8068 20981 13.86 2.0E-04 P08548 SWISSPROT LINE-1 REVERSE TRANSCRIPTASE HOMOLOG MYOMESIN 2 (M-PROTEIN) (165 KD TITIN-ASSOCIATED PROTEIN) (165 KD CONNECTIN- 8087 20990 34306 1.11 2.0E-04 P54296 SWISSPROT ASSOCIATED PROTEIn) 8533 21464 24804 0.96 2.0E-04 U32444.2 NT Solanum lycopersioum phytochrome F (PHYF) gene, pertial cds 8533 21464 34805 0.96 2.0E-04 U32444.2 NT Solanum lycoperslcum phytochrome F (PHYF) gene, partial cds Homo sapiens DNA, DLEC1 to ORCTL4 gene region, section 1/2 (DLEC1, ORCTL3, ORCTL4 genes, 8861 21791 35142 1.31 2.0E-04 AB026898.1 NT complete cds) Homo sapiens DNA, DLEC1 to ORCTL4 gene region, section 1/2 (DLEC1, ORCTL3, ORCTL4 genes, 8861 21791 35143 1.31 2.0E-04 AB026898.1 NT complete cds) 9128 22056 35416 2.26 2.0E-04 AF020503.1 NT Homo sapiens FRA3B common fragile region, diadenosine triphosphate hydrolase (FHIT) gene, exon 5 9302 22230 35590 0.52 2.0E-04 X57331.1 NT Human immunoglobulin C(mu) and C(delta) heavy chain genes (constant regions) 9953 22858 36246 0.58 2.0E-04 P18715 SWISSPROT GASTRULA ZINC FINGER PROTEIN XLCGF26.1 10481 23369 36781 0.97 2.0E-04 BE149303.1 EST_HUMAN RC3-HT0254-151099-011-b05 HT0254 Homo sapiens cDNA Page 199 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 10520 23407 36819 2.06 2.0E-04 AA405777.1 EST_HUMAN zu66c11.r1 Scares_testis_NHT Homo sapiens cDNA clone IMAGE:742964 5' 11286 24207 37657 3.82 2.0E-04 AV730373.1 EST_HUMAN AV730373 HTF Homo sapiens cDNA clone HTFAAA01 5' 11618 24525 2.47 2.0E-04 AJ243213.1 NT Homo sapiens partial 5-HT4 recaptor gene, exone 2 to 5 tj01f11.x1 NCI_CGAP_Gas4 Homo sapiens cDNA clone IMAGE:2140269 3' similar to contains Alu repetitive 11750 24651 38132 3.46 2.0E-04 AI440282.1 EST_HUMAN element; 11858 24748 38240 2.82 2.0E-04 AW136740.1 EST_HUMAN UI-BI1-adm-c-04-0-UI.s1 NCI_CGAP_Sub3 Homo sapiens cDNA clone IMAGE:2717190 3' 13088 25948 130.57 2.0E-04 D87675.1 NT Homo sapiens DNA for amyloid precuraor protein, complete ods yx26c09.s1 Soarea melanocyte 2NbHM Homo saplens cDNA clone IMAGE:262864 3' similar to contains 793 13848 26782 2.47 1.0E-04 H99646.1 EST_HUMAN L1.t1 L1 repetitive element ; RETROVIRUS-RELATED POLPOLYPROTEIN [CONTAINS: REVERSE TRANSCRIPTASE ; 1102 14145 27083 2.17 1.0E-04 P11369 SWISSPROT ENDONUCLEASE] 1141 14188 27120 3.59 1.0E-04 AW013847.1 EST_HUMAN UI-H-BI0-aab-e-09-0-UI.s1 NCI_CGAP_Sub1 Homo saplens cDNA clone IMAGE:2708825 3' 1141 14183 27121 3.59 1.0E-04 AW013847.1 EST_HUMAN UI-H-BI0-aab-e-09-0-UI.s1 NCI_CGAP_Sub1 Homo sapiens cDNA clone IMAGE:2708825 3' 1360 14391 2.89 1.0E-04 U62918.1 NT Anguilla anguilla dopamine D1A1 receptor (d1A1) gene, complete cds Kaposi's sarcoma-associated herpesvirus ORF 68 gene, partial cds; and ORF 69, kaposin, v-FLIP, v-cyclin, latent nuclear antigen, ORF K14, v-GPCR, putative phosphcribosylformylglyclnamidine synthase, and LAMP 1651 14682 27644 2.56 1.0E-04 AF148805.1 NT (LAMP) genes, complete cds Kaposi's sarcoma-associated herpesvirus ORF 68 gene, partial cde; and ORF 69, kaposin, v_FLIP, v-cyclin, latent nuclear antigen, ORF K14, v-GPCR, putative phosphoribosyiformylglycinamidine eynthase, and LAMP 1651 14682 27645 2.56 1.0E-04 AF148805.1 NT (LAMP) genes, complete cds 1886 14907 27892 1.23 1.0E-04 AB048342.1 NT Equus caballus DNA, chromosome 24q14, microsatellite TKY36 2686 15680 28680 1.05 1.0E-04 AF195953.1 NT Homo sapiens membrane-bound aminopeptidase P (XNPEP2) gene, complete cds 2686 15680 28681 1.05 1.0E-04 AF195953.1 NT Homo sapiens membrane-bound aminopeptidase P (XNPEP2) gene, complete cds 2738 15731 28726 0.91 1.0E-04 BE218833.1 EST_HUMAN hv45c08.x1 NCI_CGAP_Lu24 Homo sapiens cDNA clone IMAGE:3176366 3' 2738 15731 28727 0.91 1.0E-04 BE218833.1 EST_HUMAN hv45c08.x1 NCI_CGAP_Lu24 Homo sapiene cDNA clone IMAGE:3176366 3' 3328 16374 29275 1.42 1.0E-04 Q62203 SWISSPROT SPLICEOSOME ASSOCIATED PROTEIN 62 (SAP 62) (SPLICING FACTOR 3A SUBUNIT 2) (SF3A66) tj01f11.x1 NCI_CGAP_Gas4 Homo sapiens cDNA clone IMAGE:2140269 3' similar to contains Alu repetitive 3798 16829 29716 0.9 1.0E-04 AI440282.1 EST_HUMAN element; 4145 17166 30040 1.69 1.0E-04 M14042.1 NT Mouse alpha 1 type-IV collagen mRNA 4170 17191 30063 1.62 1.0E-04 AV647727.1 EST_HUMAN AV647727 GLC Homo sapiens cDNA clone GLCBBD04 3' 4576 17584 30446 1.03 1.0E-04 P08547 SWISSPROT LINE-1 REVERSE TRANSCRIPTASE HOMOLOG 5231 18219 31066 1.14 1.0E-04 7662015 NT Homo sapiens KIAA0237 gene product (KIAA0237), mRNA 5231 18219 31067 1.14 1.0E-04 7662015 NT Homo sapiens KIAA0237 gene product (KIAA0237), mRNA 6074 19135 32269 1.74 1.0E-04 P08547 SWISSPROT LINE-1 REVERSE TRANSCRIPTASE HOMOLOG Page 200 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Aduit Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 6148 19207 32345 0.46 1.0E-04 T19615.1 EST_HUMAN 753F Heart Homo sapiens cDNA clone 753 6148 19207 32346 0.46 1.0E-04 T19615.1 EST_HUMAN 753F Heart Homo sapiens cDNA clone 753 6707 19743 32945 0.98 1.0E-04 AA177111.1 EST_HUMAN nc02e12.s1 NCI_CGAP_Pr3 Homo sapiens cDNA clone IMAGE:252 nj25a04.s1 NCI_CGAP_AA1 Homo sapiens cDNA clone IMAGE:993486 3' similar to gb:M97252 7151 20259 33513 0.6 1.0E-04 AA564561.1 EST_HUMAN KALLMANN SYNDROME PROTEIN PRECURSOR (HUMAN); contains Alu repetitive element; 7550 20488 33777 14.75 1.0E-04 AI251980.1 EST_HHUMAN qv57d10.x1 NCI_CGAP_Ov32 Homo sapiens cDNA clone IMAGE:1985683 3' 8004 20488 33777 15.42 1.0E-04 AI251980.1 EST_HUMAN qv57d10.x1 NCI_CGAP_Ov32 Homo sapiens cDNA clone IMAGE1985683 3' 8574 21505 34849 1.13 1.0E-04 AA630453.1 EST_HUMAN ab94g08.s1 Stratagene lung (#937210) Homo sapiens cDNA clone IMAGE:2355742 3' 9876 22791 36181 2.74 1.0E-04 AI806220.1 EST_HUMAN wf26e08.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2356742 3' 9886 22801 36188 1.38 1.0E-04 O88969 SWISSPROT CYSTATIN-RELATED EPIDIDYMAL SPERMATOGENIC PROTEIN PRECURSOR (CYSTATIN 8) 9959 22664 0.62 1.0E-04 T77153.1 EST_HUMAN yd72c08.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:113774 5' 10172 23063 36460 1.61 1.0E-04 10883876 NT Homo sapiens phospholipid scramblase 1 (PLSCR1), mRNA 10675 23561 5.84 1.0E-04 P08547 SWISSPROT LINE-1 REVERSE TRANSCRIPTASE HOMOLOG 10711 23597 37024 1.04 1.0E-04 P08548 SWISSPROT LINE-1 REVERSE TRANSCRIPTASE HOMOLOG 11781 24680 2.01 1.0E-04M28587.1 NT Mouse alpha leukocyte interferon gene, complete cds 12077 24918 38418 1.85 1.0E-04 AB032968.1 NT Homo saplens mRNA for KIAA1142 protein, partial cds 12116 24957 38460 2 1.0E-04 AW269061.1 EST_HUMAN xv49g12.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2816518 3' 12146 24986 38486 1.98 1.0E-04 Q03696 SWISSPROT NEURONAL-GLIAL CELL ADHESION MOLECULE PRECURSOR (NG-CAM) 12146 24986 38487 1.98 1.0E-04 Q03696 SWISSPROT NEURONAL-GLIAL CELL ADHESION MOLECULE PRECURSOR (NG-CAM) 12216 25050 1.48 1.0E-04 AJ251885.1 NT Homo sapiens partial SLC22A2 gene for organic cation transporter (OCT2), exon 1 722 13780 26702 2.01 9.0E-05 AA718933.1 EST_HUMAN ah45c11.s1 Scares_teslis_NHT Homo sapiens cDNA clone 1292468 3' 5382 18364 31203 1.17 9.0E-05 AF156166.1 NT Homo sapiens putative tumor suppressor mRNA 6190 19247 32393 1.5 9.0E-05 Q60716 SWISSPROT PROLYL4-HYDROXYLASE ALPHA-2 SUBUNIT PRECURSOR 8011 20928 34245 0.79 9.0E-05 AW204958.1 EST_HUMAN UI-H-BI1-aer-d-05-0-UI.s1 NCI_CGAP_Sub3 Homo sapiens cDNA clone IMAGE:2720289 3' 8011 20928 34246 0.79 9.0E-05 AW204958.1 EST_HUMAN UI-H-BI1-aer-d-05-0-UI.s1 NCI_CGAP_Sub3 Homo sapiens cDNA clone IMAGE:2720289 3' 10009 22826 2.67 9.0E-05 D85606.1 NT Homo saplens gene for cholecystokinin type-A receptor, complete cds 10011 22828 36215 3.12 9.0E-05 AF120982.1 NT Homo sapiens methyl-CpG binding protein 1 (MBD1) gene, exon 15b xa34g05.x1 NCI_CGAP_Br18 Homo sapiens cDNA clone IMAGE:2568728 3' similar to contains L1.t2 L1 11676 24485 37953 3.04 9.0E-05 AW073078.1 EST_HUMAN repetitive element ; qv23f06.x1 NCI_CGAP_Lym6 Homo sapiens cDNA clone IMAGE:1982435 3' similar to contains element 11688 24590 38067 2.15 9.0E-05 AI287878.1 EST_HUMAN MIR repetitive element ; 12042 19247 32393 3.66 9.0E-05 Q60716 SWISSPROT PROLYL 4-HYDROXYLASE ALPHA-2 SUBUNIT PRECURSOR Page 201 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value Homo sapiens MSH55 gene, partial cds; and CLIC1, DDAH, G6b, G5c, G%B, G6d, G6e, G6f, BAT5, G5b, 12521 25818 4.65 9.0E-05 AF129756.1 NT CSK2B, BAT4, G4, Apo M, BAT3, BAT2, AIF-1, 1C7, LST-1, LTB, TNF, and LTA genes, complete cds 846 13901 26841 1.38 8.0E-05 AJ251646.1 NT Pisum sativum mRNA for beta-1,3 glucanase (gns2 gene) 889 13942 4.34 8.0E-05 AJ251645.1 NT Pisum sativum mRNA for beta-1,3 glucanase (gns2 gene) 4595 17603 30459 0.69 8.0E-05 AW044605.1 EST_HUMAN wy78a04.x1 Soares_NSF_F8_9W_OT_PA_P_S1 Homo sapiens cDNA clone IMAGE:2554638 3' 9308 22236 35597 0.53 8.0E-05 Y11666.1 NT Mus musculus gene for hexokinase II, exon 1 (and joined CDS) 11591 24500 37969 2.95 8.0E-05 M69197.1 NT Human haptoglobin and haptoglobin-related protein (HP and HPR) genes, complete cds zs88h01.s1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE:704593 3' similar to contains Alu 13070 25804 1.45 8.0E-05 AA279333.1 EST_HUMAN reptitive element; contains element MSR1 repetitive element ; 367 13454 26366 4.31 7.0E-05 AW847445.1 EST_HUMAN RC3-CT0208-220999-011-E04 CT0208 Homo sapiens cDNA 367 13454 26367 4.31 7.0E-05 AW847445.1 EST_HUMAN RC3-CT0208-220999-011-E04 CT0208 Homo sapiens cDNA 589 13657 26560 6.85 7.0E-05 L49075.1 EST_HUMAN HUM072014F Human fovea cDNA Homo sapiens cDNA clone EST HFD072014 589 13657 26561 6.85 7.0E-05 L49075.1 EST_HUMAN HUM072014F Human fovea cDNA Homo sapiens cDNA clone EST HFD072014 PROBABLE GLYCEROL-3-PHOSPHATE ACYLTRANSFERASE, MITOCHONDRIAL PRECURSOR 1082 14126 27064 1.13 7.0E-05 Q22949 SWISSPROT (GPAT) 2767 15759 28753 4.27 7.0E-05 AL163278.2 NT Homo sapiens chromosome 21 segment HS21C078 3201 16249 29145 3.16 7.0E-05 AB009080.1 NT Dictyostelium discoideum gene for TRFA, complete cds 4142 17163 0.81 7.0E-05 AF111167.2 NT Homo sapiens jun dimerization protein gene, partial cds; cfos gene, complete cds; and unknown gene 4479 17490 30350 2.12 7.0E-05 AL163201.2 NT Homo sapiens chromosome 21 segment HS21C001 4556 17565 30423 0.66 7.0E-05 U60980.1 NT Caenorhabditis elegans Skp1p homolog mRNA, complete cds 5037 18034 30891 0.88 7.0E-05 9845300 NT Rat cytomegalovirus Maastricht, complete genome 8803 21733 35082 1.17 7.0E-05 AA505582.1 EST_HUMAN nh93g01.s1 NCI_CGAP_Br2 Homo sapiens cDNA clone IMAGE:966096 3' 10082 22875 36263 4.71 7.0E-05 T07095.1 EST_HUMAN EST04984 Fetal brain, Stratagene (cat#936206) Homo sapiens cDNA clone HFBED60 11600 24509 6.96 7.0E-05 10835046 NT Homo sapiens sarcoglycan, epsilon (SGCE), mRNA 2040 15057 28057 1.14 6.0E-05 4885170 NT Homo sapiens chromosome X open reading frame 6 (CXORF6) mRNA 2040 15057 28058 1.14 6.0E-05 4885170 NT Homo sapiens chromosome X open reading frame 6 (CXORF6) mRNA wb54h06.x1 NCI_CGAP_GC6 Homo sapiens cDNA clone IMAGE:2309531 3' similar to gb:J03250 DNA 2628 15626 28820 1.38 6.0E-05 AI655241.1 EST_HUMAN TOPOISOMERASE I (HUMAN): 2733 15726 26722 1.11 6.0E-05 Z84506.1 NT H.sapiens flow-sorted chromosome 6 Hindill fragment, SC6pA28B10 2733 15726 28723 1.11 6.0E-05 Z84506.1 NT H.sapiens flow-sorted chromosome 6 Hindill fragment, SC6pA28B10 2861 13762 26678 2.66 6.0E-05 AF053630.1 NT Homo sapiens monocyte/neutrophil elastase inhibitor gene, complete cds 6134 19193 32329 3.87 6.0E-05 Q12860 SWISSPROT CONTACTIN PRECURSOR (GLYCOPROTEIN GP135) Page 202 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Probe Exon Most Similar Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 5134 19193 32330 3.87 6.0E-05 Q12860 SWISSPROT CONTACTIN PRECURSOR (GLYCOPROTEIN GP135) 6668 19706 32901 1.46 6.0E-05 N72829.1 EST_HUMAN yv50g11.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:246212 5' 7263 20172 33413 0.73 6.0E-05 AA897680.1 EST_HUMAN oj80a03.s1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:1504588 3' 8663 21594 34933 1.06 6.0E-05 BE064410.1 EST_HUMAN RC4-BT0311-141199-011-h06 BT0311 Homo sapiens cDNA 8663 21594 34934 1.06 6.0E-05 BE064410.1 EST-HUMAN RC4-BT0311-141199-011-h06 BT0311 Homo sapiens cDNA zl08c08.s1 Soares_pregnant_uterus_NbHPU Homo sapiens cDNA clone IMAGE:491726 3' similar to 9011 21940 35296 0.56 6.0E-05 AA1504821 EST_HUMAN contains element MER28 repetitive element; 9016 21945 35301 3.62 6.0E-05 AW896629.1 EST_HUMAN PM4-NN0050-310300-001-f10 NN0050 Homo saplene cDNA 9143 22071 35433 0.63 6.0E-05 Q60401 SWISSPROT COMPLEMENT DECAY-ACCELERATING FACTOR PRECURSOR 9794 22758 36143 1.71 6.0E-05 P08607 SWISSPROT C4B-BINDING PROTEIN PRECURSOR (C4BP) 9794 22758 36144 1.71 6.0E-05 P08607 SWISSPROT C4B-BINDING PROTEIN PRECURSOR (C4BP) 10051 22967 36356 0.69 6.0E-05 T94149.1 EST_HUMAN ye28c12.r1 stratagene lung (#937210) Homo sapiens cDNA clone IMAGE:119062 5' yi59d08.s1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE:143535 3' similar to contains Alu 11189 24115 37563 2.41 6.0E-05 R75639.1 EST_HUMAN repetitive element contains LTR7 repetitive element; 11950 24794 38293 3.33 6.0E-05 AA044015.1 EST_HUMAN zk58f02.r1 Soares_pregnant_uterus_NbHPU Homo sapiens cDNA clone IMAGE:487035 5' 12723 25802 31582 9.53 6.0E-05 AW890110.1 EST_HUMAN MR0-NT0038-250400-001-f09 NT0038 Homo sapiens cDNA 13069 25595 31728 2.44 6.0E-05 AF060568.1 NT Homo sapiens promyelocytic leukemia zinc finger protein (PLZF) gene, complete cds 1429 14460 27412 9.5 5.0E-05 AW392086.1 EST_HUMAN QV4-ST0234-241199-040-h11 ST0234 Homo sapiens cDNA 1888 14909 3.15 5.0E-05 8923891 NT Homo sapiens 22kDa peroxisomal membrene protein-like (LOC55895), mRNA 2580 15579 28573 1.04 5.0E-05 P23249 SWISSPROT PROTEIN MOV-10 2903 15957 28857 0.97 5.0E-05 AJ251058.1 NT Homo sapiens MEP1A gene, promoter region and exon 1 4064 17090 29975 3.75 5.0E-05 AJ251884.1 NT Homo sapiens partial SLC22A3 gene for extraneuronal monoamine transporter (EMT), exon 1 5301 18285 31136 0.65 5.0E-05 Q26422 SWISSPROT LIMULUS CLOTTING FACTOR C PRECURSOR (FC) 5301 18285 31137 0.65 5.0E-05 Q26422 SWISSPROT LIMULUS CLOTTING FACTOR C PRECURSOR (FC) 5715 18788 31719 10.99 5.0E-05 X58855.1 NT Human MLC1emb gene for embryonic myosin alkaline light chain, 3'UTR 6224 19279 32433 3.28 5.0E-05 AV653544.1 EST_HUMAN AV653544 GLC Homo sapiens cDNA clone GLCDMA06 3' 6409 19457 32631 0.79 5.0E-05 AF260225.1 NT Homo sapiens TESTIN 2 end TESTIN 3 genes, complete cds, alternatively spliced 7716 20648 1.24 5.0E-05 AB037964.1 NT Mus musculus gene for calretinin, exon 1 12518 25400 7.16 5.0E-05 P49193 SWISSPROT RETINAL-BINDING PROTEIN (RALBP) 12771 25400 5.89 B.0E-05 P49193 SWISSPROT RETINAL-BINDING PROTEIN (RALBP) 2854 13343 3.02 4.0E-05 U12821.1 NT Human renin (REN) gene, 5' flanking region 4596 17604 30460 1.24 4.0E-05 P49193 SWISSPROT RETINAL-BINDING PROTEIN (RALBP) 4596 17604 30461 1.24 4.0E-05 P49193 SWISSPROT RETINAL-BINDING PROTEIN (RALBP) 4982 17961 1.2 4.0E-05 AF164488.1 NT Cryptosporidium parvum isolate Zaire 15 kDa glycoprotein gp15 gene, pertial cds Page 203 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Probe Exon Most Similar Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 5146 18141 30986 0.74 4.0E-05 AF212313.1 NT Drosophila melanogaster senseless protein (sens) gene, complete cds 7271 20179 33422 0.69 4.0E-05 U01947.1 NT Macaca mulatta haptoglobin (HP) gene, 5' region 10053 22969 7.1 4.0E-05 AF202635.1 NT Homo sapiens PP1200 mRNA. complete cds RETROVIRUS-RELATED POL POLYPROTEIN [CONTAINS: REVERSE TRANSCRIPTASE; 10506 23393 36805 0.61 4.0E-05 P11369 SWISSPROT ENDONUCLEASEI 10891 23776 37202 0.63 4.0E-05 P23780 SWISSPROT BETA-GALACTOSIDASE PRECURSOR (LACTASE)(ACID BETA-GALACTOSIDASE) hi36c07.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2974380 3' similar to contains 11207 24133 37581 4.6 4.0E-05 AW627946.1 EST_HUMAN ELEMENT MIR repetitive element; 12412 25181 31877 1.69 4.0E-05 AL1632522 NT Homo sapiens chromosome 21 segment HS21C052 qh64c10.x1 Soares_fetal_liver_spleen_1NFLS_S1 Homo saplens cDNA clone IMAGE:1849458 3' similar to 704 13763 26680 0.71 3.0E-05 AI248061.1 EST_HUMAN contains Alu repetitive elementcontains element KER repelltive element; 1086 14130 27068 1.71 3.0E-05 AW273851.1 EST_HUMAN xv24g03.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2814100 3' 1158 14199 27135 1.29 3.0E-05 BF037898.1 EST_HUMAN 601461463F1 NIH_MGC_66 Homo sapiens cDNA clone IMAGE:3865142 5' 1158 14199 27186 1.29 3.0E-05 BF037898.1 EST_HUMAN 601461463F1 NIH_MGC_66 Homo sapiens cDNA clone IMAGE:3865142 5' 1543 14573 27532 0.99 3.0E-05 BE169211.1 EST_HUMAN PM1-HT0521-120200-001-e10 HT0521 Homo sapiens cDNA 1543 14573 27533 0.99 3.0E-05 BE169211.1 EST_HUMAN PM1-HT0521-120200-001 e10 HT0521 Homo sapiens cDNA glg1g11.x1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:1879748 3' similar to TR:O08632 3335 16381 0.71 3.0E-05 AI288919.1 EST_HUMAN O08632 GLYCINE TYROSINE-RICH HAIR PROTEIN.; 4489 17500 30362 9.18 3.0E-05 BE169211.1 EST_HUMAN PM1-HT0521-120200-001-e10 HT0521 Homo sapiens cDNA 4489 17500 30362 9.18 3.0E-05 BE169211.1 EST_HUMAN PM1-HT0521-120200-001-e10 HT0521 Homo sapiens cDNA 4578 17586 30447 0.86 3.0E-05 AA368679.1 EST_HUMAN EST79996 Placenta I Homo sapiens cDNA similar to similar to p53-associated protein 4578 17586 30448 0.86 3.0E-05 AA368679.1 EST_HUMAN EST79996 Placenta I Homo sapiens cDNA similar to similar to p53-associated protein 4732 17737 30599 0.71 3.0E-05 AF149773.1 NT Homo sapiens NOD1 protein (NOD1) gene, exons 1, 2, and 3 4849 17851 30719 0.95 3.0E-05 SWISSPROT CHEMOKINE RECEPTOR-LIKE 1(G-PROTEIN COUPLED RECEPTOR DEZ) gh64c10.x1 Soares_fetal_liver_spleen_1NFLS_S1 Homo saplens cDNA clone IMAGE:1849458 3' similar to 4951 13763 26680 0.68 3.0E-05 AI248061.1 EST_HUMAN contains Alu repetitive element;contains element KER repetitive element; 5749 18822 31919 1.71 3.0E-05 11072102 NT Mus musculus myosin light chain 2, precursor lymphocyte-specific (Mylc2pl), mRNA 7062 20086 33319 1.08 3.0E-05 AJ225782.1 NT Komo sapiens SYBL1 gene, exons 6-8 7062 20086 33320 1.08 3.0E-05 AJ225782.1 NT Homo sapiens SYBL1 gene, exons 6-8 8478 21409 34717 2.38 3.0E-05 BE733157.1 EST_HUMAN 601567451F1 NIH_MGC_21 Homo sapiens cDNA clone IMAGE:3842292 5' 9450 22378 35741 1.85 3.0E-05 AW770982.1 EST_HUMAN hl94e08.x1 NCI_CGAP_Lu24 Homo sapiens cDNA clone IMAGE:3009638 3' 9454 22382 35744 1.77 3.0E-05 6912431 NT Homo saplens Interleukin-1 receptor antagonist homolog 1 (IL1HY1), mRNA 9458 22386 35749 0.73 3.0E-05 P43361 SWISSPROT MELANOMA-ASSOCIATED ANTIGEN 8 (MAGE-8 ANTIGEN) 9675 22601 0.6 3.0E-05 X03273.1 NT Human Alu-family cluster 5' of alpha(1)-acid glycoprotein gene Page 204 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Aduit Liver Probe Exon Most Similar Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 9860 22775 36161 1.73 3.0E-05 AA372562.1 EST_HUMAN EST84475 Colon adenocarcinoma IV Homo sapiens cDNA 5' end 10187 23078 3.49 3.0E-05 AI769331.1 EST_HUMAN wg36f09.x1 Soares_NSF_F8_9W_OT_PA_P_S1 Homo saplens cDNA clone IMAGE:2367209 3' 11014 23898 37333 0.9 3.0E-05 Q62918 SWISSPROT PROTEIN KINASE C-BINDING PROTEIN NELL2 PRECURSOR (NEL-LIKE PROTEIN 2) 11014 23898 37334 0.9 3.0E-05 Q62918 SWISSPROT PROTEIN KINASE C-BINDING PROTEIN NELL2 PRECURSOR (NEL-LIKE PROTEIN 2) 12420 25188 1.72 3.0E-05 L77570.1 NT Homo sapiens DIGaorge syndrome critical region, centromeric and 12595 25291 1.5 3.0E-05 AJ271735.1 NT Homo sapiens Xq pseudoautosomal region; segment 1/2 qh98e11.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:1855052 3' similar to contains 2346 15354 28357 1.36 2.0E-05 AI286021.1 EST_HUMAN MER2.b2 MER3 repetitive element; 2620 15618 28611 6.69 2.0E-05 M13792.1 NT Human adenosine deaminase 9ADA) gene, complete cds zq46a12.r1 Stratagene hNT neuron (#937233) Homo salens cDNA clone IMAGE:632734 5' similar to 2762 15764 5.86 2.0E-05 AA160562.1 EST_HUMAN contains Alu repetive element contains element L1 repetitive element; 3182 16232 29127 1.93 2.0E-05 BE066036.1 EST_HUMAN RC3-BT0319-120200-014-h08 BT0319 Homo saplens cDNA 3397 16439 29343 0.92 2.0E-05 AF184614.1 NT Homo sapiens p47-phox (NCF1) gene, complete cs 3427 16468 29377 0.85 2.0E-05 X69211.1 NT H.sapiens DNA for endogenous retroviral like element 3553 16591 0.77 2.0E-05 X95465.1 NT S.cerevisiae 12.8 Kbp fragment of the left arm of chromosome XV 3875 16904 0.67 2.0E-05 AL039107.1 EST_HUMAN DKFZp5663064_r1 566 (synonym: hfkd2) Homo sapiens cDNA clone DKFZp5661064 5' 4803 17804 1.23 2.0E-05 BE378471.1 EST_HUMAN 601236455F1 NIH_MGC_44 Homo sapiens cDNA clone IMAGE:3608653 5' 5966 19033 32154 2.01 2.0E-05 AJ011712.1 NT Homo sapiens TNNT1 gene, exons 1-11 (and joined CDS) 6139 19198 0.76 2.0E-05 AF029308.1 NT Homo sapiens chromosome 9 duplication of the T cell receptor betal locus and trypsinogen gene families RENAL SODIUM/DICARBOXYLATE COTRANSPORTER (NA(+)/DICARBOXYLATE 6199 19255 32401 2.23 2.0E-05 Q13183 SWISSPROT COTRANSPORTER) RENAL SODIUM/DICARBOXYLATE COTRANSPORTER (NA(+)/DICARBOXYLATE 6199 19255 32402 2.23 2.0E-05 Q13183 SWISSPROT COTRANSPORTER) qc72a02.x1 Soares_placenta_8to9weeks_2NbHP8to9W Homo sapiens cDNA clone IMAGE:1715114 3' 6398 19446 32617 0.68 2.0E-05 AI149272.1 EST_HUMAN similar to contains L1.t3 L1 repentitive element; 6475 19520 32696 0.52 2.0E-05 P35085 SWISSPROT CALCIUM-BINDING PROTEIN 6913 19943 33162 2.19 2.0E-05 AA714330.1 EST_HUMAN nw06d12.s1 NCI_CGAP_SS1 Homo saplens cDNA clone IMAGE:1238519 3' 7230 20139 33378 2 2.0E-05 Y08926.1 NT P.falciparum mRNA for AARP1 protein, partial qz47b06.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2030003 3' similar to TR:O02711 7242 20151 33390 1.15 2.0E-05 AI492960.1 EST_HUMAN O02711 PRO-POL-DUTPASE POLYPROTEIN; 7252 20161 7.05 2.0E-05 AI991025.1 EST_HUMAN wu35h07.x1 Soares_Dieckgraefe_colon_NHCD Homo sapiens cDNA clone IMAGE:2522077 3' Page 205 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Probe Exon Most Similar Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value Heterodontus francsicl HoxA10 (HoxA10), HoxA9 (HoxA9), HoxA7 (HoxA7), HoxA6 (HoxA6), HoxA5 7514 20453 33738 2.27 2.0E-05 AF224262.1 NT (HoxA5), HoxA4 (HoxA4), HoxA3 (HoxA3), HoxA2 (HoxA2), and HoxA1 (HoxA1) genes, complete cds Heterodontus franciscl HoxA10 (HoxA10), HoxA9 (HoxA9), HoxA7 (HoxA7), HoxA6 (HoxA6), HoxA5 7514 20453 33739 2.27 2.0E-05 AF224262.1 NT (HoxA5), HoxA4 (HoxA4), HoxA3 (HoxA3), HoxA2 (HoxA2), and HoxA1 (HoxA1) genes, complete cds 7759 20689 0.98 2.0E-05 AF128847.1 NT Homo sapiens indolethylamine N-methyltransferase (INMT) mRNA, INMT-2 allele, complete cds 8465 21396 34737 2.26 2.0E-05 AI381040.1 EST_HUMAN tg20h05.x1 NCI_CGAP_CLL1 Homo sapiens cDNA clone IMAGE:2109369 3' TCBAP2E1590 Pediatric pre-B cell acute lymphoblastic leukemia Baylor-HGSC project=TCBA Homo sapiens 9666 22592 35965 0.56 2.0E-05 BE244840.1 EST_HUMAN cDNA clone TCBAP1590 TCBAP2E1590 Pediatric pre-B cell acute lymphoblastic leukemia Baylor-HGSC project=TCBA Homo sapiens 9666 22592 35966 0.56 2.0E-05 BE244840.1 EST_HUMAN cDNA clone TCBAP 1590 9807 22713 36095 0.52 2.0E-05 P49457 SWISSPROT COMPLEMENT DECAY-ACCELERATING FACTOR (CD55) 9807 22713 36096 0.52 2.0E-05 P49457 SWISSPROT COMPLEMENT DECAY-ACCELERATING FACTOR (CD55) 10434 23323 36741 0.6 2.0E-05 AL163207.2 NT Homo sapiens chromosome 21 segment HS21C007 10634 23520 36954 0.92 2.0E-05 BF055939.1 EST_HUMAN 7i75g09.y1 NCI_CGAP_Bm20 Homo sapiens cDNA clone IMAGE:3340576 5' 11062 23946 37383 2.74 2.0E-05 N41751.1 EST_HUMAN yw91a06.r1 Soares_placenta_8to9weeks_2NbHP8to9W Homo sapiens cDNA clone IMAGE:259570 5' 11062 23946 37384 2.74 2.0E-05 AI991025.1 EST_HUMAN wu35h07.x1 Soares_Dieckgraefe_colon_NHCD Homo sapiens cDNA clone IMAGE:2522077 3' 11089 20161 2.43 2.0E-05 AI991025.1 EST_HUMAN wu35h07.x1 Soares_Dieckgraefe_colon_NHCD Homo sapiens cDNA clone IMAGE:2522077 3' 11886 23986 37424 2.34 2.0E-05 BE175801.1 EST_HUMAN RC5-HT0582-280300-012-E12 HT0582 Homo sapiens cDNA hw21a03.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:3183532 3' similar to TR;Q12832 12529 25738 5.85 2.0E-05 BE348229.1 EST_HUMAN Q12832 GLYCOPHORIN HEP2; xa89a03.x1 NCI_CGAP_Co17 Homo sapiens cDNA clone IMAGE:2573932 3' similar to TR:Q12832 12629 25886 10.39 2.0E-05 AW074604.1 EST_HUMAN repetitive element; 12677 25727 2.42 2.0E-05 AF275948.1 NT Homo sapiens ABCA1 (ABCA1) gene, complete cds 12817 25438 31795 1.45 2.0E-05 AU131513.1 EST_HUMAN AU131513 NT2RP3 Homo sapiens cDNA clone NT2RP3002707 5' 13104 25619 2.09 2.0E-05 AI200970.1 EST_HUMAN qf68g11.x1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1755236 3' 2286 15294 28302 1.24 1.0E-05 P27448 SWISSPROT PUTATIVE SERINE/THREONINE-PROTEIN KINASE P78 2745 15932 28731 2.24 1.0E-05 AL163282.2 NT Homo sapiene chromosome 21 segment HS21C082 3718 16750 29638 2.1 1.0E-05 AF088273.1 NT Drosophila melanogaster strain Lamto 120 Suppressor of Hairles (Su(H)) gene, partial cds Homo sapiens calcium channel alpha1E subunit (CACNA1E) gene, exons 7-49, and partial cds, alternatively 3881 16910 1.51 1.0E-05 AF22339.1 NT spliced Page 206 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Probe Exon Most Similar Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 4050 17077 29962 15.85 1.0E-05 P81274 SWISSPROT MOSAIC PROTEIN LGN 4268 17284 30151 1.2 1.0E-05 AL163203.2 NT Homo sapiens chromosome 21 segment HS21C003 4375 17389 30252 2.22 1.0E-05 AA431119.1 EST_HUMAN zw69g04.r1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:781494 5' 4961 17959 30817 2.78 1.0E-05 AW419134.1 EST_HUMAN xy49g11.x1 NCI_CGAP_Lu34.1 Homo sapiens cDNA clone IMAGE:2856548 3' 5081 18078 30927 0.7 1.0E-05 AL163246.2 NT Homo sapiens chromosome 21 segment HS21C046 7056 20082 33314 1.68 1.0E-05 AJ246003.1 NT Homo sapiens Spast gene for spastin protein 7169 18441 31344 0.46 1.0E-05 P08548 SWISSPROT LINE-1 REVERSE TRANSCRIP TASE HOMOLOG ns19g02.s1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE:1184114 3' similar to contains L1.t1 L1 7440 20182 33426 3.21 1.0E-05 AA641846.1 EST_HUMAN L1 repetitive element; 7442 20383 33652 12.61 1.0E-05 4505844 NT Homo sapiens phospholipase A2, group X (PLA2G10) mRNA, and translated products 7p57d01.x1 NCI_CGAP_Pr28 Homo sapiens cDNA clone IMAGE:3649945 3' similar to contains MER10.b3 8109 21021 34347 0.63 1.0E-05 BF222646.1 EST-HUMAN MER10 repetitive element; 8251 21156 2.43 1.0E-05 P19474 SWISSPROT 52 KD RO PROTEIN (SJOGREN SYNDROME TYPE A ANTIGEN (SS-A))(RO(SS-A)) 9472 22400 2.99 1.0E-05 AL163227.2 NT Homo sapiens chromosome 21 segment HS21C027 zx35h12.s1 Soares_total_fetus_Nb2HF8_9w Homo sapiens cDNA clone IMAGE:788519 3' similar to 9612 22538 35908 2.81 1.0E-05 AA452578.1 EST_HUMAN gb:L02932 PEROXISOME PROLIFERATOR ACTIVATED RECEPTOR ALPHA (HUMAN); zs05e11.r1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE:684332 5' similar to contains Alu 9827 22733 36115 13.49 1.0E-05 AA236110.1 EST_HUMAN repetitive element;contains element TAR1 repetitive element; 9905 22893 36279 0.77 1.0E-05 AV732190.1 EST_HUMAN AV732190 HTF Homo sapiens cDNA clone HTFBIH01 5' hd41b02.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2912043 3' similar to contains 10353 23242 0.89 1.0E-05 AW510902.1 EST_HUMAN OFR.t1 OFR repetitive element; hd41b02.x1 Soares-NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2912043 3' similar to contains 10353 23242 36662 0.89 1.0E-05 AW510902.1 EST_HUMAN OFR.t1 OFR repetitive element; 10427 23316 36733 2.56 1.0E-05 AW291521.1 EST_HUMAN UI-H-B12-agk-a-08-0-UI.s1 NCI-CGAP_Sub4 Homo sapiens cDNA clone IMAGE:2724398 3' 10427 23316 36734 2.56 1.0E-05 AW291521.1 EST_HUMAN UH-I-B12-agk-a-08-0-UI.s1 NCI_CGAP_Sub4 Homo sapiens cDNA clone IMAGE:2724398 3' ha07c10.x1 NCI_CGAP_Kid12 Homo sapiens cDNA clone IMAGE:2873010 3' similar to contains L1.t2 L1 1.681 23567 1.76 1.0E-05 AW466995.1 EST_HUMAN repetitive element; Human hereditary haemochromatosis region, histone 2A-like protein gene, hereditary haemochromatosis 11356 24274 37716 2.1 1.0E-05 U91328.1 NT (HLA-H) gene, RoRetgene, and sodium phosphate transporter (NPT3) gene, complete cds Human hereditary haemochromatosis region, histone 2A-like protein gene, hereditarh haemochromatosis 11356 24274 37717 2.1 1.0E-05 U91328.1 NT (HLA-H) gene, RoRet gene, and sodium phosphate transporter (NPT3) gene, complete cds 12981 25880 31477 2.31 1.0E-05 AL163303.2 NT Homo sapiens chromosome 21 segment HS21C103 Page 207 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Probe Exon Most Similar Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 2721 15714 28713 7.88 9.0E-06 AI583811.1 EST_HUMAN tt73a06.x1 NCI_CGAP_HSC3 Homo sapiens cDNA clone IMAGE:2246386 3' 3143 16193 29086 4.94 9.0E-06 AI218983.1 EST_HUMAN qg11b08.x1 Soares_placenta_8to9weeks_2NbHP8to9W Homo sapiens cDNA clone IMAGE:1759191 3' 3674 16707 2.83 9.0E-06 M61755.1 NT Human alanine:glycoxylate aminotransferase (AGXT) gene, exons 1 and 2 6123 19182 32317 2.63 9.0E-06 L23416.1 NT Homo sapiens differentiation antigen CD20 gene, exons 5, 6 7188 20188 33431 1.03 9.0E-06 BE065042.1 EST_HUMAN RC1-BT0313-110500-017-a07 BT0313 Homo sapiens cDNA 7844 20771 34074 0.89 9.0E-06 P08547 SWISSPROT LINE-1 REVERSE TRANSCRIPTASE HOMOLOG ox20g01.x1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE;1656912 3' similar to 8246 21151 34486 12.99 9.0E-06 AI034370.1 EST_HUMAN contains Alu repetitive element; 9033 21962 35322 1.7 9.0E-06 AL163209.2 NT Homo sapiens chromosome 21 segment HS21C009 SUSHI REPEAT-CONTAINING PROTEIN SRPXPRECURSOR (DRS PROTEIN)(DOWN-REGULATED 9534 22461 35823 3.66 9.0E-06 Q63769 SWISSPROT BYV-SRC) SUSHI REPEAT-CONTAINING PROTEIN SRPXPRECURSOR (DRS PROTEIN)(DOWN-REGULATED 9534 22461 35824 3.66 9.0E-06 Q63769 SWISSPROT BYV-SRC) 9763 22687 36073 3.9 9.0E-06 U35114.1 NT Human apolipoprotein E (APOE) gene, hepatic control region HCR-2 11377 24293 37738 3.53 9.0E-06 Q10364 SWISSPROT PUTATIVE SERINE/THREONINE-PROTEIN KINASE C22E12.14C 2557 15926 28555 1.62 8.0E-06 AW362539.1 EST_HUMAN RC3-CT0283-201199-011-h11 CT0283 Homo sapiens cDNA 11012 23896 37330 0.78 8.0E-06 P34083 SWISSPROT FASCICLIN II, PHOSPHATIDYLINOSITOL-LINKED ISOFORM PRECURSOR (FAS II) 11012 23896 37331 0.78 8.0E-06 P34083 SWISSPROT FASCICLIN II, PHOSPHATIDYLINOSITOL-LINKED ISOFORM PRECURSOR (FAS II) ab90f10.s1 Stratagene lung (#937210) Homo sapiens cDNA clone IMAGE:854251 3' similar to contains 1006 14055 1.62 7.0E-06 AA669729.1 EST_HUMAN MER20.t1 MER20 repetitive element; 1458 14490 27451 3.05 7.0E-05 7662177 NT Homo sapiens KIAA0555 gene product (KIAA0555), mRNA qw16g09.x1 NCI_CGAP_Ut3 Homo sapiens cDNA clone IMAGE:1991296 3' similar to contains Alur repetitive 2916 15969 15.08 7.0E-06 AI368252.1 EST_HUMAN element; 3622 16658 0.87 7.0E-06 AA385542.1 EST_HUMAN EST99205 Thyroid Homo sapiens cDNA 5' end similar to EST containing L1 repeat 5894 18963 5.3 7.0E-06 AW883141.1 EST_HUMAN QV2-OT0062-250400-173-h01 OT0062 Homo sapiens cDNA 6015 19078 32203 0.94 7.0E-06 N98645.1 EST_HUMAN yy65c07.r1 Soares_multiple_sclerosis_2NbHMSP Homo sapiens cDNA clone IMAGE:278412 5' 9347 22275 35637 1.11 7.0E-06 11420709 NT Homo sapiens DNA segment, numerous copies, expressed probeas (GS1 gene)(DXF68S1E), mRNA 10412 23301 0.56 7.0E-06 Q61147 SWISSPROT CERULOPLASMIN PRECURSOR (FERROXIDASE) 12288 25906 31366 1.66 7.0E-06 BF215972.1 EST_HUMAN 601881522F1 NIH_MGC_57 Homo sapiens cDNA clone IMAGE:4093972 5' 2960 16012 28910 1.56 6.0E-06 BE069189.1 EST_HUMAN QV3-BT0379-010300-105-d11 BT0379 Homo sapiens cDNA 3758 16790 29680 1.11 6.0E-06 BE069189.1 EST_HUMAN QV3-BT0379-010300-105-d11 BT0379 Homo sapiens cDNA 4866 16035 28938 2.37 6.0E-06 Q01456 SWISSPROT OVARIAN ABUNDANT MESSAGE PROTEIN (OAM PROTEIN) Page 208 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value ox08e02.x1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:1655738 3' similar to 4874 17873 30737 2.75 6.0E-06 AI040099.1 EST_HUMAN contains MER8.t2 MER8 repetitive element ; 5533 1861231461 1.37 6.0E-06 AF167441.1 NT MusmusculusE-cadherin binding protein E7 mRNA, complete cds 559418670315491.186.0E-06 Q02040SWISSPROT PROTEIN XE7 10370 232592.19 6.0E-06 AW801912.1 EST_HUMAN IL5-UM0070-110400-063-g02 UM0070 Homo sapiens cDNA 13061 25587 31740 1.95 6.0E-06 11418157 NT Homo sapiens calcium channel, voltage-dependent, alpha 1I subunit (CACNA1I), mRNA 6296 19347 32515 4.53 5.0E-06 AL163246.2 NT Homo sapiens chromosome 21 segment HS21C046 6594 19635 32817 2.11 5.0E-06 U07561.1 NT Human ABL gene, exon 1b and Intron 1b, and putative M8604 Met protein (M8604 Met) gene, complete cds 7401 20100 33335 0.62 5.0E-06 BE145171.1 EST_HUMAN CM2-HT0193-191099-022-f06 HT0193 Homo sapiens cDNA 7603 20538 33827 0.97 5.0E-06 AB007546.1 NT Homo sapiens gene for LECt2, complete cds 9028 21957 35316 0.69 5.0E-06 AW856972.1 EST_HUMAN RC1-CT0302-120200-013-h02 CT0302 Homo sapiens cDNA 9028 21957 35317 0.69 5.0E-06 AW856972.1 EST_HUMAN RC1-CT0302-120200-013-h02 CT0302 Homo sapiens cDNA 10603 23489 36918 9.02 5.0E-06 AA313620.1 EST_HUMAN EST185496 Colon carcinoma (HCC) cell line Homo sapiens cDNA 5' and 10992 23876 37305 0.66 5.0E-06 P06681 EST_HUMAN COMPLEMENT C2 PRECURSOR (C3/C5 CONVERTASE) 12970 25534 31749 4.21 5.0E-06 AI065045.1 EST_HUMAN HA0877 Human fetal liver cDNA library Homo sapiens cDNA ya48c03.r1 Soares infant brain 1NIB Homo sapiens cDNA clone IMAGE:63254 5' similar to contains Alu 670 13732 26643 4.55 4.0E-06 R16267.1 EST_HUMAN repetitive element; contains L1 repetitive element ; xc69g12.x1 NCI_CGAP_Eso2 Homo sapiens cDNA clone IMAGE:2589574 3' similar to contains Alu 871 13924 26871 9.61 4.0E-06 AW103354.1 EST_HUMAN repetitive element; contains element MER21 repetitive element ; 1362 14393 27347 5.1 4.0E-06 AI334928.1 EST_HUMAN tb33e09.x1 NCI_CGAP_HSC2 Homo sapiens cDNA clone IMAGE:2056168 3' 1362 14393 27348 5.1 4.0E-06 AI334928.1 EST_HUMAN tb33e09.x1 NCI_CGAP_HSC2 Homo sapiens cDNA clone IMAGE:2056168 3' 1492 14523 27485 3.4 4.0E-06 BF365612.1 EST_HUMAN QV2-NT0046-200600-250-h07 NT0046 Homo sapiens cDNA 2282 15291 28299 1.85 4.0E-06 AW01540.1 EST_HUMAN UI-H-BI0-aat-f-05-0-UI.s1 NCI_CGAP_Sub1 Homo sapiens cDNA clone IMAGE:2710425 3' 3111 16162 29058 0.78 4.0E-06 AF198349.1 NT Gallus gallus Dach2 protein (DAch2) mRNA,c omplete cds 3964 16992 29876 1.26 4.0E-06 AW848295.1 EST_HUMAN IL3-CT0214-150200-074-B03 CT0214 Homo sapiens cDNA wl94c10.x1 NCI_CGAP_Brn25 Homo sapiens cDNA clone IMAGE:2432562 3' similar to contains element 4922 17921 30784 1.94 4.0E-06 AI886939.1 EST_HUMAN MER22 repetitive element ; 9066 21995 35348 0.79 4.0E-06 O15393 EST_HUMAN TRANSMEMBRANE PROTEASE, SERINE 2 9358 22286 35649 4.48 4.0E-06 AF009660.1 NT Homo sapiens T cell receptor beta locus, TCRBV7S3A2 to TCRBV12S2 region 10230 23121 36523 1.1 4.0E-06 AJ272265.1 NT Homo sapiens SPP2 gene for seoreted phosphoprotein 24 precursor, exone 1-8 11883 23983 37421 4.56 4.0E-06 AB007955.1 NT Homo sapiens mRNA, chromosome 1 specific transcript KIAA0486 zl34b08.s1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:432663 3' similar to 2176 15188 28193 1.58 3.0E-06 AA700562.1 EST_HUMAN contains L1.t1 L1 repetitive element ; Page 209 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value zl34b08.s1 Soares fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:432663 3' similar to 2176 15188 28194 1.58 3.0E-06 AA700562.1 EST_HUMAN contains L1.t1 L1 repetitive element ; 2284 15292 1.63 3.0E-06 AF202635.1 NT Homo sapiens PP1200 mRNA, complete cds ak48g11.s1 Soares_testls_NHT Homo sapiens cDNA clone IMAGE:409252 3' similar to contains LTR1.t3 2964 16016 28913 1.26 3.0E-06 AA868218.1 EST_HUMAN LTR1 repetitive element ; wl22a05.x1 NCI_CGAP_Ut1 Homo sapiens cDNA clone IMAGE:2425616 3' similar to TR:O60734 O60734 3310 16357 2.18 3.0E-06 AI857779.1 EST_HUMAN LINE-1 LIKE PROTEIN ; contains L1.t2L1 repetitive element ; 3849 16878 29762 1.4 3.0E-06 BE047094.1 EST_HUMAN hq64d12.x1 NCI_CGAP_HN13 Homo sapiens cDNA clone IMAGE:3124151 3' 3849 16878 29763 1.4 3.0E-06 BE047094.1 EST_HUMAN hq64d12.x1 NCI_CGAP_HN13 Homo sapiens cDNA clone IMAGE:3124151 3' yb78b10.r1 Stratagene ovary (#937217) Homo sapiens cDNA clone IMAGE:77275 5' similar to contains L1 4588 17596 30454 0.71 3.0E-06 T50266.1 EST_HUMAN repetitive element Homo sapiens gene for alpha-1-microglobulin-bikunin, exons 1-5 (encoding alpha-1-microglobulin, N- 4677 17682 30550 4.38 3.0E-06 X54816.1 NT terminus.) 6401 19449 32620 0.79 3.0E-06 AU159412.1 EST_HUMAN AU159412 THYRO1 Homo sapiens cDNA clone THYRO1001602 3' 7598 20534 2.11 3.0E-06 P08548 EST_HUMAN LINE-1 REVERSE TRANSCRIPTASE HOMOLOG 8661 21592 34931 0.98 3.0E-06 BE562964.1 EST_HUMAN 601336213F1 NIH_MGC_44 Homo sapiens cDNA clone IMAGE:3690314 5' 9242 22170 35522 0.77 3.0E-06 P07743 EST_HUMAN PAROTID SECRETORY PROTEIN PRECURSOR (PSP) 12683 25342 10.26 3.0E-06 AW385262.1 EST_HUMAN RC0-LT0001-261199-011-A03 LT0001 Homo sapiens cDNA 215 13314 3.41 2.0E-06 P54368 SWISSPROT HOMEOBOX PROTEIN GOOSECOID 1588 14619 4.75 2.0E-06 P21414 SWISSPROT POLPOLYPROTEIN [CONTAINS: PROTEASE ; REVERSE TRANSCRIPTASE ; ENDONUCLEASE] wa04a03.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2297068 3' similar to contains MER30.b1 2401 15406 28409 1.54 2.0E-06 AI672138.1 EST_HUMAN MER30 repatitive element ; 2490 15492 28492 2.28 2.0E-06 P04929 SWISSPROT HISTIDINE-RICH GLYCOPROTEIN PRECURSOR 2601 15599 28594 2.38 2.0E-06 P06719 SWISSPROT KNCB-ASSOCIATED HISTIDINE-RICH PROTEIN PRECURSOR (KAHRP) 3579 16616 29519 1.392.0E-06 AV667555.1 EST_HUMAN AV557555 GLC Homo sapiens cDNA clone GLCFDB05 3' 3826 16856 29739 2.19 2.0E-06 AA173518.1 EST_HUMAN zp02e05.r1 Stratagene ovarian cancer (#937219) Homo sapiens cDNA clone IMAGE:595232 5' 3836 16865 29748 0.88 2.0E-06 AW450215.1 EST_HUMAN UI-H-BI3-aky-g-05-0-UI.s1 NCI_CGAP_Sub5 Homo sapiens cDNA clone IMAGE:2736176 3' 3843 16872 29755 2.32 2.0E-06 AB030896.1 NT Mus musculus gene for odorant receptor A16, complete cds on34h01.s1 NCI_CGAP_Lu5 Homo sapiens cDNA clone IMAGE:1558609 3' similar to contains Alu repetitive 6326 19376 0.79 2.0E-06 AA974932.1 EST_HUMAN element; te51f05.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2090241 3' similar to TR:Q13537 6358 19407 32572 0.77 2.0E-06 AI539448.1 EST_HUMAN Q13537 MER37 TRANSPOSABLE ELEMENT, COMPLETE CONSENSUS SEQUENCE. ; 6709 19745 32948 5.73 2.0E-06 AI819424.1 EST_HUMAN wj90b04.x1 NCI-CGAP_Lym12 Homo sapiens cDNA clone IMAGE:2410063 3' Page 210 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value nv59c06.s1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE:1234090 3' similar to contains L1.t3 L1 7884 20810 34116 0.56 2.0E-06 AA688423.1 EST_HUMAN repetitive element ; 8496 21427 1.17 2.0E-06 AW869223.1 EST_HUMANMR3-SN0067-120400-002-f02 SN0067 Homo sapiens cDNA 8668 21599 34939 0.78 2.0E-06 T12238.1 EST_HUMAN A447R Heart Homo sapiens cDNA clone A447 zh27c11.s1 Soares_pineal_gland_N3HPG Homo sapiens cDNA clone IMAGE:413300 3' similar to 9394 22322 0.98 2.0E-06 AA772497.1 EST_HUMAN TR:P70467 P70467 REVERSE TRANSCRIPTASE ; yu37c04.r1 Soares ovary tumor NbHOT Homo sapiens cDNA clone IMAGE:235974 5' similar to gb:X74929 9407 22335 35699 1.62 2.0E-06 H62051.1 EST_HUMAN KERATI, TYPE II CYTOSKELETAL 8 (HUMAN); 9757 22681 36066 1.09 2.0E-06 AF003529.1 NT Homo sapiens glypican 3 (GPC3) gene, partial cds and flanking repeat regions 9757 22681 36067 1.09 2.0E-06 AF003529.1 NT Homo sapiens glypican 3 (GPC3) gene, partial cds and flanking repeat regions 9777 22701 0.6 2.0E-06 AI473450.1 EST_HUMAN tj16g10.x1 NCI_CGAP_Gas4 Homo sapiens cDNA clone IMAGE:2141730 3' 10223 23114 36515 0.82 2.0E-06 N30576.1 EST_HUMAN yw66e03.s1 Soares_placenta_8to9weeks_2NbHP8to9W Homo sapiens cDNA clone IMAGE:257212 3' 10430 23319 0.66 2.0E-06 AV748969.1 EST_HUMAN AV748969 NPC Homo sapiens cDNA clone NP CAXD05 5' 12592 25909 31367 1.78 2.0E-06 P23249 SWISSPROT PROTEIN MOV-10 hs92f02.x1 NCI_CGAP_Kid13 Homo sapiens cDNA clone IMAGE:144699 3' similar to containe L1.t2L1 12735 25376 3.99 2.0E-06 BE328232.1 EST_HUMAN repetitive element ; ORGANIC CATION/CARNITINE TRANSPORTER 2 (SOLUTE CARRIER FAMILY 22, MEMBER 5) (HIGH- 35 13151 26040 1.77 1.0E-06 O76082 SWISSPROT AFFINITY SODIUM-DEPENDENT CARNITINE COTRANSPORTER) 680 13742 26657 1.51 1.0E-06 AF084364.1 NT Mus musculus D6MM5E protien (D6Mm5e) mRNA, complete cds 1470 14501 27462 2 1.0E-06 P09125 SWISSPROT MEROZOITE SURFACE PROTEIN CMZ-8 1546 14577275371.22 1.0E-06 AL163279.2 NT Homo sapiens chromosome 21 segment HS21C078 zi06a12.s1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:429982 3' similar to 1592 14623 27583 1.2 1.0E-06 AA034141.1 EST_HUMAN contains Alu repetitive element; zi06a12.s1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:429982 3' similar to 1592 14623 27584 1.2 1.0E-06 AA034141.1 EST_HUMAN contains Alu repetitive element; 1606 14637 1.18 1.0E-06 P27625 SWISSPROT DNA-DIRECT4D RNA POLYMERASE III LARGEST SUBUNIT 2010 15028 28020 6.69 1.0E-06 AF184614.1 NT Homo sapiens p47-phox (NCF1) gene, complete cds 2010 15028 28021 6.69 1.0E-06 AF184614.1 NT Homo sapiens p47-phox (NCF1) gene, complete cds 4476 17487 30346 15.6 1.0E-06 U07561.1 NT Human ABL gene, exon 1b and intron 1b, and putative M8604 Met protein (M8604 Met) gene, complete cds 5246 18233 31082 1.05 1.0E-06 AL163285.2 NT Homo sapiens chromosome 21 segment HS21C085 5246 18233 31083 1.05 1.0E-06 AL163285.2 NT Homo sapiens chromosome 21 segment HS21C085 5473 18554 31396 4.81 1.0E-06 BF333015.1 EST_HUMAN MR1-BT0800-030700-002-c06 BT0800 Homo sapiens cDNA Page 211 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 5498 18577 31424 1.15 1.0E-06 BE834518.1 EST_HUMAN MR3-FN0004-090600-001-e04 FN0004 Homo sapiens cDNA 5498 18577 31425 1.15 1.0E-06 BE834518.1 EST_HUMAN MR3-FN0004-090600-001-e04 FN0004 Homo sapiens cDNA 5663 18737 31645 1.06 1.0E-06 O60613 SWISSPROT 15 KDA SELENOPROTEIN PRECURSOR 6005 19069 0.591.0E-06 BE063527.1 EST_HUMAN CM0-BT0281-031199-087-h04 BT0281 Homo sapiens cDNA 7198 20198 33444 5.2 1.0E-06 P02671 SWISSPROT FIBRINOGEN ALPHA/ALPHA-E CHAIN PRECURSOR 8209 25097 0.52 1.0E-06 BE185330.1 EST_HUMAN IL5-HT0730-020500-074-g01 HT0730 Homo sapiens cDNA 8580 21511 0.95 1.0E-06 AA912623.1 EST_HUMAN ol29c08.s1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:1524878 3' 8849 21779 35126 1.04 1.0E-06 AI347010.1 EST_HUMANqp54e02.x1 NCI_CGAP_Co8 Homo sapiens cDNA clone ImAGE:1926842 3' qv23f06.x1 NCI_CGAP_Lym6 Homo sapiens cDNA clone ImAGE:1982435 3'similar tocontains element 9057 21986 353401.5 1.0E-06 AI287878.1 EST_HUMAN MIR repetitive element ; 9844 22952 36341 1.11 1.0E-06 N74635.1 EST_HUMAN za55e01.s1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:296472 3' 9918 22903 36295 0.67 1.0E-06 Q39575 SWISSPROT DYNEIN GAMMA CHAIN, FLAGELLAROUTER ARM 10207 23093 36497 3.3 1.0E-06 U82668.1 NT Homo sapiens shox gene, alternatively spliced products, complete cds 10207 23093 36498 3.3 1.0E-06 U82668.1 NT Homo sapiens shox gene, alternatively spliced products, complete cds 10248 2313936545 5.281.0E-06 AA132611.1 EST_HUMAN zo17e08.r1 Stratagene colon (#937204) Homo sapiens cDNA clone IMAGE:587174 5' zx04d11.s1 Soares_total_fetus_Nb2HF8_9w Homo sapiens cDNA clone IMAGE:7854933' similar to 10307 231972.79 1.0E-06 AA449257.1 EST_HUMAN gb:D26129 RIBONUCLEASE PANCREATIC PRECURSOR (HUMAN); 10966 23850 2.3 1.0E-06 AL163203.2 NT Homo sapiens chromosome 21 segment HS21C003 12076 249173.35 1.0E-06 AW890941.1 EST_HUMAN RC4-NT0054-120500-012-b03 NT0054 Homo sapiens cDNA 12826 25309 31816 7.93 1.0E-06 L78810.1 NT Homo sapiens ADP/ATP carrier protein (ANT-2) gene, complete cds 381 13466 26383 1.26 9.0E-07 AF0035291. NT Homo sapiens glypican 3 (GPC3) gene, partial cds and flanking repeat regions 381 13466 26384 1.26 9.0E-07 AF0035291. NT Homo sapiens glypican 3 (GPC3) gene, partial cds and flanking repeat regions 8978 21908 0.59 9.0E-07 AL163280.2 NT Homo sapiens chromosome 21 segment HS21C080 11693 24595 38072 3.1 9.0E-07 AL163281.2 NT Homo sapiens chromosome 21 segment HS21C081 488317882 30747 5.27 9.0E-07 AI288596.1 EST_HUMAN ql82g07.x1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:1878876 3' 488317882 30748 5.27 9.0E-07 AI288596.1 EST_HUMAN ql82g07.x1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:1878876 3' 6103 191647.68 8.0E-07 P21414 SWISSPROT POL POLYPROTEIN [CONTAINS: PROTEASE ; REVERSE TRANSCRIPTASE ; ENDONUCLEASE] 8581 21512 12.29 8.0E-07 AF135416.1 NT Homo sapiens UDP-glucuronosyltransferase gene, complete cds 12047 24888 7.22 8.0E-07 T07770.1 EST_HUMANEST05660 Fetal brain, Stratagene (cal#936206) Homo sapiens cDNA clone HFBEN89 12270 250875.99 8.0E-07AL163280.2 NT Homo sapiens chramosome 21 segment HS21C080 5709 18782 31712 0.69 7.0E-07 6005700 NT Homo sapiens ATP-binding cassette, sub-family A (ABC1), member 8 (ABCA8), mRNA 5709 18782 31713 0.69 7.0E-07 6005700 NT Homo sapiens ATP-binding cassette, sub-family A (ABC1), member 8 (ABCA8), mRNA 1929 14950 27926 3.2 6.0E-07 AW85558.1 EST_HUMANCM3-CT0277-221099-024-e11 CT0277 Homo sapiens cDNA Page 212 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value Homo sapiens HLA class III region containing tenascin X (tenascin-X) gene, partial cds; cytochrome P45021- hydroxylase (CYP21B), complement component C4 (C4B) G11, hellcase (SKI2W), RD, complement factor B 2515 15516 285202.42 6.0E-07 AF019413.1 NT (Bf), and complement component C2 (C2) genes,> 4056 17083 1.98 6.0E-07 P41479 SWISSPROT HYPOTHETICAL 24.1 KD PROTEIN IN LEF4-P33 INTERGENIC REGION 7g94f07.x1 NCI_CGAP_Co16 Homo sapiens cDNA clone IMAGE:3314149 3' similar to TR:O75920 O75920 9684 22610 35984 1.57 6.0E-07 BF001867.1 EST_HUMAN 4F5L. ; 12207 25042 38545 3.58 6.0E-07 AI792950.1 EST_HUMAN om87f05.y5 NCI_CGAP_Kld3 Homo sapiens cDNA clone IMAGE:1554177 5' 12498 25861 2.14 6.0E-07 AW903222.1 EST_HUMAN CM4-NN1029-250300-121-h12 NN1029 Homo sapiens cDNA 346 13435 1.93 5.0E-07 AI831893.1 EST_HUMAN wh64f10.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2385547 3' 1084 14128 2.59 5.0E-07 AA380630.1 EST_HUMAN EST93615 Supt cels Homo sapiens cDNA 5' end 3078 16129 0.78 5.0E-07 AI831893.1 EST_HUMAN wh64f10.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2385547 3' 6359 19408 32573 1.36 5.0E-07 U65067.1 NT Mus musculus CG-2 homeodomain protein (OG-2) gene, partial cds zt08e09.r1 NCI_CGAP_GC81 Homo sapiens cDNA clone IMAGE:712552 5' similar to gb:X53741_ma1 6449 19495 32670 0.44 5.0E-07 AA278183.1 EST_HUMAN FIBULIN-1, ISOFORM A PRECURSOR (HUMAN); tg06b06.x1 NCI_CGAP_CLL1 Homo sapiens cDNA clone IMAGE:2107953 3' similar to contains Alu 7418 20117 33353 1.54 5.0E-07 AI393981.1 EST_HUMAN repetitive element; contains element A3R repetitive element ; tg06b06.x1 NCI_CGAP_CLL1 Homo sapiens cDNA clone IMAGE:2107953 3' similar to contains Alu 7418 20117 33354 1.54 5.0E-07 AI393981.1 EST_HUMAN repetitive element; contains element A3R repetitive element ; xa31a02.x1 NCI_CGAP_Br18 Homo sapiens cDNA clone IMAGE:2568362 3' similar to gb:X15344 7735 20667 33964 15.89 5.0E-07 AW070885.1 EST_HUMAN CYTOCHROME C OXIDASE POLYPEPTIDE VIA-LIVER (HUMAN); ADAM-TS 1 PRECURSOR (A DISINTERGRIN AND METALLOPROTEINASE WITH THROMBOSPONDIN 8851 21781 35128 1.11 5.0E-07 Q9WUQ1 SWISSPROT MOTIFS 1) (ADAMTS-1) (ADAM-TS1) 9059 21988 1.04 5.0E-07 P09593 SWISSPROT S-ANTIGEN PROTEIN PRECURSOR 10854 23740 37163 7.25 5.0E-07 AI908587.1 EST_HUMAN CM-BT178-220499-014 BT178 Homo sapiens cDNA 11106 24037 37482 1.56 5.0E-07 P08547 SWISSPROT LINE-1 REVERSE TRANSCRIPTASE HOMOLOG 11947 24791 38289 3.91 5.0E-07 P11087 SWISSPROT COLLAGEN ALPHA 1(I) CHAIN PRECURSOR 12012 24854 2.6 5.0E-07 AJ271735 NT Homo sapiens Xq pseudoautosomal region; segment 1/2 12890 25774 3.27 5.0E-07 AW862537.1 EST_HUMAN QV0-CT0383-210400-204-b12 CT0383 Homo sapiens cDNA 4085 17110 29989 1.66 4.0E-07 AW009602.1 EST_HUMAN ws84h05.x1 NCI_CGAP_Co3 Homo sapiens cDNA clone IMAGE:2504697 3' 7542 20481 0.99 4.0E-07 AJ2722675.1 NT Homo sapiens SPP2 gene for secreted phosphoprotein 24 preucursor, exons 1-8 7643 20578 33872 0.58 4.0E-07 Q9Z2V6 SWISSPROT HISTONE DEACETYLASE 5 (HD5) (HISTONE DEACETYLASE MHDA1) 7643 20578 33873 0.58 4.0E-07 Q9Z2V6 SWISSPROT HISTONE DEACETYLASE 5 (HD5) (HISTONE DEACETYLASE MHDA1) 8501 21432 34773 0.85 4.0E-07 AL163207.2 NT Homo sapiens chromosome 21 segment HS21C007 9604 22530 35897 4.84 4.0E-07 AW419134.1 EST_HUMAN xy49g11.x1 NCI_CGAP_Lu34.1 Homo sapiens cDNA clone IMAGE:2856548 3' Page 213 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 10814 23700 37128 0.65 4.0E-07 AL163218.2 NT Homo sapiens chromosome 21 segment HS@1C018 11376 24292 37736 3.3 4.0E-07 AI765528.1 EST_HUMAN wi81b08.x1 NCI_CGAP_KId12 Homo sapiens cDNA clone IMAGE:2399703 3' 11376 24292 37737 3.3 4.0E-07 AI765528.1 EST_HUMAN wi81b08.x1 NCI_CGAP_KId12 Homo sapiens cDNA clone IMAGE:2399703 3' 11670 24574 1.78 4.0E-07 BE001828.1 EST_HUMAN PM1-BN0083-030300-003-e12 BN0083 Homo sapiens cDNA Human microfibril-associated glycoprotein (MFAP2) gene, putative promoter regionand alternatively spliced 464 13536 26456 4.44 3.0E-07 U19719.1 NT untranslated exons 604 13670 26573 1.46 3.0E-07 AJ271735.1 NT Homo sapiens Xq pseudoautosomal region; segment 1/2 1401 14432 27387 2.03 3.0E-07 M99149.1 NT Human polymorphic microsatelite DNA 1649 14680 2.08 3.0E-07 M64857.1 NT Human IgK subgroup I gemiline gene, exons 1 and 2, V-region 018 allele nl56b09.s1 NCI_CGAP_Ov2 Homo sapiens cDNA clone IMAGE:980825 similar to contains Alu repetitive 2060 15076 1.07 3.0E-07 AA526763.1 EST_HUMAN element; contains L1.t3 L1 repetitive element ; 2307 15315 28318 1.77 3.0E-07 M99149.1 NT Human polymorphic microsatellite DNA 2492 15494 28494 4.09 3.0E-07 BE005077.1 EST_HUMAN MR0-BN0115-020300-001-f11 BN0115 Homo sapiens cDNA 2492 15494 28495 4.09 3.0E-07 BE005077.1 EST_HUMAN MR0-BN0115-020300-001-f11 BN0115 Homo sapiens cDNA 3081 16132 29028 0.64 3.0E-07 T84704.1 EST_HUMAN yd50f12.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:111695 5' 3202 16250 29146 2.3 3.0E-07 P38739 SWISSPROT HYPOTHETICAL 63.8 KD PROTEIN IN GUT1-RIM1 INTERGENIC REGION PRECURSOR 4840 17841 30710 8.54 3.0E-07 AV650201.1 EST_HUMAN AV650201 GLC Homo sapiens cDNA clone GLCCCD01 3' 4876 17875 30740 0.87 3.0E-07 AI797236.1 EST_HUMAN we86b12.x1 Soares_NFL_T_GBC_s1 Homo sapiens cDNA clone IMAGE:2347967 3' yc14h09.s1 Stratagene lung (#937210) Homo sapiens cDNA clone IMAGE:80705 3' similar to similar to 5198 18190 31031 1.7 3.0E-07 T57850.1 EST_HUMAN gb:M62982 ARACHIDONATE 12-LIPOXYGENASE (HUMAN) yc14h09.s1 Stratagene lung (#937210) Homo sapiens cDNA clone IMAGE:80705 3' similar to similar to 5198 18190 31032 1.7 3.0E-07 T57850.1 EST_HUMAN gb:M62982 ARACHIDONATE 12-LIPOXYGENASE (HUMAN) PROTEIN-ARGININE DEIMINASE TYPE IV (PEPTIDYLARGININE DEIMINASE IV) (PAD-R4) 5863 18934 32053 11.51 3.0E-07 O88807 SWISSPROT (PEPTIDYLARGININE DEIMINASE TYPE ALPHA) 6202 19258 32405 0.81 3.0E-07 O42280 SWISSPROT WNT-14 PROTEIN PRECURSOR 7000 20027 4.92 3.0E-07 AA815175.1 EST_HUMAN cc04c10.s1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE:1339890 3' 7932 20854 34162 4.02 3.0E-07 AW797168.1 EST_HUMAN QV1-UM0036-200300-115-g02 UM0036 Homo sapiens cDNA tw28f11.x1 NCI_CGAP_Ov35 Homo sapiens cDNA clone IMAGE:2261037 3' similar to contains Alu 8114 21025 0.75 3.0E-07 AI591065.1 EST_HUMAN repetitive element; contains element MSR1 MSR1 repetitive element ; 11931 24776 1.48 3.0E-07 BE439409.1 EST_HUMAN HTMA-025F1 HTMA Homo sapiens cDNA 12084 24925 2.07 3.0E-07 AF029308.1 NT Homo sapiens chromosome 9 duplication of the T cell receptor beta locus and trypsinogen gene famillies 13092 25609 6.32 3.0E-07 AJ132352.1 NT Rattus norvegicus mRNA for 45 kDa secretory protein, partial 30 13146 26034 2.82 2.0E-07 AF262988.1 NT Homo sapiens TRF2-interacting telomeric RAP1 protein (RAP1) mRNA, complete cds Page 214 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 164 13265 26182 6.85 2.0E-07 L77569.1 NT Homo sapiens DiGeorge syndrome critical region, telomeric end 164 13265 26183 6.85 2.0E-07 L77569.1 NT Homo sapiens DiGeorge syndrome critical region, telomeric end 193 13291 26206 33.69 2.0E-07 U38849.1 NT Fugu rubripes beta-cytoplasmic (vascular)actin gene, complete cds 772 13829 26760 3.24 2.0E-07 AF003530.1 NT Homo sapiens homeobox protein CDX4 (CDX4)gene, complete cds and flanking repeat regions 772 13829 26761 3.24 2.0E-07 AF003530.1 NT Homo sapiens homeobox protein CDX4 (CDX4)gene, complete cds and flanking repeat regions RETROVIRUS-RELATED POL POLYPROTEIN [CONTAINS: REVERSE TRANSCRIPTASE ; 785 13841 0.86 2.0E-07 P11369 SWISSPROT ENDONUCLEASE] zr08b07.s1 Stratagene NT2 neuronal precursor 937230 Homo sapiens cDNA clone IMAGE:6508693' similar 971 14022 26966 2.78 2.0E-07 AA22326.1 EST_HUMAN to gb:L31860 GLYCOPHORIN A PRECURSOR (HUMAN); contains Alu repetitie element; yc15g04.s1 Stratagene lung(#937210) Homo sapiens cDNA clone IMAGE:80790 3' similar to contains L1 972 14023 26967 7.01 2.0E-07 T63042.1 EST_HUMAN repetitie element ; 1190 1422927168 0.95 2.0E-07 Q26768 SWISSPROT I/6 AUTOANTIGEN 1623 14653 27617 2.21 2.0E-07 Q09701 SWISSPROT HYPOTHETICAL 72.5 KD PROTEIN C2F7.10 IN CHROMOSOME I 3684 16717 0.66 2.0E-07 BF131397.1 EST_HUMAN 601818916F1 NIH_MGC_58 Homo sapiens cDNA clone IMAGE:4044891 5' 3754 16786 29675 26 2.0E-07 AF125348.1 NT Homo sapiens caveolin 1 (CAV1) gene, exon 3 and partial cds 5280 18266 0.78 2.0E-07 AW902219.1 EST_HUMAN QV3-NN1023-260400-168-h11 NN1023 Homo sapiens cDNA 5528 18607 31455 1.79 2.0E-07 AW898066.1 EST_HUMAN RC3-NN0066-260400-021-g11 NN0066 Homo sapiens cDNA 6831 25655 33077 0.69 2.0E-07 AW448968.1 EST_HUMAN UI-H-BI3-ake-b-01-0-UI.s1 NCI_CGAP_Sub5 Homo sapiens cDNA clone IMAGE:2734008 3' 6957 19986 33210 1.78 2.0E-07 AI208715.1 EST_HUMAN qg56d05.x1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1839177 3' nm33a05.s1 NCI_CGAP_Lip2 Homo sapiens cDNA clone IMAGE:1061938 similar to contains Alu repetitive 6971 1999833228 0.57 2.0E-07 AA572953.1 EST_HUMAN element; 903921968 4.66 2.0E-07 AV729390.1 EST_HUMAN AV729390 HTC Homo sapiens cDNA clone HTCAEG02 5' 9253 22181 35535 1.24 2.0E-07 AA035198.1 EST_HUMAN zk27g09.s1 Soares_pregnant_uterus_NbHPU Homo sapiens cDNA clone IMAGE:471808 3' 10281 23171 1.73 2.0E-07 AL163303.2 NT Homo sapiens chromosome 21 segment HS21C103 1076023646 37079 7.43 2.0E-07 AW892507.1 EST_HUMAN CM4-NN0003-280300-124-e06 NN0003 Homo sapiens cDNA COMPLEMENT FACTOR B PRECURSOR (C3/C5 CNVERTASE) (PROPERDIN FACTOR B) 10967 23851 37275 1.08 2.0E-07 P00751 SWISSPROT (GLYCINE-RICH BETA GLYCOPROTEIN) (GBG) (PBF2) COMPLEMENT FACTOR B PRECURSOR (C3/C5 CNVERTASE) (PROPERDIN FACTOR B) 10967 23851 37276 1.08 2.0E-07 P00751 SWISSPROT (GLYCINE-RICH BETA GLYCOPROTEIN) (GBG) (PBF2) 12231 25525 1.88 2.0E-07 BE153717.1 EST_HUMAN PM04 IT0339-260100-006-H07 HT0339 Homo sapiens cDNA zn85h11.x5 Stratagens lung carcinoma 937218 Homo sapiens cDNA clone IMAGE:565029 3' similar to 12309 26775 2.33 2.0E-07 AI732462.1 EST_HUMAN contains THR.b2 THR repetitive element ; 1129 14171 0.97 1.0E-07 AL163282.2 NT Homo sapiens chromosome 21 segment HS21C082 Page 215 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 1986 15004 27991 1.33 1.0E-07 AL163213.2 NT Homo sapiens chromsome 21 segment HS21C013 1986 15004 27992 1.33 1.0E-07 AL163213.2 NT Homo sapiens chromsome 21 segment HS21C013 2406 15411 28414 0.94 1.0E-07 P10263 SWISSPROT TETROVIRUS-RELATED GAG POLYPROTEIN (VERSION 1) 2875 14575 27535 2.43 1.0E-07 P09256 SWISSPROT GLYCOPROTEIN GPV 3807 14171 1.11 1.0E-07 AL163282.2 NT Homo sapiens chromosme 21 segment HS21C082 4395 17408 30274 3.97 1.0E-07 AV718662.1 EST_HUMAN AV718662 GLC Homo sapiens cDNA clone GLCFNF04 5' 4395 17408 30275 3.97 1.0E-07 AV718662.1 EST_HUMAN AV718662 GLC Homo sapiens cDNA clone GLCFNF04 5' Homo sapiens chromosome Xq28 melanoma antigen family A2a (MAGEA2A), melanoma antigen family A12 (MAGEA12), melanoma antigen family A2b (MAGEA2B), melanoma antigen family A3 (MAGEA3), caltractin 6780 19813 33025 1.27 1.0E-07 U82671.2 NT (CALT), NAD(P)H dehydrogenase-like protein (NSDHL), and LI> 7192 20192 33435 5.49 1.0E-07 BE047871.1 EST_HUMAN tz43d06.y1 NCI_CGAP_Brn52 Homo sapiens cDNA clone IMAGE:2291339 5' 7192 20192 33436 5.49 1.0E-07 BE047871.1 EST_HUMAN tz43d06.y1 NCI_CGAP_Brn52 Homo sapiens cDNA clone IMAGE:2291339 5' 7914 20838 34141 8.93 1.0E-07 N55081.1 EST_HUMAN yv43c07.s1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:245484 3' 8097 21009 34334 0.68 1.0E-07 BF375909.1 EST_HUMAN PM4-TN0024-030800-002-b05 TN0024 Homo sapiens cDNA 8097 21009 34335 0.68 1.0E-07 BF375909.1 EST_HUMAN PM4-TN0024-030800-002-b05 TN0024 Homo sapiens cDNA 3130 21040 34369 1.32 1.0E-07 AL163281.2 NT Homo sapiens chromosome 21 segment HS21C081 8354 21259 34593 0.46 1.0E-07 AL163203.2 NT Homo sapiens chromosome 21 segment HS21C003 8794 21724 35071 2.11 1.0E-07 P97436 SWISSPROT ENTEROPEPTIDASE (ENTEROKINASE) 8794 21724 35072 2.11 1.0E-07 P97436 SWISSPROT ENTEROPEPTIDASE (ENTEROKINASE) 9509 22436 35800 3.72 1.0E-07 AA693576.1 EST_HUMAN zi51e10.s1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:434346 3' ADAM-TS 8 PRECURSOR (A DISINTEGRIN AND METALLOPROTEINASE WITH THROMBOSPONDIN 9810 22716 36098 1.14 1.0E-07 P57110 SWISSPROT MOTIFS 8) (ADAMTS-8) (ADAM-TS8) (METH-2) hu28h06.x1 NCl-CGAP_Mel15 Homo sapiens cDNA clone IMAGE:3171419 3' similar to contain MER18.t3 10143 23034 36432 0.56 1.0E-07 BE327843.1 EST_HUMAN MER18 repetitive element; 10445 23334 36752 3.54 1.0E-07 BF674524.1 EST_HUMAN 602137714F1 NIH_MGC_83 Homo sapiens cDNA clone IMAGE:4274426 5' 10453 23342 36759 1.25 1.0E-07 AA386311.1 EST_HUMAN EST185054 Brain IV Homo sapiens cDNA 10943 23828 1.54 1.0E-07 AL163282.2 NT Homo sapiens chromosome 21 segment HS21C082 hr53c11.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:3132212 3' similar to TR:O95722 O95722 12558 25754 31571 2.88 1.0E-07 BE04877.1 EST_HUMAN DJ1163J1.1 ; 7660 20594 33892 0.75 9.0E-08 AI539362.1 EST_HUMAN te51b06.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2090195 3' 10399 23288 36710 2.31 9.0E-08 AV734819.1 EST_HUMAN AV734819 cdA Homo sapiens cDNA clone cdABFB06 5' wn30e07.x1 NCI_CGAP_Gas4 Homo sapiens cDNA clone IMAGE:2446932 3' similar to contains OFR.t2 11626 24533 38002 2.18 AI891052.1 EST_HUMAN OFR repetitive element ; 12093 24934 38441 2.86 9.0E-08 AL163301.2 NT Homo sapiens chromosome 21 segment HS21C1010 Page 216 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 12509 25243 2.37 9.0E-08 AJ251973.1 NT Homo sapiens partial steerin-1 gene 630 15879 3.17 8.0E-08 AI911352.1 EST_HUMAN wd18b05.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2328273 3' 1076 14120 0.81 8.0E-08 BE795469.1 EST_HUMAN 601590133F1 NICH_MGC_7 Homo sapiens cDNA clone IMAGE:3943976 5' 3063 16640 1.22 8.0E-08 BE795469.1 EST_HUMAN 601590133F1 NICH_MGC_7 Homo sapiens cDNA clone IMAGE:3943976 5' 9298 22226 35585 3.14 8.0E-08 AI752367.1 EST_HUMAN cn15c02.x1 Normal Human Trabecular Bone Cells Homo sapiens cDNA clone NHTBC_cn15c02 random 9298 22226 35586 3.14 8.0E-08 AI752367.1 EST_HUMAN cn15c02.x1 Normal Human Trabecular Bone Cells Homo sapiens cDNA clone NHTBC_cn15c02 random 10153 23044 36443 3.47 8.0E-08 AW970693.1 EST_HUMAN EST382776 MAGE resequences, MAGK Homo sapiens cDNA 11692 24594 2.08 8.0E-08 AF253417.1 NT Homo sapiens microsomal apoxide hydrolase (EPHX1) gene, complete cds 83 13196 26109 2.1 7.0E-08 Q02357 SWISSPROT ANKYRIN 1 (ERYTHROCYTE ANKYRIN) 1388 14419 27374 6.53 7.0E-08 X04809.1 NT Rat mRNA for ribosomal protein L31 3637 16673 29570 1.33 7.0E-08 P15305 SWISSPROT DYNEIN HEAW CHAIN (DYHC) 3637 16673 29571 1.33 7.0E-08 P15305 SWISSPROT DYNEIN HEAW CHAIN (DYHC) 11253 24177 2.02 7.0E-08 AI535743.1 EST_HUMAN cong3.P11.A5 conom Homo sapiens cDNA 3' 12098 24939 38443 5.9 7.0E-08 U24070.1 NT Ratt.is norvegicus Munc13-1 mRNA, complete cds 12942 16673 29570 3.2 7.0E-08 P15305 SWISSPROT DYNEIN HEAVY CHAIN (DYHC) 12942 16673 29571 3.2 7.0E-08 P15305 SWISSPROT DYNEIN HEAVY CHAIN (DYHC) 842 13897 26834 3.05 6.0E-08 AL163248.2 NT Homo sapiens chromosome 21 segment HS21C048 842 13897 26835 3.05 6.0E-08 AL163248.2 NT Homo sapiens chromosome 21 segment HS21C048 2386 15391 28395 1.7 6.0E-08 BE1443981. EST_HUMAN MR0-HT0166-19199-004-g09 HT0166 Homo sapiens cDNA 3109 16160 29056 0.99 6.0E-08 7662473 NT Homo sapiens KIAA1074 protein (KIAA1074), mRNA 4346 17360 30225 1.12 6.0E-08 AL163248.2 NT Homo sapiens chromosome 21 segment HS21C048 8529 21460 0.7 6.0E-08 P08547 SWISSPROT LINE-1 REVERSE TRANSCRIP TASE HOMOLOG ob56c05.s1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE:1335368 3' similar to contains 9868 22783 0.66 6.0E-08 AA827075.1 EST_HUMAN MER12.b3 MER12 repetitive element ; RETROVIRUS-RELATED POL POLYPROTEIN [CONTAINS: REVERSE TRANSCRIPTASE ; 11848 24698 38189 2.34 6.0E-08 P11369 SWISSPROT ENDONUCLEASE] 11964 24807 1.64 6.0E-08 AL163209.2 NT Homo sapiens chromosome 21 segment HS21C009 87 13200 26113 2.33 5.0E-08 AL163303.2 NT Homo sapiens chromosome 21 segment HS21C103 nb03b09.s1 NCI_CGAP_Thy1 Homo sapiens cDNA clone IMAGE:943193 smilar to contains Alu repetitive 2251 15261 28270 2.16 5.0E-08 AA493851.1 EST_HUMAN element; 12272 25088 6.77 5.0E-08 P06681 SWISSPROT COMPLEMENT C2 PRECURSOR (C35.0E-08C5 CONVERTASE) 12448 25201 31849 1.56 5.0E-08 AW851878.1 EST_HUMAN QV0-CT0225-131099-034-a12 CT0225 Homo sapiens cDNA Page 217 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 1785 14811 2779 1.19 4.0E-08 P25723 SWISSPROT DORSAL-VENTRAL PATIENING TOLLOID PROTEIN PRECURSOR 1785 14811 2780 1.19 4.0E-08 P25723 SWISSPROT DORSAL-VENTRAL PATIENING TOLLOID PROTEIN PRECURSOR 2927 15980 0.96 4.0E-08 AL079581.1 EST_HUMAN DKFZp434J0426_r1 434 (synonym: htes3) Homo sapiens cDNA clone DKFZp434J0426 5' oz05e02.x1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:1674458 3' similar to 3112 16163 1.35 4.0E-08 AI078417.1 EST_HUMAN contains Alu repetitive element; 3987 17014 29903 0.72 4.0E-08 U82668.1 NT Homo sapiens shox gene, alternatively spliced producte, complete cds 6670 19707 32902 1.08 4.0E-08 P52624 SWISSPROT URIDINE PHOSPHORYLASE (UDRPASE) 9356 22284 35646 0.79 4.0E-08 O15393 SWISSPROT TRANSMEMBRANE PROTEASE, SERINE 2 9682 22608 35981 0.84 4.0E-08 L42571.1 NT Cricetulus griseus ribosomal transcription factor (UBF2) mRNA, complete cds 10171 23062 0.95 4.0E-08 P08547 SWISSPROT LINE-1 REVERSE TRANSCRIPTASE HOMOLOG 10819 23705 1.48 4.0E-08 AI016342.1 EST_HUMAN ct78d12.s1 Soares_total_fetus_Nib2HF8_9w Homo sapiens cDNA clone IMAGE:1622903 3' en22d10.x1 Gessier Wilms tumor Homo sapiens cDNA clone IMAGE:1699411 3' similar to contains Alu 10874 23760 37187 4.41 4.0E-08 AI050027.1 EST_HUMAN repetitive element;containe element MER22 repetitive element ; zt76b08.r1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:728247 5' similar to TR:G505579 11512 24422 37878 1.69 4.0E-08 AA393627.1 EST_HUMAN G505579 NA/CA,K-EXCHANGER. ; zt76b08.r1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:728247 5' similar to TR:G505579 11512 24422 37879 1.69 4.0E-08 AA393627.1 EST_HUMAN G505579 NA/CA,K-EXCHANGER. ; 11533 24443 37903 3.91 4.0E-08 BF692493.1 EST_HUMAN 602248024F1 NIH_MGC_62 clone IMAGE: cDNA clone IMAGE:4333300 5' 11533 24443 37904 3.91 4.0E-08 BF692493.1 EST_HUMAN 602248024F1 NIH_MGC_62 clone IMAGE: cDNA clone IMAGE:4333300 5' zd65g03.r1 Soares_fetal_heart_NbHH19W Homo sapiens cDNA clone IMAGE:345556 5' similar to contains 12277 25888 1.88 4.0E-08 W76159.1 EST_HUMAN L1.t1 L1 repetitive element ; tb95a11.x1 NCI_CGAP_Co16 Homo sapiens cDNA clone IMAGE:2062076 3' similar to contains MER18.b3 12878 25476 2.28 4.0E-08 AI343353.1 EST_HUMAN MER18 MER18 repetitive element ; bb79a10.y1 NIH_MGC_10 Homo sapiens cDNA clone IMAGE:3048570 5' similar to TR;Q9Z158 Q9Z158 5805 18877 31984 2.76 3.0E-08 BE018348.1 EST_HUMAN SYNTAXIN 17.; 7316 18484 31308 4.02 3.0E-08 AI792737.1 EST_HUMAN qs76f11.y5 NCI_CGAP_Pr28 Homo sapiens cDNA clone IMAGE:1944045 5' 7969 20891 34203 1.5 3.0E-08 AL163246.2 NT Homo sapiens chromosome 21 segment HS21C046 th93h09.x1 Soares_NSF_F8_9W_OT_PA_P_S1 Homo sapiens cDNA clone IMAGE:2126273 3' similar to 8216 21121 3.33 3.0E-08 AI436352.1 EST_HUMAN TR:Q13537 Q13537 MER37 TRANSPOSABLE ELEMENT, COMPLETE CONSENSUS SEQUENCE. ; 10410 23299 0.67 3.0E-08 AF055066.1 NT Homo sapiens MHC class 1 region yp12b10.s1 Soares breast 3NbHBst Homo sapiens cDNA clone IMAGE:187195 3' similar to gb:M34079 TAT 12006 24843 38346 1.53 3.0E-08 R86279.1 EST_HUMAN BINDING PROTEIN-1 (HUMAN); Page 218 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value yp12b10.s1 Soares breast 3NbHBst Homo sapiens cDNA clone IMAGE:187195 3' similar to gb:M34079 TAT 12006 24843 38347 1.53 3.0E-08 R86279.1 EST_HUMAN BINDING PROTEIN-1 (HUMAN); yg02f04.r1 Soares infant brain 1NIB Homo sapiens cDNA clone IMAGE:30948 5' similar to contains Alu 12247 25070 28.09 3.0E-08 R18420.1 EST_HUMAN repetitive element; 219 13318 6.29 2.0E-08 AW302996.1 EST_HUMAN xr87f06.x1 NCI_CGAP_Lu26 Homo sapiens cDNA clone IMAGE:2767139 3' zw48f07.r1 Soares_total_fetus_Nb2HF8_9w Homo sapiens cDNA clone IMAGE:773317 5' similar to contains 246 13344 5.67 2.0E-08 AA425598.1 EST_HUMAN Alu repetitive element;contains element MER15 repetitive element ; 519 13589 26502 2.35 2.0E-08 AF198349.1 NT Gallus gallus Dach2 protein (Dach2) mRNA, complete cds 683 13745 26659 8.21 2.0E-08 AW886438.1 EST_HUMAN MR0-OT0080-240200-001-g08 OT0080 Homo sapiens cDNA 683 13745 26660 8.21 2.0E-08 AW886438.1 EST_HUMAN MR0-OT0080-240200-001-g08 OT0080 Homo sapiens cDNA 1017 14067 19.93 2.0E-08 BE280477.1 EST_HUMAN 601155321F1 NIH_MGC_21 Homo sapiens cDNA clone IMAGE:3138893 5' 1371 14403 27357 1.66 2.0E-08 AL163247.2 NT Homo sapiens chromosome 21 segment HS21C047 1769 14795 2.44 2.0E-08 BE73487.11 EST_HUMAN 601570463F1 NIH_MGC-21 Homo sapiens cDNA clone IMAGE:3645199 5' 1879 14900 3.29 2.0E-08 AW270271.1 EST_HUMAN xp43f11.x1 NCI_CGAP_HN11 Homo sapiens cDNA clone IMAGE:2743149 3' 2574 15573 19.96 2.0E-08 K00216.1 NT Sheep His-tRNA-GUG 3253 16301 29206 6.87 2.0E-08 O42280 SWISSPROT WNT-14 PROTEIN PRECURSOR 3253 16301 29207 6.87 2.0E-08 O42280 SWISSPROT WNT-14 PROTEIN PRECURSOR 3926 16954 2.68 2.0E-08 AW813620.1 EST_HUMAN RC3-ST0197-161099-0120-b03 ST0197 Homo sapiens cDNA 4164 17185 30058 0.73 2.0E-08 U82668.1 NT Homo sapiens shox gene, alternatively spliced products, complete cds aa26c07.r1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE:814380 5' similar to contains L1.t2 L1 4511 17521 2.15 2.0E-08 AA459040.1 EST_HUMAN repetitive element ; he17h08.x2 NCI_CGAP_CML1 Homo sapiens cDNA clone IMAGE:2919327 3' similar to containe Alu 5072 18069 4.82 2.0E-08 AW572881.1 EST_HUMAN repetitive element; 5832 18903 32018 0.9 2.0E-08 AA813204.1 EST_HUMAN al80h11.s1 Soares_testis_NHT Homo sapiens cDNA clone 1377189 3' xd32c04.x1 NCI_CGAP_Ov23 Homo sapiens cDNA clone IMAGE:2595462 3' similar to contains MER18.b3 6046 19108 32238 0.87 2.0E-08 AW088924.1 EST_HUMAN MER18 MER18 repetitive element ; 8583 21514 34858 0.95 2.0E-08 P10272 SWISSPROT POL POLYPROTEIN [CONTAINS: PROTEASE ; REVERSE TRANSCRIPTASE ; ENDONUCLEASE] 8688 21619 34961 1.57 2.0E-08 AA490121.1 EST_HUMAN ab02g06.s1 Stratagene fetal retina 937202 Homo sapiens cDNA clone IMAGE:839674 3' 9631 22557 1.1 EST_HUMAN AU139978.1 EST_HUMAN AU139978 PLACE 1 Homo sapiens cDNA clone PLACE1011719 6' yv72f02.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:248283 5' similar to contains 10999 23883 37314 0.91 2.0E-08 N78097.1 EST_HUMAN LTR1.b3 LTR1 repetitive element ; yv72f02.r1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:248283 5' similar to contains 10999 23883 37315 0.91 2.0E-08 N78097.1 EST_HUMAN LTR1.b3 LTR1 repetitive element ; 13008 25929 1.77 2.0E-08 11431676 NT Homo sapiens hypothetical protein FLJ11342 (FLJ11342), mRNA Page 219 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 1529 15903 27519 1.33 1.0E-08 P31792 SWISSPROT POL POLYPROTEIN [CONTAINS: REVERSE TRANSCRIPTASE ; ENDONUCLEASE] 1800 14826 27794 1.79 1.0E-08 AF125348.1 NT Homo sapiens caveolin 1 (CAV1) gene, exon 3 and partial cds 2065 15080 2.52 1.0E-08 BE141959.1 EST_HUMAN PM2-HT0130-150999-001-f12 HT0130 Homo sapiens cDNA TCBAP 1D5232 Pediatric pre-B cell acute lymphoblastic leukemia Baylor-HGSC project=TCBA Homo 3235 16283 29184 1.16 1.0E-08 BE246844.1 EST_HUMAN sapiens cDNA clone TCBAP5232 TCBAP 1D5232 Pediatric pre-B cell acute lymphoblastic leukemia Baylor-HGSC project=TCBA Homo 3235 16283 29185 1.16 1.0E-08 BE246844.1 EST_HUMAN sapiens cDNA clone TCBAP5232 5793 18865 31973 3.89 1.0E-08 AJ010770.1 NT Homo sapiens hyperion gene, exons 1-50 8238 21143 34476 1.14 1.0E-08 P19474 SWISSPROT 52 KD RO PROTEIN (SJOGREN SYNDROME TYPE A ANTIGEN (SS-A)) (RO(SS-A)) 9111 22039 35395 2.15 1.0E-08 AI015304.1 EST_HUMAN ot35a05.s1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1619736 3' 9746 22670 36053 0.75 1.0E-08 BE072572.1 EST_HUMAN PM2-BT0546-210100-004-d02 BT0546 Homo sapiens cDNA TRICARBOXYLATE TRANSPROT PROTEIN PRECURSOR (CUITRATE TRANSPORT PROTEIN) (CTP) 10472 23360 36774 0.95 1.0E-08 P79110 SWISSPROT (TRICARBOXYLATE CARRIER PROTEIN) 11032 23916 37358 0.65 1.0E-08 P98063 SWISSPROT BONE MORPHOGENETIC PROTEIN 1 PRECURSOR (BMP-1) 11760 24661 38146 4.28 1.0E-08 AF44083.1 NT Homo sapiens major histocompatibility locus class III region 12622 25307 1.89 1.0E-08 X51755.1 NT Homo sapiens lambda-8immunoglobulin constant region complex (germiline) 4341 17355 30219 5.3 9.0E-09 AL163279.2 NT Homo sapiens chromosome 21 segment HS21C079 4341 17355 30220 5.3 9.0E-09 AL163279.2 NT Homo sapiens chromosome 21 segment HS21C079 10564 23450 0.59 9.0E-09 T97950.1 EST_HUMAN ya58a12.s1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:121918 3' qu86c11.x1 NCI_CGAP_Gas4 Homo sapiens cDNA clone IMAGE:1978964 3' similar to contans L1.t3 L1 6756 19790 0.57 8.0E-09 AI270615.1 EST_HUMAN repetitive element ; qd42e07.x1 Soares_fetal_heart_NbHH19W Homo sapiens cDNA clone IMAGE:1732164 3' similar to 7639 20574 33868 7.89 8.0E-09 AI83500.1 EST_HUMAN contains MSR1.t1 MSR repetitive element ; 8679 21510 34856 2.58 8.0E-09 AW900159.1 EST_HUMAN CM0-NN1004-100300-273-e06 NN1004 Homo sapiens cDNA 9540 22467 3.07 8.0E-09 AA938892.1 EST_HUMAN op74d08.s1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:1582575 3' 3670 16703 2.5 7.0E-09 D86842.1 NT Homo sapiens DNA for 3-ketoacyl-CoA thiolase beta-subunit of mitochondrial trifunctional protein, exon 2,3 4093 17118 2.83 7.0E-09 U50871.1 NT Human familial Alzheimer's disease (STM2) gene, complete cds zr80c05.r1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:681992 5' similar to contains L1.t2 L1 8625 21556 0.94 7.0E-09 AA256200.1 EST_HUMAN repetitive element ; 9802 22708 36091 2.99 7.0E-09 L09709.1 NT Human lysosomal membrane glycoprotein-2 (LAMP2) gene, 5' end and flanking region 10680 23566 36996 1.86 7.0E-09 BE254850.1 EST_HUMAN 601111173F1 NIH_MGC-16 clone IMAGE: cDNA clone IMAGE:3351834 5' zf58e07.s1 Soares retina N2b4HR Homo sapiens cDNA clone IMAGE:381156 3' similar to contains L1.t2 L1 10833 23719 1.72 7.0E-09 AA058626.1 EST_HUMAN repetitive element ; Page 220 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 11117 24047 3.29 7.0E-09 T97950.1 EST_HUMAN ye58a12.s1 Soares fetal liver splean 1NFLS Homo sapiens cDNA clone IMAGE:121918 3' 5102 18099 30947 9.39 6.0E-09 BE16942.1 EST_HUMAN PM1-HT0527-160200-001-h05 HT0527 Homo sapiens cDNA nl17a11.s1 NCI_CGAP_HSC1 Homo sapiens cDNA clone IMAGE:1040924 similar to contains L1.t2L1 5392 18374 31215 1.19 6.0E-09 AA557940.1 EST_HUMAN repetitive element ; 5565 18643 31521 8.92 6.0E-09 AW195784.1 EST_HUMAN xn85h08.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2701311 3' 9139 22067 35428 1.4 6.0E-09 BE161653.1 EST_HUMAN MR3-HT0446-260300-201-h12 HT0446 Homo sapiens cDNA 9718 22643 36024 2.66 6.0E-09 4503710 NT Homo sapiens fibroblast growth factor receptor 3 (achondroplasla, thanalophoric dwarfism) (FGFR3) mRNA 10769 23655 4.23 6.0E-09 AF20923.2 NT Homo sapiens testis-specific kinase substrate (TSKS) gene, complete cds 7145e10.x1 Soares_NSF_F8_9W_OT_PA_P_S1 Homo sapiens cDNA clone IMAGE:352443 3' similar to 11173 24100 37546 1.41 6.0E-09 BF108755.1 EST_HUMAN contains MER29.b2 MER29 repetitive element ; 12122 24963 38466 1.8 6.0E-09 P08547 SWISSPROT LINE-1 REVERSE TRANSCRIP TASE HOMOLOG 12122 24963 38467 1.8 6.0E-09 P08547 SWISSPROT LINE-1 REVERSE TRANSCRIP TASE HOMOLOG 12197 25032 38533 1.49 6.0E-09 C01803.1 EST_HUMAN HUMGS0003762 Human adult (K.Okubo) Homo sapiens cDNA 1438 14469 27425 4.58 5.0E-09 BE149264.1 EST_HUMAN RC2-HT0252-120200-0140h10 HT0252 Homo sapiens cDNA 1877 14898 27882 1.16 5.0E-09 AL163284.2 NT Homo sapiens chromosome 21 segment HS21C084 6675 19712 32905 3.42 5.0E-09 AA359454.1 EST_HUMAN EST68746 Fatal lung II Homo sapiens cDNA 5' end Human germline T-cell receptor beta chain Dopamine-beta-hydroxylase-lie, TRY1, TRY2, TRY3, TCRBV27S1P, TCRBV22S1A2N1T, TCRBV9S1A1T, TCRBV7S1A1N2T, TCRBV5S1A1T, TCRBV13S3, TCRBV6S7P, TCRBV7SA2T, TCRBV13S2A1T, TCRB9S2A2PT, TCRBV7S2A1N4T, 7166 18438 31340 0.53 5.0E-09 U66059.1 NT TCRBV13S/13S> 10597 23483 36912 3.23 5.0E-09 AW799667.1 EST_HUMAN PM2-UM0053-240300-005-c09 UM0053 Homo sapiens cDNA 544 13613 1.75 4.0E-09 AL163282.2 NT Homo sapiens chromosome 21 segment HS21C082 991 14041 1.82 4.0E-09 AL163285.2 NT Homo sapiens chromosome 21 segment HS21C085 1488 14519 27480 1.57 4.0E-09 9558718 NT Homo sapiens hypothetical protein (AF038169), mRNA 2036 1553 28051 1.23 4.0E-09 AF176325.1 NT Homo sapiens eukaryotic initiation factor 4AI (EIF4A1) gene, partial cds 2036 1553 28052 1.23 4.0E-09 AF176325.1 NT Homo sapiens eukaryotic initiation factor 4AI (EIF4A1) gene, partial cds 2454 15458 28455 4.22 4.0E-09 AA350878.1 EST_HUMAN EST58385 Infant brain Homo sapiens cDNA 6' end similar to similar to heat shock protein, 90 kDa 8429 21361 34700 0.74 4.0E-09 AA495747.1 EST_HUMAN zw04c06.r1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE: 768298 6' 11514 24424 37882 1.58 4.0E-09 AI886401.1 EST_HUMAN wm94f10.x1 NCI_CGAP_Ut2 Homo sapiens cDNA clone IMAGE:2443627 3' zr34a12.r1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:665278 5' similar to gb:L07807 11557 24465 1.62 4.0E-09 AA195142.1 EST_HUMAN DYNAMIN-1 (HUMAN); hu0e09.x1 NCI_CGAP_Lu24 Homo sapiens cDNA clone IMAGE:166120 3' similar to contains MER18.t3 2374 15379 28381 4.49 3.0E-09 BE22239.1 EST_HUMAN MER 18 repetitive element; Page 221 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value hu09e09.x1 NCI_CGAP_Lu24 Homo sapiens cDNA clone IMAGE:3166120 3' similar to contains MER18.t3 2587 15585 28579 1.85 3.0E-09 BE222239.1 EST_HUMAN MER18 repetitive element; 2699 15693 28687 1.11 3.0E-09 P23249 SWISSPROT PROTEIN MOV-10 hu09e09.x1 NCI_CGAP_Lu24 Hoo sapiens cDNA clone IMAGE:3166120 3' similar to contains MER18.t3 3376 16420 29322 1.03 3.0E-09 BE222239.1 EST_HUMAN MER18 repetitive element; 3434 16475 0.75 3.0E-09 AA442272.1 EST_HUMAN zv54a04.r1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:757422 5' 4187 17207 0.64 3.0E-09 X16674.1 NT H.sapiens PADPRP-1 gene for NAD(+) ADP-ribosyltransferase 4533 17542 30404 4 3.0E-09 AF175325.1 NT Homo sapiens eukaryotic initialion factor 4Al(ElF4A1) gene, partial cds 4633 17639 30502 2.44 3.0E-09 Q9Y3R5 SWISSPORT 258.1 KDA PROTEIN C21ORF5 (KIAA0933) 5327 18311 0.9 3.0E-09 D86842.1 NT Homo sapiens DNA for 3-ketoacyl-CoA thiolase beta-subunit of mitochondrial trifunctional protein, exon 2, 3 hx80a02.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:3194090 3' similar to TR:O55091 8480 21411 34748 1.19 3.0E-09 BE465780.1 EST_HUMAN O55091 IMPACT PROTEIN.; 10741 23627 37057 2.07 3.0E-09 AL163247.2 NT Homo sapiens chromosome 21 segment HS21C047 11460 24375 37823 4.02 3.0E-09 BF109943.1 EST_HUMAN 7172c08.x1 Soares_NSF_F8_9W_OT_PA_P_S1 Homo sapiens cDNA clone IMAGE:3527030 3' 11460 24375 37824 4.02 3.0E-09 BF109943.1 EST_HUMAN 7172c08.x1 Soares_NSF_F8_9W_OT_PA_P_S1 Homo sapiens cDNA clone IMAGE:3527030 3' 1285 14318 27266 5.55 2.0E-09 AL163284.2 NT Homo sapiens chromosome 21 segment HS21C084 1685 14715 9.07 2.0E-09 AL118573.1 EST_HUMAN DKFZp761B1710_r1 761 (synonym:hamy2) Homo sapiens cDNA clone DKFZp761B1710 5' 2348 15356 28358 1.41 2.0E-09 Q9Y3R5 SWISSPROT 258.1 KDA PROTEIN C21ORF5 (KIAA0933) 4013 17040 29929 4.32 2.0E-09 O60241 SWISSPROT BRAIN-SPECIFIC ANCIOGENESIS INHIBITOR 2 PRECURSOR 5368 18350 31192 0.99 2.0E-09 P25823 SWISSPROT MATERNAL TUDOR PROTEIN 5921 18988 32107 0.61 2.0E-09 Al004062.1 EST_HUMAN ot47b09.s1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1619897 3' 6390 19439 0.62 2.0E-09 AL163249.2 NT Homo sapiens chromosome 21 segment HS21C049 7087 20293 0.68 2.0E-09 AA357407.1 EST_HUMAN EST66142Kidney IX Homo sapiens cDNA 5' end similar to EST containing L1 repeat zx63h06.r1 Soares_total_fetus_Nb2HF8_9W Homo sapiens cDNA clone IMAGE:796187 5' similar to contains 7855 20782 34086 8.73 2.0E-09 AA46143.1 EST_HUMAN Alu repetitive element, 7947 20869 34181 0.64 2.0E-09 W28834.1 EST_HUMAN 52d11 Human retina cDNA randomly primed sublibrary Homo sapiens cDNA 8269 21174 34509 0.46 2.0E-09 Al243732.1 EST_HUMAN qh88g10.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:1854114 3' 8347 21252 34586 0.53 2.0E-09 AW862126.1 EST_HUMAN MR1-CT0352-240200-105-b06 CT0352 Homo sapiens cDNA 9271 22199 35557 1.27 2.0E-09 AJ271735.1 NT Homo sapiens Xq pseudoautosomal region; segment 1/2 11712 24614 38090 1.87 2.0E-09 AL163248.2 NT Homo sapiens chromosome 21 segment HS21C048 12761 18422 15.23 2.0E-09 X16674.1 NT H.saplens PADPRP-1 gene for NAD(+) ADP-ribosyitransferase nc1 1c02.r1 NCI_CGAP_Pr1 Homo sapiens cDNA clone IMAGE:1007810 similar to contains Alu repetitive 12820 25957 1.74 2.0E-09 AA226070.1 EST_HUMAN element; Page 222 to 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value zd79d03.s1 Soares_fetal_heart_NbHH19W Homo sapiens cDNA clone IMAGE:346853 3' similar to 1022 14071 1.98 1.0E-09 W78152.1 EST_HUMAN 9b:L02932 PEROXISOME PROLIFERATOR ACTIVATED RECEPTOR ALPHA (HUMAN); 1136 14178 27115 1.51 1.0E-09 5031624 NT Homo sapiens CCAAT-box-binding transcription factor (CBF2) mRNA 1136 14178 27116 1.51 1.0E-09 5031624 NT Homo sapiens CCAAT-box-binding transcription factor (CBF2) mRNA 1658 14688 0.91 1.0E-09 AJ229041.1 NT Homo sapiens 959 kb contig between AML1 and CBR1 on chromosome 21q22; segment 1/3 qy64e11.x1 NCI_CGAP_Bm25 Homo sapiens cDNA clone IMAGE:2016812 3' similar to contains MER12.t2 2525 15526 1.28 1.0E-09 Al356086.1 EST_HUMAN MER12 repetitive element; Homo sapiens basic transcription factor 2 p44 (btf2p44) gene, partial cds, neuronal apoptosis inhibitory 2931 15984 28883 1.74 1.0E-09 U80017.1 NT protein (naip) and survival motor neuron protein (smn) genes, complete cds 2968 16020 28917 2.04 1.0E-09 M28699.1 NT Homo sapiens nucleolar phosphoprotein B23 (PM1) mRNA, complete cds 2968 16020 28918 2.04 1.0E-09 M28699.1 NT Homo sapiens nucleolar phosphoprotein B23 (PM1) mRNA, complete cds 3085 16136 29032 0.86 1.0E-09 BE535440.1 EST_HUMAN 601058602F1 NIH_MGC_10 Homo sapiens cDNA clone IMAGE:3445177 5' zh35b03.s1 Soares_pineal_gland_N3HPG Homo sapiens cDNA clone IMAGE:414029 3' similar to contains 4914 17913 6.56 1.0E-09 AA719297.1 EST_HUMAN Alu repefitive element contains element MER22 repetitive element; 5693 18766 31690 1.1 1.0E-09 AL163283.2 NT Homo sapiens chromosome 21 segment HS21C083 6043 19105 32235 1.39 1.0E-09 U07000.1 NT Human breakpoint cluster reglon (BCR) gene, complete cds 6384 19433 32600 3.04 1.0E-09 P26694 SWISSPROT CIRCUMSPOROZOITE PROTEIN PRECURSOR (CS) 8329 21234 34568 0.59 1.0E-09 AV728645.1 EST_HUMAN AV728645 HTC Homo sapiens cDNA clone HTCBIG07 5' wd39b05.x1 Soares_NFL_T_GBC_S1 homo sapiens cDNA clone IMAGE:2330481 3' similar to contains 8961 21892 35250 0.68 1.0E-09 Al688474.1 EST_HUMAN MER25.t1 MER25 repetitive element; 10803 23689 2.91 1.0E-09 AL163283.2 NT Homo sapiens chromosome 21 segment HS21C083 12198 25033 1.88 1.0E-09 AL163283.2 NT Homo sapiens chromosome 21 segment HS21C083 12670 25897 31481 1.52 1.0E-09 11418127 NT Homo sapiens GTP binding protein 1 (GTPBP1). mRNA 12778 25407 1.52 1.0E-09 T57366.1 EST_HUMAN yb51g12.s1 Stratagene fetal spleen (#937205) Homo sapiens cDNA clone IMAGE:74758 3' 13054 25821 2.18 1.0E-09 AF260225.1 NT Homo sapiens TESTIN 2 and TESTIN 3 genes, complete cds, alternatively spliced 1335 14369 27319 1.6 9.0E-10 AW867740.1 EST_HUMAN MR0-SN0040-050500-002-c07 SN0040 Homo sapiens cDNA we78h03.x1 Soares_Dieckgraefe_colon_NHCD Homo sapiens cDNA clone IMAGE:2347253 3' similar to 2881 15936 28841 5.32 9.0E-10 Al870071.1 EST_HUMAN SW:RL29_HUMAN P47914 603 RIBOSOMAL PROTEIN L29;contains element PTR5 repetitive element; tj46b09.x1 Soares_NSF_F8_9W_OT_PA_P_S1 Homo sapiens cDNA clone IMAGE:2144537 3' similar to 7147 20255 33507 4.51 9.0E-10 Al452982.1 EST_HUMAN TR:O00372 O00372 PUTATIVE P150.; 157 13257 26175 8.63 8.0E-10 U63630.2 NT Homo sapiens MCM4 (MCM4) and DNA-PKcs (PRKDC) genes, partial cds 3391 18434 29337 0.93 8.0E-10 BE080748.1 EST_HUMAN QV1-BT0631-150200-017-f01 BT0631 Homo sapiens cDNA 4297 17311 30177 4.53 8.0E-10 AA376832.1 EST_HUMAN EST89564 Small intestine 1 Homo sapiens cDNA 5' end Page 223 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 10471 23359 3.22 8.0E-10 U36308.2 NT Homo sapiens lens major intrinslc protein (MIP) gene, complete cds 725 13783 26707 17.58 7.0E-10 7706225 NT Homo sapiens TPA inducible protein (LOC51586), mRNA 725 13783 26708 17.58 7.0E-10 7706225 NT Homo sapiens TPA inducible protein (LOC51586), mRNA 1645 14676 27640 2.31 7.0E-10 Q13342 SWISSPROT LYSP 100 PROTEIN (LYMPHOID-RESTRICTED HOMOLOG OF SP100) 2594 15592 20.7 7.0E-10 P08547 SWISSPROT LINE-1 REVERSE TRANSCRIPTASE HOMOLOG 3137 16187 29079 2.65 7.0E-10 X00856.1 NT H.sapiens DHFR gene, exon 3 6426 19473 32647 4.28 7.0E-10 AA345220.1 EST_HUMAN EST51247 Gall bladder Il Homo sapiens cDNA 5' end 7817 20746 34051 1.36 7.0E-10 BF352883.1 EST_HUMAN IL3-HT0619-110700-209-D12HT0619 Homo sapiens cDNA 8106 21017 1.61 7.0E-10 P35084 SWISSPROT DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT 8554 21485 34825 1.44 7.0E-10 AF029701.2 NT Homo sapiens presenilin-1 gene, axons 1 and 2 8554 21485 34826 1.44 7.0E-10 AF029701.2 NT Homo sapiens presenilin-1 gene, axons 1 and 2 ho12g02.x1 NCI_CGAP_Co14 Homo sapiens cDNA clone IMAGE:3037202 3' similar to contains Alu 12085 24926 38430 1.82 7.0E-10 AW778769.1 EST_HUMAN repetitive element;contains MER7.b1 MER7 repetitive element; Homo sapiens ASCL3 gene, CEGP1 gene, C11orf14 gene, C11orf15 gene, C11orf16 gene and C11orf17 938 13990 26932 2.8 6.0E-10 AJ400877.1 NT gene 2726 15719 28716 1.66 6.0E-10 Al424405.1 EST_HUMAN tf02d07.x1 NCI_CGAP_Pr28 Homo sapians cDNA clone IMAGE:2095021 3' 4606 17614 30475 0.66 6.0E-10 Q02817 SWISSPROT MUCIN 2 PRECURSOR (IN TESTINAL MUCIN 2) 4852 17854 3.3 6.0E-10 AW863719.1 EST_HUMAN RC3-CT0254-031099-012-g12 CT0254 Homo sapiens cDNA E-SELECTIN PRECURSOR (ENDOTHELIAL LEUKOCYTE ADHESION MOLECULE 1)(ELAM-1) 9342 22270 35632 1.03 6.0E-10 P33730 SWISSPROT (LEUKOCYTE-ENDOTHELIAL CELL ADHESION MOLECULE 2)(LECAM2)(CD62E) E-SELECTIN PRECURSOR (ENDOTHELIAL LEUKOCYTE ADHESION MOLECULE 1)(ELAM-1) 9342 22270 35633 1.03 6.0E-10 P33730 SWISSPROT (LEUKOCYTE-ENDOTHELIAL CELL ADHESION MOLECULE 2)(LECAM2)(CD62E) 10160 23051 36452 0.7 6.0E-10 P98073 SWISSPORT ENTEROPEPTIDASE PRECURSOR (ENTEROKINASE) 785 13842 5.7 5.0E-10 AL046804.1 EST_HUMAN DKFZp434N291_r1 434 (synonym: htes3) Homo sapiens cDNA clone DKFZp434N219 5' 7706 20638 1.88 5.0E-10 BF105159.1 EST_HUMAN 601822184F1 NIH_MGC_75 Homo sapiens cDNA clone IMAGE:4042413 5' 10065 22981 36371 2.15 5.0E-10 P34678 SWISSPROT HYPOTHETICAL 67.9 KD PROTEIN ZK688.8 IN CHROMOSOME III 10065 22981 36372 2.15 5.0E-10 P34678 SWISSPROT HYPOTHETICAL 67.9 KD PROTEIN ZK688.8 IN CHROMOSOME III qg09f09.x1 Soares_placenta_Sto9weeks_2NbHP8to9W Homo sapiens cDNA clone IMAGE:1759049 3' 115 13223 1.09 4.0E-10 Al221083.1 EST_HUMAN similer to contains LTR8.b2 LTR8 repefitive element; hg58g03.x1 NCI_CGAP_GC6 Homo sapiens cDNA clone IMAGE:2949844 3' similar to contains Alu 2012 15030 28023 1.34 4.0E-10 AW594709.1 EST_HUMAN repetitive element; 2610 15608 28603 7.51 4.0E-10 AL163303.2 NT Homo sapiens chromosome 21 segment HS21C103 Homo sapiens mannosidase, beta, A, lysosomal (MANBA) gene, and ubiquitin-conjugating enzyme E2D 3 7540 20479 33767 18.76 4.0E-10 AF224669.1 NT (UBE2D3) genes, complete cds Page 224 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 10926 23811 37239 0.95 4.0E-10 Al267342.1 EST_HUMAN aq63h11.x1 Stanley Frontal SN pool 2 Homo sapiens cDNA clone IMAGE:2035653 yy32f06.s1 Soares melanocyte 2NbHM Homo saplens cDNA clone IMAGE:272963 3' similar to contains 940 13991 26934 1.42 3.0E-10 N36113.1 EST_HUMAN L1.t1 L1 repetitive element; 1380 14412 5.11 3.0E-10 AY005150.1 NT Homo sapiens extracellular glycoprotein lectitin precursor, gene, complete cds 4652 17658 30524 1.06 3.0E-10 AL163203.2 NT Homos sapiens chromosome 21 segment HS21C003 4652 17658 30525 1.06 3.0E-10 AL163203.2 NT Homos sapiens chromosome 21 segment HS21C003 5640 18715 31616 0.82 3.0E-10 N50109.1 EST_HUMAN yz1g08.s1 Soares_multiple_selerosis_2NbHMSP Homo sepiens cDNA clone IMAGE:282782 3' 6444 19490 32667 1.99 3.0E-10 P20350 SWISSPROT RHOMBOID PROTEIN (VEINLET PROTEIN) 6609 19650 32834 2.88 3.0E-10 BE302970.1 EST_HUMAN ba76d08.y1 NIH_MGC_20 Homo sapiens cDNA clone IMAGE:2906319 5' 8228 21133 34463 1.77 3.0E-10 AV743302.1 EST_HUMAN AV743302 CB Homo sapiens cDNA clone CBFBGD08 5' 8228 21133 34464 1.77 3.0E-10 AV743302.1 EST_HUMAN AV743302 CB Homo sapiens cDNA clone CBFBGD08 5' ys74b12s1 Sosres retina N2b4HR Homo sapiens cDNA cline IMAGE:220511 3' similar to contains MER29 9289 22217 35575 1.21 3.0E-10 H87208.1 EST_HUMAN repetitive element; 9602 22528 35894 1.72 3.0E-10 AW850731.1 EST_HUMAN IL3-CT0219-160200-064-B06 CT0219 Homo sapiens cDNA 9602 22528 35895 1.72 3.0E-10 AW850731.1 EST_HUMAN IL3-CT0219-160200-064-B06 CT0219 Homo sapiens cDNA 9879 22794 0.66 3.0E-10 AF020503.1 NT Homo saplens FRA3B common fragile region, diadenosine triphosphate hydrolase (FHIT) gene, exon 5 10941 23826 1.4 3.0E-10 T65891.1 EST_HUMAN yc11e12r1 Stratagene lung (#937210) Homo sapiens cDNA clone IMAGE:80398 5' 11065 23949 1.37 3.0E-10 AA769294.1 EST_HUMAN nz36g03.s1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE:1289908 3' 12911 254949 31.768 2.23 3.0E-10 BE179517.1 EST_HUMAN IL3-HT0618-110500-136-E07 HT0618 Homo sapiens cDNA 37 3153 26042 1.43 2.0E-10 P48988 SWISSPROT MAJOR CENTROMERE AUTOANTIGEN B (CENTROMERE PROTEIN B)(CENP-B) 37 3153 26043 1.43 2.0E-10 P48988 SWISSPROT MAJOR CENTROMERE AUTOANTIGEN B (CENTROMERE PROTEIN B)(CENP-B) Homo sapiens basic transcription factor 2 p44 (btf2p44) gene, partial cds, neuronal apoptosis inhibitory 1915 14936 2.21 2.0E-10 U80017.1 NT protein (naip) and survival motor neuron protein (smn) genes, complete cds 3028 16080 0.65 2.0E-10 BF675047.1 EST_HUMAN 602136640F1 NIH_MGC_83 Homo sapiens cDNA clone IMaGE:4273377 5' 5362 18344 31188 1.52 2.0E-10 P11227 SWISSPROT POL POLYPROTEIN [CONTAINS:PROTEASE; REVERSE TRANSCRIPTASE;RIBONUCLEASE H] 6014 19077 2.91 2.0E-10 Q26640 SWISSPROT (HPRG) Homo sapiens cytochrome P450 polypetide 43 (CYP3A43) gene, partial cds; cytchreme P450 polypetide 4(CYP3A4) and cytochrome P450 polypetide 7 (CYP3A7) genes, complete cds: and cytochrome P450 6499 19543 32719 1.52 2.0E-10 AF280107.1 NT polypepfide 5 (CYP3A5) gene, partial cds 7772 20702 34001 8.3 2.0E-10 BE791082.1 EST_HUMAN 601586208F1 NIH_MGC_7 Homo sapiens cDNA clone IMAGE:3940824 5' 8592 21523 34867 0.7 2.0E-10 P26809 SWISSPROT POL POLYPROTEIN [CONTAINS: PROTEASE; REVERSE TRANSCRIPTASE; RIBONUCLEASE H] 8592 21523 34868 0.7 2.0E-10 P26809 SWISSPROT POL POLYPROTEIN [CONTAINS: PROTEASE; REVERSE TRANSCRIPTASE; RIBONUCLEASE H] Page 225 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 7o78d08.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:3642303 3' similar to contains L1.t2 L1 9842 22747 1.18 2.0E-10 BF434565.1 EST_HUMAN repetitive element; 1528 14559 1.5 1.0E-10 AW867767.1 EST_HUMAN MR0-SN0038-290300-001-f01 SN0038 Homo sapiens cDNA 1629 14659 27622 3.22 1.0E-10 AV652123.1 EST_HUMAN AV852123 GLC Homo sapiens cDNA clone GLCCXA11 3' 2619 16617 1.64 1.0E-10 AW852001.1 EST_HUMAN QV0-CT0225-191199-058-e08 CT0225 Homo sapiens cDNA 3556 16595 29499 0.95 1.0E-10 AW832912.1 EST_HUMAN QV2-TT0003-161199-013-g10 TT0003 Homo sapiens cDNA 3600 16637 0.74 1.0E-10 AL041685.1 EST_HUMAN DKFZp434N1317_r1 434 (syncnym: htes3) Homo sapiens cDNA clone DKFZp434N1317 5' 3913 16637 0.99 1.0E-10 AL041685.1 EST_HUMAN DKFZp434N1317_r1 434 (syncnym: htes3) Homo sapiens cDNA clone DKFZp434N1317 5' Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 (NFKB1) gene, complete 4101 17126 8.43 1.0E-10 AF213884.1 NT cds Homo sapiens X28 region near ALD locus containing dual specificity phosphatase 9 (DUSP9), ribosomal protein L18a (RPL18a), Ca2+/Calmodulin-dependent protein kinaso I (CAMKI), creatine traneporter (CRTR), 4225 17241 30108 7.39 1.0E-10 U52111.2 NT CDM protein (CDM), adrenoleukodystrophy protein> Homo sapiens X28 region near ALD locus containing dual specificity phosphatase 9 (DUSP9), ribosomal protein L18a (RPL18a), Ca2+/Calmodulin-dependent protein kinaso I (CAMKI), creatine traneporter (CRTR), 4225 17241 30108 7.39 1.0E-10 U52111.2 NT CDM protein (CDM), adrenoleukodystrophy protein> 4233 17249 30118 2.13 1.0E-10 AB031069.1 NT Homo sapiens PCCX1 mRNA for protein containing CXXC domain 1, complete cds 4266 17282 2.53 1.0E-10 M30629.1 NT Human pregnancy-specific glycoprotein beta-1 (SP1) mRNA, last exon wa82f04.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2347615 3' similar to contains 5316 18300 1.02 1.0E-10 Al797745.1 EST_HUMAN MER31.t1 MER31 repetitive element; 7014 20041 33275 0.43 1.0E-10 AA631233.1 EST_HUMAN nq81a05.s1 NCI_CGAP_Co9 Homo sapiens cDNA clone IMAGE:1158704 3' Homo sapiens X-linked anhidroltic ectodermal dysplasia protein gene (EDA), exon 2 and flanking repeat 7130 20334 33598 0.45 1.0E-10 AF003528.1 NT regions 7895 20821 073 1.0E-10 P08548 SWISSPROT LINE-1 REVERSE TRANSCRIPTASE HOMOLOG 8136 21045 34375 0.55 1.0E-10 AU128584.1 EST_HUMAN AU128584 NT2RP2 Homo saplens cDNA clone NT2RP2003751 5' 8816 21746 35094 1.48 1.0E-10 AW408990.1 EST_HUMAN fB_6A4 Fetal brain library Homo sapiens cDNA qm04e10.x1 NCI_CGAP_Lu5 Homo sapiens cDNA clone IMAGE:1880874 3' similar to contains L1.t1 L1 9213 22141 1.27 1.0E-10 Al268340.1 EST_HUMAN repetitive element; '10698 23584 8.22 1.0E-10 AA081868.1 EST_HUMAN zn23g06.r1 Stralagene neuroepithelium NT2RAMI 937234 Homo sapiens cDNA clone IMAGE:548314 5' 11352 24270 37712 2.96 1.0E-10 Al038280.1 EST_HUMAN oy85h03.x1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:1672661 3' 281 13375 26290 0.82 9.0E-11 BE14600.1 EST_HUMAN IL2-HT0203-291099-016-c08 HT0203 Homo sapiens cDNA 2116 15129 28134 6.04 9.0E-11 AL134395.1 EST_HUMAN DKFZp547D226_r1 547 (synonym:hfbr1) Homo sapiens cDNA DKFZp547D225 5' 2116 15129 28135 6.04 9.0E-11 AL134395.1 EST_HUMAN DKFZp547D226_r1 547 (synonym:hfbr1) Homo sapiens cDNA DKFZp547D225 5' Page 226 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 3442 16483 29391 3.25 9.0E-11 AL134395.1 EST_HUMAN DKFZp547D225_r1 547 (synonym:hfbr1) Homo sapiens cDNA clone DKFZp547D225 5' 3442 16483 29392 3.25 9.0E-11 AL134395.1 EST_HUMAN DKFZp547D225_r1 547 (synonym:hfbr1) Homo sapiens cDNA clone DKFZp547D225 5' 4621 17628 30492 0.99 9.0E-11 AA775985.1 EST_HUMAN ae78f01.s1 Strategene schizo brain S11 Homo sapiens cDNA cone IMAGE:970297 3' 5766 18839 4.2 9.0E-11 BE079780.1 EST_HUMAN RCG-BT0627-140200-011-E06 BT0627 Homo sapiens cDNA 10651 23537 36970 1.49 9.0E-11 AA324960.1 EST_HUMAN EST27872 Cerebellum II Homo sapiens cDNA 5' end 10651 23537 36971 1.49 9.0E-11 AA324960.1 EST_HUMAN EST27872 Cerebellum II Homo sapiens cDNA 5' end 12599 25295 31844 3.3 9.0E-11 C16635.1 EST_HUMAN C16635 Clontech human aorta polyA+ mRNA (#572) Homo sapiens cDNA clone GEN-506B08 5' yn53f11.s1 Soares adult brain N2b5HB55Y Homo sapiens cDNA clone IMAGE:172173 3' similar to contains 3161 16211 15.85 8.0E-11 H11971.1 EST_HUMAN L1 repetitive element; 4046 17073 29959 0.69 8.0E-11 Al478617.1 EST_HUMAN tm54c09.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2161936 3' 4127 17150 30025 7.52 8.0E-11 N23712.1 EST_HUMAN yw46e06.s1 Weizmann Olfactory Epithelium Homo sapiens cDNA clone IMAGE:255298 3' ox46b04.s1 Soares_total_fetus_Nb2HF8_9w Homo sapiens cDNA clone IMAGE:1659343 3' similar to 5311 18295 31148 5.12 8.0E-11 Al056038.1 EST_HUMAN gb:L02932 PEROXISOME PROLIFERATOR ACTIVATED RECEPTOR ALPHA (HUMAN); 6003 19067 32194 0.72 8.0E-11 AW674316.1 EST_HUMAN ba60g04.x1 NIH_MGC_10 Homo sapiens cDNA clone IMAGE:2900982 3' xf45h11.x1 NCI_CGAP_Brn50 Homo sapiens cDNA clone IMAGE:262106 3' similar to contains MER10.t1 6968 19996 0.56 8.0E-11 AW166158.1 EST_HUMAN MER10 repetitive element; 1467 14498 27459 1.62 7.0E-11 AA330642.1 EST_HUMAN EST34392 Embryo, 6 week I Homo sapiens cDNA 5' end 9065 21994 35347 2.34 7.0E-11 AF163864.1 NT Homo sapiens SNCA isoform (SNCA) gene, complete cds, slternatively spliced RETROVIRUS-RELATED PO_POLYPROTEIN [CONTAINS: REVERSE TRANSCRIPTASE; 10724 23610 1.45 7.0E-11 P11369 SWISSPROT ENDONUCLEASE] 12733 25374 1.71 7.0E-11 AV701656.1 EST_HUMAN AV701656 ADB Homo sapiens cDNA clone ADBABC09 5' 435 13506 26431 4.25 6.0E-11 M55270.1 NT Human matrix Gla protein (MGP) gene, complete cds 435 13506 26432 4.25 6.0E-11 M55270.1 NT Human matrix Gla protein (MGP) gene, complete cds Homo sapiens chromosome X region from filamin (FLN) gene to glucose-6-phosphate dehydrogenase 7023 20049 33282 1.04 6.0E-11 L44140.1 NT (G6PD) gene, complete cds's 8147 21056 34388 3.32 6.0E-11 P08547 SWISSPROT LINE-1 REVERSE TRANSCRIPTASE HOMOLOG 8936 21866 35224 11.62 6.0E-11 AV727859.1 EST_HUMAN AV727859 HTC Homo sapiens cDNA clone HTCASC06 5' 9854 22769 36154 0.61 6.0E-11 BE063509.1 EST_HUMAN CM0-BT0281-031199-087-a03 BT028 Homo sapiens cDNA 12 13127 26013 0.84 5.0E-11 AL163283.2 NT Homo sapiens chromosome 21 segment HS21C083 3421 13127 26013 1.23 5.0E-11 AL163283.2 NT Homo sapiens chromosome 21 segment HS21C083 4328 17342 30208 2 5.0E-11 P48034 SWISSPROT ALDEHYDE OXIDASE 6794 19827 33037 1.56 5.0E-11 AL163213.2 NT Homo sapiens chromosome 21 segment HS21C013 7955 20877 34188 11.23 5.0E-11 11416799 NT Homo sapiens protocadherin beta 3 (PCDHB3), mRNA 1426 14457 1.32 4.0E-11 AA436042.1 EST_HUMAN zu01b12.r1 Soares_testis_NHT Homo sapiens cANA clone IMAGE:730559 5' Page 227 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 2838 15827 28823 11.8 4.0E-11 BE885900.1 EST_HUMAN 601507531F1 NIH_MGC_71 Homo sapiens cDNA clone IMAGE:3909295 5' 3010 16062 28986 1.57 4.0E-11 AL163247.2 NT Homo sapiens chromosome 21 segment HS21C047 4731 17736 30598 0.89 4.0E-11 D44666.1 EST_HUMAN HUMSUPY069 Human brain cDNA Homo sapiens cDNA clone 069 6750 19785 32997 2.67 4.0E-11 P20095 SWISSPROT PRE-MRNA SPLICING FACTOR RNA HELICASE PRP2 zv59f10.r1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:757963 5' similar to TR:G1055250 7345 20341 33607 1.19 4.0E-11 AA442630.1 EST_HUMAN G1055250 PHEROMONE RECEPTOR VN4.; Homo sapiens mannosidase, beta A, lysosomal (MANBA) gene, and ubiquitin-conjugafing enzyme E2D 3 7767 20697 4.05 4.0E-11 AF224669.1 NT (UBE2D3) genes, complete cds 9931 22836 1.91 4.0E-11 BE149425.1 EST_HUMAN RC1-HT0256-210100-013-f08 HT0256 Homo sapiens cDNA tf82g12.x1 NCI_CGAP_Brn23 Homo sapiens cDNA clone IMAGE:2105830 3' similar to WP:ZK353.1 10186 23077 36479 1.07 4.0E-11 Al609753.1 EST_HUMAN CE00385; 12792 25419 31791 4.36 4.0E-11 11545732 NT Homo sapiens SH3-domain bincling protein 1 (SH3BP1), mRNA 1510 14541 27503 3.15 3.0E-11 6679077 NT Mus musculus expressed in non-metastatic cells 2, protein (NM23B)(Nme2), mRNA 2943 15995 0.92 3.0E-11 Al816933.1 EST_HUMAN wj35d06.x1 NCI_CGAP_Kid12 Homo sapiens cDNA clone IMAGE:2404811 3' 4374 17388 1.42 3.0E-11 AA309248.1 EST_HUMAN EST180120 Liver, hepatocellular carcinoma Homo sapiens cDNA 5' end qf36c04.x1 Soates_testis_NHT Homo sapiens cDNA clone IMAGE:1752102 3' similar to contains MER10.t3 986 14037 26980 1.31 2.0E-11 Al150502.1 EST_HUMAN MeR10 repetitive element; 1213 14251 27193 4.27 2.0E-11 R24807.1 EST_HUMAN yg43e12.r1 Soares infant brain 1NIB Homo sapiens cDNA clone IMAGE:35144 5' 1213 14251 27194 4.27 2.0E-11 R24807.1 EST_HUMAN yg43e12.r1 Soares infant brain 1NIB Homo sapiens cDNA clone IMAGE:35144 5' Gallus gallus rho-globin, beta-H globin, beta-A globin, epsilon-globin, and olfactory receptor-like protein 1636 14666 27628 3 2.0E-11 L17432.1 NT COR3'beta (COR3'beta) genes, complete cds Gallus gallus rho-globin, beta-H globin, beta-A globin, epsilon-globin, and olfactory receptor-like protein 1636 14666 27629 3 2.0E-11 L17432.1 NT COR3'beta (COR3'beta) genes, complete cds 2815 15804 28802 1.26 2.0E-11 AF087913.1 NT Human endogenous retrovirus HERV-P-T47D 3240 16288 29192 8.7 2.0E-11 P10263 SWISSPROT RETROVIRUS-RELATED GAG POLYPROTEIN (VERSION 1) 3371 16415 29316 0.9 2.0E-11 Al478617.1 EST_HUMAN tm54c09.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone IMAGE:2161936 3' 4553 17562 0.92 2.0E-11 BE065537.1 EST_HUMAN RC3-BT0316-170200-014-e05 BT0316 Homo sapiens cDNA 4716 17721 0.73 2.0E-11 AL163227.3 NT Homo sapiens chromesome 21 segment HS21C027 5048 18045 1.42 2.0E-11 BE062558.1 EST_HUMAN QV2-BT0258-261099-014-a01 BT0258 Homo sapiens cDNA 5125 18121 30963 1.02 2.0E-11 AL163279.2 NT Homo sapiens chromosome 21 segment HS21C079 EST178226 Colon carcinoma (HCC) cell line Hoo sapiens cDNA 5' end similar to similar to alpha-2- 5162 18155 31002 2.36 2.0E-11 AA307331.1 EST_HUMAN macroglobulin 6375 19424 32590 1.28 2.0E-11 AW877806.1 EST_HUMAN QV2-PT0073-280300-109-h08 PT0073 Homo sapiens cDNA Page 228 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Aduit Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value nc83h05.r1 NCI_CGAP_GC1 Homo sapiens cDNA clone IMAGE:797433 5'[ similar to SW:PR16_YEAST 6565 19606 32791 1.81 2.0E-11 AA581028.1 EST_HUMAN P15938 PRE-MRNA SPLICING FACTOR RNA HELICASE PRP16. ; 7559 20496 33786 0.85 2.0E-11 BF592945.1 EST_HUMAN 7j97c03.x1 NCI_CGAP_GC6 Homo sapiens cDNA clone IMAGE:3442565 3' 8462 21393 0.72 2.0E-11 P37032 SWISSPROT OLFACTORTY RECEPTOR-LIKE PROTEINJ COR6 9764 22688 1.89 2.0E-11 AF029308.1 NT Homo sapiens chromosome 9 duplication of the T cell receptor beta locus and trypsinogen gene families 10776 23662 37090 5.29 2.0E-11 Q13606 SWISSPROT OLFACTORY RECEPTOR 5@1 (OLFACTORY RECEPTOR-LIKE PROTEIN OLF1) 10995 23879 37309 0.96 2.0E-11 AW885874.1 EST_HUMAN RC4-OT0072-170400-013-c11 OT0072 Homo sapiens cDNA 10995 23879 37310 0.96 2.0E-11 AW885874.1 EST_HUMAN RC4-OT0072-170400-013-c11 OT0072 Homo sapiens cDNA 11553 24462 37926 1.75 2.0E-11 AA035369.1 EST_HUMAN zk27g02.s1 Soares_pregnant_uterus_NbHPU Homo sapiens cDNA clone IMAGE:471794 3' 11553 24462 37927 1.75 2.0E-11 AA035369.1 EST_HUMAN zk27g02.s1 Soares_pregnant_uterus_NbHPU Homo sapiens cDNA clone IMAGE:471794 3' 11583 24492 37960 1.84 2.0E-11 AA261956.1 EST_HUMAN zs18b04.r1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE:685519 5' 12371 25887 2.11 2.0E-11 AA701195.1 EST_HUMAN zj77e03.s1 Soares_fetal_liver_spieen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:460924 3' 12398 25171 2.44 2.0E-11 AW842143.1 EST_HUMAN RC0-CN0027-210100-011-c01 CN0027 Homo sapiens cDNA 12421 25187 31878 2.51 2.0E-11 BF377859.1 EST_HUMAN CN2-TN0140-070900-372-g01 TN0140 Homo sapiens cDNA 12806 25429 3.91 2.0E-11 P08547 SWISSPORT LINE-1 REVERSE TRANSCRIPTASE HOMOLOG 13079 25601 3.38 2.0E-11 11417966 NT Homo sapiens SEC14 (S. oerefvisiae)-like 2 (SEC14L2), mRNA 699 13758 26675 2.54 1.0E-11 AJ131016.1 NT Homo sapiens SCL gene locus 810 13866 26801 1.05 1.0E-11 AL163209.2 NT Homo sapiens chromosome 21 segment HS21C009 1245 14281 27223 1.89 1.0E-11 AL163279.2 NT Homo sapiens chromosome 21 segment HS21C079 1516 14547 1.83 1.0E-11 AF119914.1 NT HOmo sapiens PRO30e78 mRNA, complete cds 2051 15068 28068 0.95 1.0E-11 P16258 SWISSPROT OXYSTEROL-BINDING PROTEIN 2140 15153 28154 4.14 1.0E-11 AF000573.1 NT Homo sepiens homogentisate 1,2-dioxygenase gene, complete cds 3557 16594 29498 1.22 1.0E-11 BE004315.1 EST_HUMAN CM0-BN0105-170300-292-d12 BN0105 Homo sapiens cDNA 5515 18594 31442 14.58 1.0E-11 AL163247.2 NT Homo saplens chromosome 21 segment HS21 C047 7p57d01.x1 NCI_CGAP_Pr28 Homo sapiens cDNA clone IMAGE:3649945 3' similar to contains MER10.b3 6044 19106 32236 0.75 1.0E-11 BF222646.1 EST_HUMAN MER10 repetitive element ; 8328 21233 0.46 1.0E-11 AB042297.1 NT Homo sapiens PTS gene for 6-pyruvoylletrahydropterin synthase, complete cds 8780 21710 35056 2.97 1.0E-11 4885546 NT Homo sapiens PHD finger protein 2 (PHF2) mRNA 9144 22072 35434 6.62 1.0E-11 R13174.1 EST_HUMAN yf73d08.r1 Soares infant brein 1NIB Homo sapiens cDNA clone IMAGE:28166 5' 9601 22527 35892 1.26 1.0E-11 BF365119.1 EST_HUMAN QV4-NN1149-250900-423-a03 NN1149 Homo sapiens cDNA 9601 22527 35893 1.26 1.0E-11 BF365119.1 EST_HUMAN QV4-NN1149-250900-423-a03 NN1149 Homo sapiens cDNA 11732 24634 38116 8.73 1.0E-11 BF880078.1 EST_HUMAN 602154807F1 NIH_MGC_83 Homo sapiens cDNA clone IMAGE:4295977 5' 12877 25708 2. 1.0E-11 Z20377.1 EST_HUMAN HSAAACADH P, Human foetal Brain Whole tissue Homo sapiens cDNA Page 229 of 545<BR> Table 4<BR> Single Exon Probes "Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 2993 16045 28948 0.79 9.0E-12 P20742 SWISSPROT PREGNANCY ZONE PROTEIN PRECURSOR 10314 23203 36613 1.33 9.0E-12 AL163300.2 NT Homo saplens chromosome 21 segment HS21C100 10314 23203 36614 1.33 9.0E-12 AL163300.2 NT Homo saplens chromosome 21 segment HS21C100 9877 22792 1.22 8.0E-12 BE074720.1 EST_HUMAN IL5-BT0578-130300-036-G12 BT0578 Homo sapiens cDNA 12469 25215 5.13 8.0E-12 AJ271736.1 NT Homo sapiens Xq pseudoautosomal reglon; segment 2/2 4772 17777 30645 1.68 7.0E-12 Q05904 SWISSPROT 34 KD SPICULE MATRIX PROTEIN PRECURSOR (LSM34) 11788 24710 38201 8.81 7.0E-12 AA704735.1 EST_HUMAN zj23g01.s1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:451152 3' 3606 16643 0.81 6.0E-12 AV730554.1 EST_HUMAN AV730554 HTF Homo sapiens cDNA clone HTFAWF06 5' nz88f11.s1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE:1302573 3' similar to contains Alu 4457 17468 30325 11.13 6.0E-12 AA732516.1 EST_HUMAN repetitive element; 6652 19691 32884 0.49 6.0E-12 AF020503.1 NT Homo sapiens FRA3B common fragile region, diadenosine triphosphate hydrolase (FHIT) gene, excon 5 9547 22474 35831 1.29 6.0E-12 AF003249.1 NT Morone saxatilis myosin heavy chain FM3A (FM3A) mRNA, complete cds od10g11.s1 NCI_CGAP_GCB1 Homo0 sapiens cDNA clone IMAGE:1367588 similar to contain MER29.t2 10007 22824 1.32 6.0E-12 AA847898.1 EST_HUMAN MER29 repetitive element ; 1069 14113 27053 1.73 5.0E-12 T0573.1 EST_HUMAN EST04462 Fetal brain, Stratagene (cat#936206) Homo sapiens cDNA clone HFBDV33 3449 16490 29397 1.37 5.0E-12 BE047779.1 EST_HUMAN tz42b05.y1 NCI_CGAP_Bm52 Homo sapiens cDNA clone IMAGE:2291217 5' 3791 16822 29709 9.07 5.0E-12 AJ271736.1 NT Homo sapiens Xq pseudoautosomal region; segment 2/2 6254 19307 32469 5.65 5.0E-12 AL163278.2 NT Homo sapiens chromosome 21 segment HS21C078 6254 19307 32470 5.65 5.0E-12 AL163278.2 NT Homo sapiens chromosome 21 segment HS21C078 6767 19801 33012 10.4 5.0E-12 AW974760.1 EST_HUMAN EST386850 MAGE resequences, MAGE Homo sapiens cDNA 7382 20092 33326 0.94 5.0E-12 AL040739.1 EST_HUMAN DKFZp434B1615_s1 434 (synonym: htes3) Homo sapiens cDNA DKFZp434B1615 3' 7393 20092 33326 1.15 5.0E-12 AL040739.1 EST_HUMAN DKFZp434B1615_s1 434 (synonym: htes3) Homo sapiens cDNA DKFZp434B1615 3' zf01g12.s1 Soares_fetal_heart_NbHH19W Homo sapiens cDNA clone IMAGE:375718 3' similar to contains 8807 21737 35087 1.26 5.0E-12 AA033745.1 EST_HUMAN L1.t3 L1 repetitive element ; 9225 22153 0.6 5.0E-12 AW887037.1 EST_HUMAN RC1-OT0086-220300-011-b07 OT0086 Homo sapiens cDNA 9546 22473 0.61 5.0E-12 AL079581.1 EST_HUMAN DKFZp434J0426_r1 434 (syncnym; htec3) Homo sapiene cDNA clone DKFZp434J0426 5' 9653 22579 35951 2.51 5.0E-12 AJ271735.1 NT Homo sapiens Xq pseudoautosomal region; segment 1/2 OLFACTORY RECEPTOR 1D2 (OLFACTORY RECEPTOR-LIKE PROTEIN HGMP07E)(OLFACTORY 9957 22862 36249 1.23 5.0E-12 P34082 SWISSPROT RECEPTOR 17-4)(OR17-4) 10768 23654 5.1 5.0E-12 AL163303.2 NT Homo sapiens chromosome 21 segment HS21C103 10850 23738 37159 0.76 5.0E-12 AL163302.2 NT Homo sapiens chromosome 21 segment HS21C102 263 13359 26274 3.99 4.0E-12 AA700326.1 EST_HUMAN zj74g11.s1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:460676 3' 264 13359 26274 4.24 4.0E-12 AA700326.1 EST_HUMAN zj74g11.s1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA clone IMAGE:460676 3' Page 230 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value tx26h05.x1 NCI_CGAP_Lu24 Homo saplens cDNA clone IMAGE:2270745 3' similar to TR:Q13539 Q13539 4733 17738 30600 0.75 4.0E-12 AI689984.1 EST_HUMAN MARINER TRANSPOSASE.; nads21b03.x1 NCI_CGAP_Lu24 Homo sapiens cDNA clone IMAGE:3366077 3' similar to contains MER7.b2 8067 20980 0.63 4.0E-12 BF445140.1 EST_HUMAN MER7 repetitive element; Homo sapiens S164 gene, partial cds; PS1 and hypothetical protein genes, complete cds; and S171 gene, 8819 21749 3.74 4.0E-12 AF109907.1 NT partial cds 9245 22173 35527 0.95 4.0E-12 AB042815.1 NT Bos taurus Mtch2 mRNA fort miltochondrial carrier homolog 2, complete cds 11521 24431 37889 4.68 4.0E-12 AJ229043.1 NT Homo sapiens 959 kb contig between AML1 and CBR1 on chromosome 21q22, segment 3/3 hd13d01.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2909377 3' similar to TR:O14517 639 13700 26606 2.95 3.0E-12 AW341683.1 EST_HUMAN O14517 SMRP.; hd13d01.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2909377 3' similar to TR:O14517 639 13700 26607 2.95 3.0E-12 AW341683.1 EST_HUMAN O14517 SMRP.; 5315 18299 31151 0.72 3.0E-12 AL163268.2 NT Homo sapiens chromosome 21 segment HS21C068 5637 18713 31614 1.35 3.0E-12 AF111168.2 NT Homo sapiens serine palmitoyl transferase, subunit II gene. complete cds; and unknown genes 7371 20365 33634 0.47 3.0E-12 BE149692.1 EST_HUMAN RC1-HT0256-280300-017-c09 HT0256 Homo sapiens cDNA 7829 20758 0.58 3.0E-12 AB042297.1 NT Homo sapiens PTS gene for 6-pyruvoyltetrahydroterin synthase, complete cds 8221 21126 0.48 3.0E-12 AW854328.1 EST_HUMAN RC3-CT0255-031099-011-h02 CT0255 Homo sapiens cDNA 9651 22577 35948 0.73 3.0E-12 O35453 SWISSPROT SERINE PROTEASE HEPSIN 11099 24030 37474 3.17 3.0E-12 U37672.1 NT Human prostate specific antigen gene, 5' flanking region 11099 24030 37475 3.17 3.0E-12 U37672.1 NT Human prostate specific antigen gene, 5' flanking region 1680 14710 27672 1.83 2.0E-12 AW802131.1 EST_HUMAN IL5-UM0071-120400-065-a05 UM0071 Homo sapiene cDNA 3527 16565 29469 0.93 2.0E-12 6754495 NT Mus musculus keratin-associated protein 6.2 (Krtap6-2), mRNA 4208 17225 30092 1.22 2.0E-12 J01884.1 NT Rat U3A small nuclear RNA 4208 17225 30093 1.22 2.0E-12 J01884.1 NT Rat U3A small nuclear RNA 4528 17537 2.47 2.0E-12 BE063509.1 EST_HUMAN CM0-BT0281-031199-087-a03 BT0281 Homo sapiens cDNA 5006 18004 30861 0.65 2.0E-12 O70306 SWISSPROT TBX15 PROTEIN (T-BOXPROTEIN 15) 5006 18004 30862 0.65 2.0E-12 O70306 SWISSPROT TBX15 PROTEIN (T-BOXPROTEIN 15) RETROVIRUS-RELATED POL POLYPROTEIN [CONTAINS: REVERSE TRANSCRIPTASE; 5430 18512 31235 0.81 2.0E-12 P11369 SWISSPROT ENDONUCLEASEJ 6751 19785 2.64 2.0E-12 AW971857.1 EST_HUMAN EST383946 MAGE resequences, MAGL Homo sapiens cDNA 7539 20478 33766 3.2 2.0E-12 T08169.1 EST_HUMAN EST06060 infant Brain, Bento Soares Homo sapiens cDNA clone HIBA13 5' end 7730 20662 33960 1.46 2.0E-12 BE173035.1 EST_HUMAN MR0-HT0559-200400-015-e08 HT0559 Homo sapiens cDNA 7960 20882 0.56 2.0E-12 AW842798.1 EST_HUMAN MR2-CN0037-210200-101-b02 CN0037 Homo sapiens cDNA 8110 21022 34348 2.4 2.0E-12 11422229 NT Homo sapiens Ac-like transposable element (ALTE), mRNA Page 231 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value POLYPEPTIDE N-ACETYLGALACTOSAMINYLTRANSFERASE (PROTEIN-UDP ACETYLGALACTOSAMINYLTRANSFERASE)(UDP-GALNAC:POLYPEPTIDE, N- 9285 22213 35571 0.55 2.0E-12 Q10473 SWISSPROT ACETYLGALACTOSAMINYLTRANSFERASE)(GALNAC-T1) 9848 22956 1.96 2.0E-12 AF196864.1 NT Homo sapiens putative BPES syndrome breakpoint region protein gene, comeplete ods 10491 23379 12.68 2.0E-e12 BE165980.1 EST_HUMAN MR3-HT0487-150200-113-g01 HT0487 Homo sapiens cDNA qq07f02.x1 Soares_NhHMPu_S1 Homo saplens cDNA clone IMAGE:1931835 3' similar to TR:Q13538 10994 23878 37308 0.86 2.0E-12 AI334130.1 EST_HUMAN Q13538 ORF2: FUNCTUION UNKNOWN.; 12385 25163 2.32 2.0E-12 AL163283.2 NT Homo sapiens chromosome 21 segment HS21C083 hh90a09.x1 NCI_CGAP_GU1 Homo saplens cDNA cone IMAGE:2970040 3' similar to contains MER18.t1 127 13232 26148 2.72 1.0E-12 AW627674.1 EST_HUMAN MER18 repetitive element ; wm51f07.x1 NCI_CGAP_Ut2 Homo sapiens cdNA cione IMAGE:2439493 3' similar to contains L1.b3 L1 2004 15022 1.28 1.0E-12 AI871726.1 EST_HUMAN repetitive element ; 3118 16169 29063 0.94 1.0E-12 AF000991.1 NT Homo sapiens testils-specific Testis Transcript Y 2 (TTY2) mRNA, partial cds 3118 16169 29064 0.94 1.0E-12 AF000991.1 NT Homo sapiens testils-specific Testis Transcript Y 2 (TTY2) mRNA, partial cds 3943 16971 29853 46.33 1.0E-12 AU132248.1 EST_HUMAN AU132248 NT2RP3 Homo sapiens cDNA clone NT2RP3004070 5' 3943 16971 29854 46.33 1.0E-12 AU132248.1 EST_HUMAN AU132248 NT2RP3 Homo sapiens cDNA clone NT2RP3004070 5' 6194 19250 1.65 1.0E-12 U82828.1 NT Homo sapiens ataxia telangiectasia (ATM) gene, complete cds 6276 19327 1.98 1.0E-12 Q9Y2G7 SWISSPROT HYPO THE TICAL ZINC FINGER PROTEIN KIAA0961 6394 19442 32610 0.52 1.0E-12 BF642800.1 EST_HUMAN EST00008 Soares_NFL_T_GBC_S1 Homo sapoiens cDNA clone IMAGE:1847869 5' 6394 19442 32611 0.52 1.0E-12 BF642800.1 EST_HUMAN EST00008 Soares_NFL_T_GBC_S1 Homo sapoiens cDNA clone IMAGE:1847869 5' Mus musculus WNT-2 gene, partial cds; putative ankfyrin-related protein and cystic fibrosis transmembrane 6811 19844 33054 0.52 1.0E-12 AF229843.1 NT conductance regulator (CFTR) genes, section 1 of 2 of the complete cds; and unknown gene 7475 20415 33693 1.9 1.0E-12 AF196864.1 NT Homo osapiens putative BPES syndrome breakpoint region protein gene, complete cds gh66a04.x1 Soares_fetal_liver_spleen_1NFLS_S1 Hoemo sapiens cDNA clone IMAGE:1849614 3' similar to gb:M19503 LINE-1 REVERSE TRANSCRIPTASE HOMOLOG (HUMAN);contains MER10.t1 MER10 7511 20450 33734 13 1.0E-12 AI248533.1 EST_HUMAN repetitive element; gh66a04.x1 Soares_fetal_liver_spleen_1NFLS_S1 Hoemo sapiens cDNA clone IMAGE:1849614 3' similar to gb:M19503 LINE-1 REVERSE TRANSCRIPTASE HOMOLOG (HUMAN);contains MER10.t1 MER10 7511 20450 33735 13 1.0E-12 AI248533.1 EST_HUMAN repetitive element; Human germline T-cell receptor beta chain Dopamine-beta-hydroxylase-like, TRY1, TRY2, TRY3, TCRBV27S1P, TCRBV22S1A2N1T, TCRBV9S1A1T, TCRBV7S1A1N2T, TCRBV5S1A1T, TCRBV13S3, TCRBV6S9P, TCRBV7S3A2T, TCRBV13S2A1T, TCRBV9S2A2PT, TCRBV7S2A1N4T, 9058 21987 35341 0.66 1.0E-12 U66059.1 NT TCRBV13Sg/13S> Page 232 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value 9263 22191 35549 1.45 1.0E-12 AA782323.1 EST_HUMAN ao26d05.s1 Stratagene ovary (#937217) Homo sapiens cDNA clone IMAGE:857577 3' 12299 25108 38576 4.45 1.0E-12 AW962164.1 EST_HUMAN EST374237 MAGE resequences, MAGG Homo sapiens cDNA 12493 25234 1.67 1.0E-12 AI738592.1 EST_HUMAN wi33h08.x1 NCI_CGAP_Co16 Homo sapiens cDNA clone IMAGE:2392095 3' 12636 25862 2.55 1.0E-12 AL163266.2 NT Homo sapiens chromosome 21 segment HS21C068 Homo sapiens mannosidase, beta A, lysosomal (MANBA) gene, and ublqultin-conjugating enzyme E2D 3 12919 25529 1.49 1.0E-12 AF224669.1 NT (UBE2D3) genes, complete cds xbf61f07.x1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone IMAGE:2580805 3' similar to contains 1078 14122 27059 2.27 9.0E-13 AW082714.1 EST_HUMAN MER28.t3 MER28 repetilive element ; 3695 16727 1 9.0E-13 AJ271735.1 NT Homo sapiens Xq psaudoautosomal region; sagment 1/2 4024 17051 29942 1.04 9.0E-13 AB029900.1 NT Homo sapiens CST gene for serebroside sulfotransferase, exon 1, 2, 3, 4, 5 7658 20592 33890 0.42 9.0E-13 AL163283.2 NT Homo sapiens chromosome 21 segment HS21C083 10128 23019 2.38 9.0E-13 N69653.1 EST_HUMAN za26b06.s1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:293651 3' 740 13798 26722 5.28 8.0E-13 U29185.1 NT Homo sapiens prion protein (PrP) gene, complete cds 740 13798 26723 5.28 8.0E-13 U29185.1 NT Homo sapiens prion protein (PrP) gene, complete cds Homo sapiens basic transcription factor 2 p44 (btf2p44) gene, partial cds, neuronal apoptosis inhibitory 1862 14884 27864 3.51 8.0E-13 U8017.1 NT protein (naip) and survival motor neuron prodein (smn) genes, complete cds 8690 21621 34963 0.83 8.0E-13 AI884398.1 EST_HUMAN wm31h09.x1 NCI_CGAP_Ut4 Homo sapiens cDNA clone IMAGE:2437601 3' 8690 21621 34964 0.83 8.0E-13 AI884398.1 EST_HUMAN wm31h09.x1 NCI_CGAP_Ut4 Homo sapiens cDNA clone IMAGE:2437601 3' Homo sapiens Bruton's tyrosine kinase (BTK), alpha-D-galactosidioase A (GLA), L44-like ribosomal protein 10644 23530 3.91 8.0E-13 U78027.1 NT (L44L) and FTP3 (FTP3) genes, complete cds Human germfline T-cell receptor beta chain TCRBV13S1, TCRBV6S8A2T, TCRBV5S6A3N2T, TCRBV13S6A2T, TCRBV6S9P, TCRBV5S3A2T, TCRBV13S8P, TCRBV6S3A1N1N1T, TCRBV5S2, TCRBV6S6A2T, TCRBV5S7P, TCRBV123S4, TCRBV6S2A1N1T, TCRBV5S4A2T, TCRBV6S4A1, 12187 25023 38524 2.6 8.0E-1 U66060.1 NT TCRBV23S1A2T, TCRBV12> 8348 21253 34587 0.59 7.0E-13 AI884398.1 EST_HUMAN wm31h09.x1 NCI_CGAP_Ut4 Homo sapiens cDNA clone IMAGHE:2437601 3' 8348 21253 34588 0.59 7.0E-13 AI884398.1 EST_HUMAN wm31h09.x1 NCI_CGAP_Ut4 Homo sapiens cDNA clone IMAGHE:2437601 3' 8812 21742 0.59 7.0E-13 Q95155 SWISSPROT OLFACTORY RECEPTOR-LIKE PROTEIN OLF2 12737 25377 31.57 7.0E-13 BE778223.1 EST_HUMAN 601463285F1 NIH_MGC_67 Homo sapiens cDNA clone IMAGE:3E866613 5' POLYPEPTIDE N-ACETYLGALACTOSAMINYL TRANSFERASE (PROTEIN-UDP ACETYLGALACTOSAMINYL TRANSFERASE) (UDP-GALNAC:POLYEPTIDE, N- 12940 25507 2.07 7.0E-13 Q10473 SWISSPTOR ACETYLGALACTOSAMINYLTRANSFERASE) (GALNAC-T1) 2113 15126 28131 9.96 6.0E-13 AL163207.2 NT Homo sapiens chromosome 21 segment HS21C007 3367 16411 0.83 5.0E-13 R78338.1 EST_HUMAN yi82f04.r1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE:145759 5' Page 233 of 545<BR> Table 4<BR> Single Exon Probes Expressed In Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLAST E No. NO: NO: Source Value zt77a12.s1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:728350 3' similar to contains Alu 3457 16498 1.9 5.0E-13 AA435773.1 EST_HUMAN repetitive alement;contains element MER22 repetitive element; 7202 20202 33447 0.66 5.0E-13 P08983 SWISSPTOR GAP JUNCTION BETA-1 PROTEIN (CONNEXIN 30) (CX30) 11294 24214 37663 2.58 5.0E-13 P07313 SWISSPROT MYOSIN LIGHT CHAIN KINASE, SKELETAL MUSCLE (MLCK) 1890 14911 2.05 4.0E-13 AW378614.1 EST_HUMAN PM2-HT0224-221099-001-e11 HT0224 Homo sapiens cDNA 2484 15486 3.04 4.0E-13 AF003529.1 NT Homo sapiens glypican 3 (GPC3) gene, partial cds and flanking repeat reglons 4861 17863 1.15 4.0E-13 AA454054.1 EST_HUMAN zx48d07.r1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:795469 5' 5780 18852 31957 5.23 4.0E-13 BE169131.1 EST_HUMAN PM3-HT-520-230200-002-c08 HT0520 Homo sapiens cDNA 7572 20508 33796 1.3 4.0E-13 AB037750.1 NT Homo sapiens mRNA for KIAA1329 protein, partial ods zw76g12.r1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:782182 5' similar to TR:G452763 8056 20969 34285 0.93 4.0E-13 AA431529.1 EST_HUMAN G452763 COR1 MRNA. ; yy33g05.r1 Soares melanocyte 2NbHM Homo sapiens cDNA clone IMAGE:273080 5' similar to PIR:A32995 8182 21089 1.8 4.0E-13 N44291.1 EST_HUMAN A32995 t complex sterility protein - mouse ; 9400 22328 35690 1.27 4.0E-13 AL043810.1 EST_HUMAN DKFZp434A0128_r1 434 (synonym: htes3) Homo sapiens cDNA clone DKFZp434A0128 5' qn32d05.x1 NCI_CGAP_Kid5 Homo sapiens cDNA clone IMAGE: 1899945 3' similar to contains Alu 10523 23410 36822 4.84 4.0E-13 AI289831.1 EST_HUMAN Frepetitive element; 11608 24516 37985 1.98 4.0E-13 AA435819.1 EST_HUMAN zt78g10.s1 Soares_testis_ NHT Homo sapiens cDNA clone IMAGE:728514 3' 11608 24516 37986 1.98 4.0E-13 AA435819.1 EST_HUMAN zt78g10.s1 Soares_testis_ NHT Homo sapiens cDNA clone IMAGE:728514 3' hz82e05.x1 NCI_CGAP_Lu 24 Homo sapiens cDNA clone IMAGE:3214496 3' similar to contains MER31.t1 12698 25354 5.02 4.0E-13 BE503023.1 EST_HUMAN MER31 repetitive element; Homo sapiens X-linked anhidrolfic ectodermal dysplasla protein gene (EDA), exon 2 and flanking repeat 191 13289 2.94 3.0E-13 AF003528.1 NT regions 890 13943 2.39 3.0E-13 AA430310.1 EST_HUMAN zw68g08.r1 Soares_testis_NHT HOmo sapiens cDNA clone IMAGE:781406 5' 2393 15398 28402 2.22 3.0E-13 AJ271736.1 NT Homo sapiens Xq pseudoautosomal region; segment 2/2 2501 15503 3.r07 3.0E-13 AL163210.2 NT Homo sapiens chromosome 21 segment HS21C010 2713 15707 28702 3.37 3.0E-13 BF372962.1 EST_HUMAN CM3-FT0100-140700-242-h08 FT0100 Homo sapiens cDNA 3230 16278 2.57 3.0E-13 AA745844.1 EST_HUMAN ob18d02.s1 NCI_CGAP_Kid5 Homo sapiens cDNA clone IMAGE:1324035 3' 4604 17612 30472 6.13 3.0E-13 AA430310.1 EST_HUMAN zw68g08.r1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:781406 5' 5226 18215 31061 0.65 3.0E-13 BF372962.1 EST_HUMAN CM3-FT0100-140700-242-h08 FT0100 Homo sapiens cDNA zn88h10.r1 Stratagene lung carcinoma 937218 Homo sapiens cDNA clone IMAGE:565315 5' simllar to 5730 18803 31896 0.78 3.0E-13 AA134017.1 EST_HUMAN contains THR.t2 THR repetitive element; zn88h10.r1 Stratagene lung carcinoma 937218 Homo sapiens cDNA clone IMAGE:565315 5' simllar to 5730 18803 31897 0.78 3.0E-13 AA134017.1 EST_HUMAN contains THR.t2 THR repetitive element; Page 234 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLASTE No. NO: NO: Source Value wz88c02.x1 NCI_CGAP_Brn25 Homo saplens cDNA clone IMAGE:2565890 3' similar to TR:O75139 6223 19278 32432 0.71 3.0E_13 AW005639.1 ETS_HUMAN O75139 KIAA0644 PROTEIN.; Homo sapiens X28 region near ALD locus containing dual specificity phosphalase 9 (DUSP9), ribosomal protein L18a (RPL18a), Ca2+/Calmodulin-dependent protein kinase I (CAMKI), creatine transporter (CRTR), 8463 21394 34735 7.8 3.0E-13 U52111.2 NT CDM protein (CDM), adrenoleukodystrophy protein > EST60487 Activated T-cells XX Homo sapiens cDNA 5' end similar to simiar to serine protease P100, Ra- 8654 21585 34920 0.78 3.0E-13 AA352487.1 ETS_HUMAN reactive factor EST60487 Activated T-cells XX Homo sapiens cDNA 5' end similar to simiar to serine protease P100, Ra- 8654 21585 34921 0.78 3.0E-13 AA352487.1 ETS_HUMAN reactive factor 10694 23580 37010 0.7 3.0E-13 AW935487.1 ETS_HUMAN RC2-DT0007-110100-014-g10 DT0007 Homo sapiens cDNA 11119 24049 3.46 3.0E-13 AI064768.1 ETS_HUMAN HA0536 Human fetal liver cDNA library Homo sapiens cDNA 11482 24395 37845 3.05 3.0E-13 BE063509.1 ETS_HUMAN CM0-BT0281-031199-087-a03 BT0281 Homo sapiens cDNA 12028 24870 38373 1.87 3.0E-13 AL163248.2 NT Homo sapiens chromosome 21 segment HS21C048 Homo sapiens X28 region near ALD locus containing dual specificity phosphalase 9 (DUSP9), ribosomal protein L18a (RPL18a), Ca2+/Calmodulin-dependent protein kinase I (CAMKI), creatine transporter (CRTR), 160 13260 26178 2.22 2.0E-13 852111.2 NT CDM protein (CDM), adrenoleukodystrophy protein > 258 13355 26271 1 2.0E-13 U23839.1 NT Danio rerio fibroblast growh factor receptor 4 mRNA, complete cds 1297 14330 27276 5.69 2.0E-13 AF239710.1 NT Homo sapiens DNA polymerase delta small subunit (POLD2) gene, exons 1 through 11 and complete cds 3049 16101 29004 0.79 2.0E-13 8924119 NT Homo sapiens hypothetical protein PRO2130 (PRO2130), mRNA 3049 16101 29005 0.79 2.0E-13 8924119 NT Homo sapiens hypothetical protein PRO2130 (PRO2130), mRNA 3325 16371 29272 1.02 2.0E-13 BF431899.1 ETS_HUMAN nab76f05.x1 Soares_NSF_F8_9W_OT_PA_P_S1 Homo sapiens cDNA clone IMAGE: 3' Homo sapiens S164 gene, partial cds; PS1 and hypothetical protein genas, complete cds; and S171 gene, 3564 16601 29505 1.04 2.0E-13 AF109907.1 NT partial cds 4203 17221 1.7 2.0E-13 AL163278.2 NT Homo sapiens chromosome 21 segment HS21C078 5378 18360 31199 1.02 2.0E-13 M58318.1 NT Homo sapiens ala gene 5378 18360 31200 1.02 2.0E-13 M58318.1 NT Homo sapiens ala gene GELL SURFACE GLYOCOPROTEIN 1 PRECURSOR (OUTER LAYER PROTEIN B) (S-LAYER PROTEIN 6362 19411 32576 4.77 2.0E-13 Q06852 SWISSPROT 1) 6448 19494 0.44 2.0E-13 X79417.1 NT S. scrofa rps12 mRNA for ribosomal protein S12 7126 20330 33593 6.66 2.0E-13 X16912.1 NT Human PFKL gene for live-type 6-phosphofructokinase (EC 2.7.1.11) exon 2 7407 20106 3340 0.63 2.0E-13 10835072 NT Homo sapiens N-myristoyltransferase 1 (NMT1), mRNA 7407 20106 3341 0.63 2.0E-13 10835072 NT Homo sapiens N-myristoyltransferase 1 (NMT1), mRNA 10937 23822 37249 1.93 2.0E-13 5031896 NT Homo sapiens mab-21 (C. elegans)-like 1 (MAB21L1) mRNA Page 235 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLASTE No. NO: NO: Source Value 12453 25203 25.49 2.0E-13 AW892155.1 ETS_HUMAN CM0-NN0001-100300-274-e11 NN0001 Homo sapiens cDNA 311 13403 26320 1.59 1.0E-13 S74129.1 NT FGF-1=fibroblast growth factor 1 [human, kidney, Genomic, 342 nt, segment 2 of 2] 913 13965 26912 5.04 1.0E-13 AJ007973.1 NT Homo sapiens LGMD28 gene H. sapiens DMA, DMB, HLA-Z1, IPP2, LMP2, TAP1, LMP7, TAP2, DOB, DQB2 and RING8, 9, 13 and 14 1364 14395 27350 1.78 1.0E-13 X87344.1 NT genes nw21g02.s1 NCI_CGAP_GCOBO Homo sapiens cDNA clone IMAGE:1241138 3' similar to contains THR 13 2035 15052 28050 2.8 1.0E-13 AA720574.1 ETS_HUMAN THR repetitive element ; 4704 17709 30572 1.95 1.0E-13 BF340987.1 ETS_HUMAN 602038009F1 NCI_CGAP_Brn64 Homo sapiens cDNA clone IMAGE:4185866 5' 6713 19749 32953 0.47 1.0E-13 AA090732.1 ETS_HUMAN y1 535.seq F Human fetal heart, Lambda ZAP Express Homo sapiens cDNA 5' nn24d01.s1 NCI_CGAP_Gas1 Homo sapiens cDNA clone IMAGE:108401 3' similar to contains Alu 8489 21420 34757 1.03 1.0E-13 AA577812.1 ETS_HUMAN repettiye elementcontains element MER24 repetitive element; nn24d01.s1 NCI_CGAP_Gas1 Homo sapiens cDNA clone IMAGE:108401 3' similar to contains Alu 8489 21420 34758 1.03 1.0E-13 AA577812.1 ETS_HUMAN repettiye elementcontains element MER24 repetitive element; 10592 23478 0.93 1.0E-13 O15481 SWISSPROT MELANOMA-ASSOCIATED ANTIGEN B4 (MAGE-B4 ANTIGEN) 10790 23675 37106 0.57 1.0E-13 AF300701.1 NT Mus musculus osteotesticular protein tyrosine phosphatase mRNA, complete cds 7145e10.x1 Soares_NSF_F8_9W_OT_PA_P_S1 Homo sapiens cDNA clone IMAGE:3524443 3' similar to 11818 24739 38230 11.71 1.0E-13 BF108755.1 ETS_HUMAN contains MER29.b2 MER29 repatitive element ; 12292 25103 1.6 1.0E-13 AV715377.1 ETS_HUMAN AV715377 DCB Homo sapiens cDNA clone DCBAIE03 5' 12892 25482 2.97 1.0E-13 AJ271735.1 NT Homo sapiens Xq pseudoautosoma region; segment 1/2 aj24c01.s1 Soares_testis_NHT Homo saplens cDNA clone 1391232 3' similar to contains MER19.t1 MER19 353 13440 26353 2.13 9.0E-14 AA781159.1 ETS_HUMAN repetitive element; aj24c01.s1 Soares_testis_NHT Homo saplens cDNA clone 1391232 3' similar to contains MER19.t1 MER19 354 13441 26354 2.16 9.0E-14 AW861577.1 ETS_HUMAN repetitive element; 2632 15630 28624 1.41 9.0E-14 AJ133127.1 NT Homo sapiens mRNA for sodium-glucose cotransporter (SGL T2 gene) 2632 15630 28625 1.41 9.0E-14 AJ133127.1 NT Homo sapiens mRNA for sodium-glucose cotransporter (SGL T2 gene) 2602 15791 28790 7.93 9.0E-14 AB038162.1 NT Homo sapiens TFF gene cluster for trofoll factor, complete cds 3157 16207 29097 6.47 9.0E-14 ETS_HUMAN xo54h05.x1 NCI_CGAP_Ut1 Homo sapiens cDNA clone IMAGE:2707833 3' aj24c01.s1 Soares_testis_NHT Homo sapiens cDNA clone 1391232 3' similar to contains MER19.t1 MER19 3284 13440 26353 1.01 9.0E-14 AA781169.1 ETS_HUMAN repstitive element; 3862 16891 29776 8.91 9.0E-14 AJ002153.1 NT Saguinus oedipus gene for seminal vesicle secreted protein semenogelin 1 3556 16593 1.27 8.0E-14 BE468263.1 ETS_HUMAN hz71c09.x1 NCI_CGAP_Lu24 Homo saplens cDNA clone IMAGE:3213424 3' 4039 17066 4.12 8.0E-14 R76269.1 ETS_HUMAN yi72e03.r1 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGE:144796 3' Page 236 of 545<BR> Table 4<BR> Single Exon Probes Expressed in Adult Liver Most Similar Probe Exon Top Hit ORF SEQ Expression (Top) Hit Top Hit Acession SEQ ID SEQ ID Database Top Hit Descriptor ID NO: Signal BLASTE No. NO: NO: Source Value 9980 21338 34674 50.26 8.0E-14 X89211.1 NT H. sapiens DNA for endogenous retroviral like element 10089 22882 36268 3.61 8.0E-14 AA219316.1 ETS_HUMAN zq17c10.s1 Stratagene fetal retina 937202 Homo sapiens cDNA clone IMAGE:629970 3' 11865 24755 1.47 8.0E-14 BE062558.1 ETS_HUMAN QV2-BT0258-261099-014-a01 BT0258 Homo sapiens cDNA 12644 25320 31822 3.19 8.0E-14 AI688118.1 ETS_HUMAN wc92h08.x1 NCI_CGAP_Co3 Homo sapiens cDNA clone IMAGE:2326143 3' xf67e10.x1 NCI_CGAP_Gas4 Homo sapiens cDNA clone IMAGE:2623146 3'similar to contains MER10.t2 1652 15906 5.71 7.0E-14 AW151673.1 ETS_HUMAN MER10 repetitive element; 9476 22404 0.74 7.0E-14 AL163285.2 NT Homo sapiens chromosome 21 segment HS21C085 388 13472 26390 8.8 6.0E-14 AF020503.1 NT Homo sapiens FRA3B common fragile region, diadenosine triphosphate hydrolase (FHIT) gene, exon 5 10337 23226 36641 2.66 6.0E-14 AF020503.1 NT Homo sapiens FRA3B common fragile region, diadenosine triphosphate hydrolase (FHIT) gene, exon 5 10337 23226 36642 2.66 6.0E-14 AF020503.1 NT Homo sapiens FRA3B common fragile region, diadenosine triphosphate hydrolase (FHIT) gene, exon 5 CANALICULAR MULTISPECIFIC ORGANIC ANION TRANSPORTER 1 (MULTIDRUG RESISTANCE- 641 13702 26609 5.79 5.0E-14 Q63120 SWISSPROT ASSOCIATED PROTEIN 2) (CANALICULAR MULTIDRUG RESISTANCE PROTEIN) xb03b05.x1 NCI_CGAP_GU1 Homo sapiens cDNA clone IMAGE:2575185 3' similar to contains L1.t2 L1 5186 18178 31024 1.07 5.0E-14 AW073791.1 ETS_HUMAN repetitive element; 5723 18796 31888 5.15 5.0E-14 P08547 SWISSPROT LINE-1 REVERSE TRANSCRIPTASE HOMOLOG 1150 15893 1.84 4.0E-14 P04928 SWISSPROT S-ANTIGEN PROTEIN PRECURSOR 1900 14921 27901 8.26 4.0E-14 AJ007973.1 NT Homo sapiens LGMD2B gene 3615 16845 0.92 4.0E-14 AA046502.1 EST_HUMAN zk67a06.r1 Soares_pregnant_uterus_NbHPU Homo sapiens cDNA clone IMAGE:487858 5' yy73c12.s1 Soares_multiple_sclerosis_2NbHMSP Homo sapiens cDNA clone IMAGE:279190 3' similar to 4394 17407 30273 1.05 4.0E-14 N46328.1 EST_HUMAN contains L1.t3 L1 repetitive element; H. sapiens DMA, DMB, HLA-Z1, IPP2, LMP2, TAP1, LMP7, TAP2, DOB, DQB2 and RING8, 9, 13 and 14 8636 21467 0.73 4.0E-14 X87344.1 NT genes wm08c03.x1 NCI_CGAP_Ut4 Homo sapiens cDNA clone IMAGE:2435332 3' similar to contains Alu 1