Login| Sign Up| Help| Contact|

Patent Searching and Data


Title:
IMMUNOTHERAPEUTIC MODULATION OF AMYLOIDOGENIC DISEASE USING NON-FIBRILLOGENIC, NON-AMYLOIDOGENIC POLYMERIZED PROTEINS AND PEPTIDES
Document Type and Number:
WIPO Patent Application WO/2013/012811
Kind Code:
A2
Abstract:
The present invention is directed to polymerized products and compositions useful for the treatment and prevention of amyloid disease in a subject. The invention further relates to isolated antibodies that recognize a common conformational epitope of amyloidogenic proteins or peptides that are useful for the diagnosis, treatment, and prevention of amyloid disease.

Inventors:
WISNIEWSKI THOMAS M (US)
GONI FERNANDO (US)
Application Number:
PCT/US2012/046941
Publication Date:
January 24, 2013
Filing Date:
July 16, 2012
Export Citation:
Click for automatic bibliography generation   Help
Assignee:
UNIV NEW YORK (US)
WISNIEWSKI THOMAS M (US)
GONI FERNANDO (US)
International Classes:
A61K48/00; A61K38/16; A61K38/17; A61P25/16; A61P25/28
Domestic Patent References:
WO2010016912A22010-02-11
Foreign References:
US20080050383A12008-02-28
US20090163420A12009-06-25
Other References:
SADLER, K. ET AL.: 'Synthetic peptide epitope-based polymers: controlling size and determining the efficiency of epitope incorporation' J. PEPT. RES. vol. 60, no. 3, September 2002, pages 150 - 158
Attorney, Agent or Firm:
CHILDS, Carissa, R. et al. (A Professional Corporation70 Linden Oaks, Suite 21, Rochester NY, US)
Download PDF:
Claims:
WHAT IS CLAIMED:

1. A non-amyloidogenic, non-fibrillogenic polymerized product comprising two or more protein and/or peptide units, wherein each unit is independently selected from the group consisting of an amyloid-beta (Αβ) peptide, an a-synuclein protein or peptide, a tau protein or peptide, a TAR DNA-binding protein 43 (TDP-43) protein or peptide, an amylin protein or peptide, a prion protein (PrP) protein or peptide, and any combination thereof.

2. The polymerized product of claim 1, wherein the Αβ peptide comprises an amino acid sequence selected from the group consisting of amino acid residues 1-16 of SEQ ID NO: 1 , amino acid residues 1-20 of SEQ ID NO: 1 , amino acid residues 1-30 of SEQ ID NO: 1 , amino acid residues 1-40 of SEQ ID NO: 1 , amino acid residues 1-42 of SEQ ID NO: l , amino acid residues 10-30 of SEQ ID NO: 1, amino acid residues 20-40 of SEQ ID NO: 1 , and amino acid residues 20-42 of SEQ ID NO: l .

3. The polymerized product of claim 2, wherein the Αβ peptide comprises amino acid residues 1-42 of SEQ ID NO: 1. 4. The polymerized product of claim 1 , wherein the Αβ peptide comprises an amino acid sequence selected from the group consisting of amino acid residues 1-30 of SEQ ID NO:2 (Αβ1-30Κ18Κι9), amino acid residues 1 -40 of SEQ ID NO:2 (Αβ 1-40Κι8Κ19), amino acid residues 1 -42 of SEQ ID NO:2 (Αβ1 -42Κι8Κι9), amino acid residues 1 -20 of SEQ ID NO:2 (Αβ 1 -20Κ]8Κι9), amino acid residues 10- 30 of SEQ ID NO:2 (Αβ10-30Κι8Κι9), amino acid residues 10-40 of SEQ ID NO:2 (Αβ10-40Κ,8Κ19), amino acid residues 10-42 of SEQ ID NO:2 (Αβ 10-42Κι8Κ19), amino acid residues 20-40 of SEQ ID NO:2 (Αβ20-40 ]8Κ19), and amino acid residues 20-42 of SEQ ID NO:2 (Αβ20-42Κι8Κ!9). 5. The polymerized product of claim 4, wherein the Αβ peptide comprises amino acid residues 1 -30 of SEQ ID NO:2 (Αβ1 -30Κι8Κι9).

6. The polymerized product of claim 1 , wherein the a-synuclein protein or peptide comprises an amino acid sequence of SEQ ID NO:3 or a peptide derived from the amino acid sequence of SEQ ID NO: 3. 7. The polymerized product of claim 1, wherein the tau protein or peptide comprises an amino acid sequence of SEQ ID NO: 4 or a peptide derived from the amino acid sequence of SEQ ID NO:4.

8. The polymerized product of claim 1 , wherein the TDP-43 protein or peptide comprises an amino acid sequence of SEQ ID NO:5 or a peptide derived from the amino acid sequence of SEQ ID NO:5.

9. polymerized product of claim 1 , wherein the amylin protein or peptide comprises an amino acid sequence of SEQ ID NO:6 or a peptide derived from the amino acid sequence of SEQ ID NO:6.

10. The polymerized product of claim 1 , wherein the PrP protein or peptide comprising an amino acid sequence of SEQ ID NO:7 or a peptide derived from the amino acid sequence of SEQ ID NO:7.

1 1. The polymerized product of claim 1 , wherein the polymerized product is a co-polymer comprising one or more amyloid-beta (Αβ) peptides copolymerized with one or more a-synuclein proteins or peptides. 12. The polymerized product of claim 1 , wherein the polymerized product is a co-polymer comprising one or more amyloid-beta (Αβ) peptides co- polymerized with one or more tau peptides.

13. The polymerized product of claim 1 , wherein the polymerized product is a co-polymer comprising one or more TDP-43 peptides co-polymerized with one or more amyloid-beta (Αβ) peptides and/or one or more tau peptides.

14. The polymerized product of claim 1, wherein an adjuvant polypeptide is linked in frame to one or more of the proteins or peptides of the polymerized product.

15. The polymerized product of claim 14, wherein the adjuvant polypeptide is selected from the group consisting of cholera toxin B, flagellin, human papillomavirus LI or L2 protein, herpes simplex glycoprotein D (gD), complement C4 binding protein, TL4 ligand, and 1L- 1 β.

16. The polymerized product of claim 14, wherein the one or more proteins or peptides of the polymerized product further comprises a linker sequence connecting the protein or peptide and the adjuvant polypeptide.

17. The polymerized product of claim 1 , wherein an immunogenic carrier molecule is conjugated to the one or more proteins or peptides of the polymerized product.

18. The polymerized product of claim 17, wherein the immunogenic carrier molecule is covalently or non-covalently bonded to the one or more proteins or peptides of the polymerized product.

19. The polymerized product of claim 17, wherein the immunogenic carrier molecule is selected from the group consisting of bovine serum albumin, chicken egg ovalbumin, keyhole limpet hemocyanin, tetanus toxoid, diphtheria toxoid, thyroglobulin, a pneumococcal capsular polysaccharide, CRM 197, and a meningococcal outer membrane protein.

20. A pharmaceutical composition comprising:

the polymerized product of claim 1 and

a pharmaceutically acceptable carrier.

21. The pharmaceutical composition of claim 20 further comprising:

an adjuvant.

22. The pharmaceutical composition of claim 21 , wherein the adjuvant is selected from the group consisting of an aluminum salt, flagellin, Freund's complete or incomplete adjuvant, lysolecithin, pluronic polyols, polyanions, an oil- water emulsion, dinitrophenol, iscomatrix, and liposome polycation DNA particles. 23. The pharmaceutical composition of claim 22, wherein the adjuvant comprises aluminum salt.

24. The pharmaceutical composition according to claim 20 further comprising:

a delivery vehicle. 25. The pharmaceutical composition according to claim 24, wherein the delivery vehicle is selected from the group consisting of biodegradable microspheres, microparticles, nanoparticles, liposomes, collagen minipellets, and cochleates.

26. The pharmaceutical composition according to claim 24, wherein the delivery vehicle comprises attenuated salmonella.

27. A method of inducing an immune response against an amyloidogenic form of a protein or peptide in a subject, said method comprising:

administering to the subject the polymerized product of claim 1 under conditions effective to induce an immune response against the amyloidogenic form of a protein or peptide in the subject.

28. The method according to claim 27 further comprising:

selecting a subject that would benefit from an immune response against an amyloidogenic form of a protein or peptide prior to said administering the pharmaceutical composition to the subject.

29. The method according to claim 27, wherein the protein or peptide having an amyloidogenic form is selected from the group consisting of beta protein precursor, prion proteins, a-synuclein, ABri precursor protein, ADan precursor protein, amylin, apolipoprotein AI. apolipoprotein All, lyzozyme, cystatin C, gelsolin, protein, atrial natriuretic factor, calcitonin, keratoepithelin, lactoferrin, immunoglobulin light chains, tau, transthyretin, A amyloidosis, p2-microglobulin, immunoglobulin heavy chains, fibrinogen alpha chains, prolactin, keratin, medin, and TDP-43.

30. A method of preventing or treating a condition mediated by an amyloidogenic protein or peptide in a subject, said method comprising:

administering to the subject the polymerized product of claim 1 under conditions effective to treat or prevent the condition mediated by the amyloidogenic protein or peptide in the subject. 1. The method of claim 30 further comprising:

selecting a subject at risk for having or having a condition mediated by an amyloidogenic protein or peptide prior to said administering the pharmaceutical composition to the subject.

32. The method according to claim 30, wherein the condition mediated by an amyloidogenic protein or peptide is selected from the group consisting of Alzheimer's disease, Diffuse Lewy body disease, Down syndrome, fronto-temporal dementia, Parkinson's disease, hereditary cerebral hemorrhage with amyloidosis, kuru, Creutzfeldt- Jakob disease, Gerstmann-Straussler-Scheinker disease, fatal familial insomnia, British familial dementia, Danish familial dementia, familial corneal amyloidosis, Familial corneal dystrophies, medullary thyroid carcinoma, insulinoma, type 2 diabetes, isolated atrial amyloidosis, pituitary amyloidosis, aortic amyloidosis, plasma cell disorders, lymphoproliferative disorders, familial amyloidosis, senile cardiac amyloidosis, inflammation-associated amyloidosis, familial Mediterranean fever, dialysis-associated amyloidosis, systemic amyloidosis, and familial systemic amyloidosis.

33. An isolated antibody or binding portion thereof having antigenic specificity for an epitope of a non-amyloidogenic, non-fibrillogenic polymerized product, wherein the polymerized product comprises two or more protein and/or peptide units, each unit independently selected from the group consisting of an amyloid-beta (Αβ) peptide, an a-synuclein protein or peptide, a tau protein or peptide, a TAR DNA-binding protein 43 (TDP-43) protein or peptide, an amylin protein or peptide, a prion protein (PrP) protein or peptide, and any combination thereof. 34. The isolated antibody or binding portion thereof of claim 33, wherein the epitope is a conformational epitope.

35. A pharmaceutical composition comprising:

the antibody or binding portion thereof of claim 33 and a pharmaceutically acceptable carrier.

36. A method of treating a condition mediated by an amyloidogenic protein or peptide in a subject, said method comprising:

administering to the subject the antibody or binding portion thereof of claim 33 in an amount effective to treat the condition mediated by the amyloidogenic protein or peptide in the subject.

37. A method according to claim 36 further comprising:

selecting a subject having a condition mediated by an amyloidogenic protein or peptide prior to said administering the antibody to the subject. 38. The method according to claim 36, wherein the condition is selected from the group consisting of Alzheimer's disease, Down syndrome, fronto- temporal dementia, Parkinson's disease, hereditary cerebral hemorrhage with amyloidosis, kuru, Creutzfeldt- Jakob disease, Gerstmann-Straussier-Scheinker disease, fatal familial insomnia, British familial dementia, Danish familial dementia, familial corneal amyloidosis, Familial corneal dystrophies, medullary thyroid carcinoma, insulinoma, type 2 diabetes, isolated atrial amyloidosis, pituitary amyloidosis, aortic amyloidosis, plasma cell disorders, familial amyloidosis, senile cardiac amyloidosis, inflammation-associated amyloidosis, familial Mediterranean fever, dialysis-associated amyloidosis, systemic amyloidosis, and familial systemic amyloidosis.

39. A method of diagnosing an amyloid disease in a subject, said method comprising:

detecting, in the subject, the presence of an amyloidogenic protein or peptide using a diagnostic reagent, wherein the diagnostic reagent comprises the antibody or binding fragment thereof of claim 33, and

diagnosing an amyloid disease in the subject based on said detecting.

40. The method according to claim 39, wherein said detecting comprising:

obtaining a biological sample from the subject;

contacting the biological sample from the subject with the diagnostic reagent under conditions effective for the diagnostic reagent to bind to an

amyloidogenic protein or peptide in the sample; and

detecting binding of the diagnostic reagent to an amyloidogenic protein or peptide in the sample.

41. The method according to claim 40, wherein the diagnostic reagent contains a detectable label and said detecting is carried out using an in vivo imaging device to detect the labeled diagnostic reagent in the subject.

42. A diagnostic kit comprising:

the isolated antibody or binding fragment thereof of claim 33 and a detectable label.

Description:
IMMUNOTHERAPEUTIC MODULATION OF AMYLOIDOGENIC DISEASE USING NON-FIB RILLOGENIC, NON-AMYLOIDOGENIC

POLYMERIZED PROTEINS AND PEPTIDES [0001] This application claims the benefit of U.S. Provisional Patent

Application Serial Nos. 61/509,320 and 61/509,442, both filed July 19, 201 1 , which are hereby incorporated by reference in their entirety.

[0002] This invention was made with government support under grant numbers AG20245 and NS073501 awarded by the National Institutes of Health. The government has certain rights in this invention.

FIELD OF THE INVENTION

[0003] The present invention relates to pharmaceutical agents and antibodies suitable for the diagnosis, prevention, and treatment of amyloid disease.

BACKGROUND OF THE INVENTION

[0004] Amyloidosis broadly encompasses a variety of diseases that are characterized by the extracellular or intracellular deposition of amyloid proteins in tissues and/or organs. Amyloids are insoluble fibrous protein/peptide aggregates and their deposition may occur in localized sites or systemically. The fibrillar composition of these deposits is an identifying characteristic for the various forms of amyloid disease. In some cases the amyloid protein/peptide accumulates

intracellullary, resulting in cell dysfunction and ultimately cell death. Examples of intracellular amyloid proteins include cc-synuclein, forming Lewy bodies in

Parkinson's disease, and huntingtin, forming neuronal inclusions in Huntington disease. The pathogenesis of Alzheimer's disease (AD), the most common of the amyloid related neurodegenerative disorders, is linked to the cleavage of the amyloid precursor protein generating the amyloid-β (Αβ) peptide which undergoes a shape change into a pathological conformer having a high β-sheet content. Intracerebral and cerebrovascular deposits composed primarily of fibrils of the pathological Αβ peptide are characteristic of both familial and sporadic forms of AD. In addition to Αβ, abnormally folded and phosphorylated tau protein forms toxic oligomeric structures and neurofibrillary tangles in AD. Similar to AD, prion-associated diseases, such as Creutzfeld-Jacob disease, have also been characterized as amyloid diseases. The pathogenesis of prion disease is linked to a change of the cellular prion protein (PrP c ) into the disease associated PrP c (Sc for scrapie). Currently, there is no effective therapy for any of these disorders.

[0005] An active area of translational research and current clinical trials for amyloid disease has focused on immunotherapy, using both passive and active immunization against amyloid proteins, particularly Αβ in AD (Wisniewski et al., "Amyloid-β Immunization for Alzheimer's Disease," Lancet Neurol 7:805-81 1 (2008)). Although immunotherapy holds great promise as a means of reducing amyloid deposition, it, unfortunately, has been accompanied by major obstacles. Specific problems associated with immunotherapy that were identified in a clinical trial for AD include the potential of toxicity from encephalitis (related to excessive cell mediated immunity), the immunological targeting of both the normal and abnormal Αβ peptide, the failure to address tau related pathology, and the apparent poor efficacy. Moreover, although autopsy data from this early immunotherapy vaccine trial suggested that many patients had a significant reduction in amyloid burden, these patients exhibited only minor cognitive benefits (Wisniewski et al., "Amyloid-β Immunization for Alzheimer's Disease," Lancet Neurol 7:805-81 1 (2008) and Holmes et al., "Long Term Effects of Αβ42 Immunization in Alzheimer's

Disease: Immune Response, Plaque Removal and Clinical Function," Lancet 372:216- 223 (2008)). Therefore, an immunotherapeutic approach that can effectively reduce amyloid burden and overcome the aforementioned problems is warranted.

[0006] The present invention is directed to overcoming these and other deficiencies in the art.

SUMMARY OF THE INVENTION

[0007] A first aspect of the present invention relates to a non-amyloidogenic, non-fibrillogenic polymerized product comprising two or more protein and/or peptide units, where each unit is independently selected from the group consisting of an amyloid-beta (Αβ) peptide, an a-synuclein protein or peptide, a tau protein or peptide, a TAR DNA-binding protein 43 (TDP-43) protein or peptide, an amylin protein or peptide, a prion protein (PrP) protein or peptide, and any combination thereof,

[0008] A second aspect of the present invention is directed to an isolated antibody or binding portion thereof having antigenic specificity for an epitope a non- amyloidogenic, non-fibrillogenic polymerized product. The polymerized product comprises two or more protein and/or peptide units, each unit independently selected from the group consisting of an amyloid-beta (Αβ) peptide, an a-synuclein protein or peptide, a tau protein or peptide, a TAR DNA-binding protein 43 (TDP-43) protein or peptide, an amylin protein or peptide, a prion protein (PrP) protein or peptide, and any combination thereof.

[0009] The development of an effective immunotherapeutic approach for the prevention and treatment of amyloid related diseases has been hindered by potential cell-mediated toxicity, non-specific immunological targeting of both normal and amyloidogenic proteins, and overall poor efficacy. The immunotherapeutic approach of the present invention employs non-amyloidogenic, non-fibrillogenic polymerized protein and/or peptides and co-polymerized proteins and/or peptides to generate a specific immunological response to conformational epitopes that are shared by various amyloidogenic proteins, thereby overcoming many of the above noted obstacles. BRIEF DESCRIPTION OF THE DRAWINGS

[0010] Figures 1 A- ID show the results of locomotor activity testing in SwDI transgenic (Tg) control mice and Tg mice vaccinated with synthetic polymerized Αβ peptide (Αβ 1-30ι 8 Κΐ9Κ), polymerized ABri peptide (ABri-Glut), or polymerized Αβ1-42 peptide. No significant differences between the groups were noted in distance traveled (Figure 1 A) or mean velocity (Vrnean) (Figure 1 C). Αβ1-42 vaccinated Tg mice exhibited slower maximum velocity (Vmax) (Figure I B) (p=0.0234 post-hoc only; Αβ 1 -42 versus control p<0.05) and longer resting time (Figure I D) (p=0.031 1 post-hoc only; Αβ1 -42 versus control p<0.05) compared to controls. No significant differences between the Αβ1~30 ΐ 8 Κι 9 Κ and ABri treated Tg animals and controls in these parameters were observed (Figures I B and ID) [0011] Figures 2A-2D show the results of locomotor activity testing in Tg3x transgenic control mice and Tg mice vaccinated with synthetic polymerized Αβ peptide (Αβ 1-30Κι 8 Κΐ9), polymerized ABri peptide (ABri-Glut), or the combination of Αβ 1-30 Ki gKi 9 and ABri polymerized peptides. No significant differences between the groups were noted in distance traveled (Figure 2 A), maximum velocity (Vmax) (Figure 2B), mean velocity (Vmean) (Figure 2C), or in resting time (Figure 2D).

[0012] Figures 3A-3C illustrate the effects of polymerized peptide vaccination on behavioral improvement in 3xTg and SwDI transgenic animal models of amyloidogenic disease. Figure 3A is a graph depicting the results of the radial arm maze. The number of errors (y-axis) versus the day of testing (x-axis) are plotted for 3xTg mice vaccinated with polymerized ABri, transgenic control (Tg control), and wildtype. Vaccinated transgenic animals commit significantly fewer errors that non- treated transgenic and perform similarly to the wildtype animals. p=0.0044 one-way ANOVA; p<0.01 wildtype and Tg pABri treated vs. Tg control; p=>0.05 wildtype vs. Tg pABri treated. Figure 3B is a similar graph showing the radial arm maze results for 3xTg animals vaccinated with polymerized ABri, polymerized Αβ 1-30Κι 8 Κΐ 9, and the combination (polymerized ABri and Αβ1-30Κ ΐ 8 Κ ΐ9 ). All treatment groups committed significantly fewer errors than the transgenic control animals. p=0.004 by one-way ANOVA; p<0.01 all Tg Treated groups and wild-type versus Tg Control; no significant difference between wild-type and Tg treated groups. Figure 3C is another graph depicting the results of the radial arm maze cognitive testing. In this graph the number of errors (y-axis) versus the day of testing (x-axis) are plotted for SwDI transgenic mice vaccinated with polymerized ABri, polymerized Αβ1-30 ΐ 8 Κ 19 Κ, polymerized Αβ 1-42, transgenic control mice, and wildtype mice (WT). All treatment groups committed significantly fewer errors than the transgenic control animals (p<0.01 all Tg Treated groups and wild-type versus Tg Control).

[0013] Figures 4A-4C are bar graphs showing IgM and IgG antibody levels raised in TgSwDI mice vaccinated with polymerized ABri peptide (pABri) (Figure 4A), polymerized Αβ 1 -30Κι 8 Κι 9 (Figure 4B), and polymerized Αβ1-42 peptide (Figure 4C). Antibody titers against Αβ 1-40, Αβ 1-42, pABri, and a mutant Αβ ΐ- 30KK were measured in vaccinated mice prior to the first inoculation (TO), after the 6th inoculation (Tl ) and at the time of sacrifice (TF). (***p<0.0001 , **p<0.01 , *p>0.05 versus TO).

[0014] Figures 5A-5D are bar graphs showing IgM and IgG antibody levels raised in 3xTg mice vaccinated with polymerized ABri peptide (Figure 5A), polymerized Αβ 1 -30 18 Ki9 (Figure 5B), the combination of polymerized peptides (Figure 5C), and vehicle (Figure 5D). Antibody titers against Αβ 1-40, Αβ1-42, pABri, and a mutant Αβ 1-30ΚΚ were measured in vaccinated mice prior to the first inoculation (TO), after the 6th inoculation (Tl ), and at the time of sacrifice (TF). (***p<0.0001 , **p<0.01 , *p>0.05 versus TO).

[0015] Figures 6A-6C depict the amyloid and paired helical fiber (PHFl) burden in Tg3x transgenic control and vaccinated animals. Figure 6A is a bar graph showing the reduction of hippocampal amyloid burden in Tg3x animals administered polymerized ABri (Tg-pABri), polymerized Αβ 1-30ι 8 Κ ] 9 (Tg-AB 1 -30KK), or the combination of polymerized peptides (Tg-combined) compared to transgenic control (Tg-control) animals (p=0.001 by one way ANOVA post-hoc testing; p<0.01 all treatment groups vs. control). Figures 6B and 6C show a reduction in PHFl in the hippocampus and cortex, respectively, of Tg3x animals administered polymerized ABri or the combination of polymerized ABri and Αβ1-30ι 8 Κΐ9Κ (p<0.0001 one way ANOVA post hoc; p<0.001 Tg-ABri and Tg-combined vs. Tg-control and Tg-Αβΐ- 30I 8 KIQK for both hippocampal and cortical analyses). No significant difference was found between Tg-control and Tg- Αβ1-30ι 8 Κΐ 9 Κ treated animals.

[0016] Figures 7A-7B depict the amyloid burden in SwDI transgenic control and vaccinated animals. Figure 7A is a bar graph showing the reduction in hippocampal amyloid burden in polymerized ABri vaccinated (Tg pABri), polymerized Αβ1-30ι 8 Κ 19 Κ vaccinated (Tg-Αβ 1 -30KK), and polymerized Αβ1-42 vaccinated (Tg-Ap42) animals compared to transgenic control (Tg Control). Figure 7B is an electron micrograph (EM) image of negatively stained polymerized Αβ 1 -42 peptide, which is predominately in the form of spherical particles of ~200nm.

[0017] Figures 8A-8B are EM images of aged Αβ1 -42 peptides. In Figure 8 A Αβΐ -42 peptide was aged for 3 months after controlled polymerized with

glutaraldehyde. There is no evidence of fibril formation, and the sample was typical of oligomerized peptides/proteins. Figure 8B is an Αβ 1 -42 peptide from the same synthesis batch as the peptide in Figure 8A, This peptide was dissolved in saline and aged for 3 months before the EM. In contrast to the polymerized Αβ 1 -42 peptide, the unpolymerized Αβ1 -42 sample was completely fibrillized.

[0018] Figure 9 shows specific anti-PrP IgA antibodies in feces of control and deer vaccinated with prion protein (PrP) as measured by ELISA. White tail deer were orally inoculated with an attenuated salmonella carrying deer-PrP or an empty vector (control) four times over a period of a few months following the protocol for mucosal vaccination described in Goni et al, "High Titers of Mucosal and Systemic Anti-PrP Antibodies Abrogate Oral Prion Infection in Mucosal-Vaccinated Mice," Neurosci. 153:679-686 (2008), which is hereby incorporated by reference in its entirety.

Animals were subsequently orally boosted with a mixture of polymerized PrP and polymerized recombinant PrP peptides as described in the Examples herein.

Antibody titers were measure before the first inoculation (TO), after the fourth inoculation (T5), and ten days after the boost (T6). The boost with PrP and polymerized PrP fragments was repeated two months after the first boost, and titers were again measured 10 days after the second boost (T7). The control group did not develop any noticeable titer whereas the vaccinated group showed some increase in mucosa titer after the immune response was established with the salmonella oral delivery. The titers were very low (T5) but were greatly enhanced after the animals were boosted with the polymerized PrP and PrP fragments (T6 and T7) showing the importance of these antigenic preparation to have a sustainable immune response.

[0019] Figure 10 shows serum anti-PrP IgM antibodies of control deer and deer vaccinated with PrP as described in Figure 9. Again the control group did not show any noticeable increase in antibody titer; whereas the vaccinated group showed some concomitant IgM titer in serum at the same time of the mucosal response (T5). Anti-PrP antibody titers in the vaccinated animals greatly increased after the two boosts with the polymerized PrP and PrP fragments showing that this type of boost could invoke a therapeutic serum response. Vaccinated vs. control at TO not significant, * p<0.05, ** p=0.0009, *** p<0.0001 (two-tailed test).

[0020] Figure 1 1 shows immunoblots of salmonella lysate (lane 1), sheep PrP

(lane 2), polymerized sheep PrP (lane 3), deer PrP (lane 4), and polymerized deer PrP (lane 5) that were developed using purified antibodies from vaccinated animal 781 at T7 and control animal 786 at T7. Both animals mounted a good immune response to saimoneila (lane i ); however, oniy the vaccinated animai had antibodies against different deer PrP molecules (lane 4) and the oligomers present in the polymerized deer PrP (lane 5). Vaccinated vs. control at TO not significant, * p<0.017, ** p=0.0022, *** p<0.01 (two-tailed test).

[0021] Figure 12 is a Kaplan and Meier survival curve showing the protective effect of PrP vaccination in White Tail Deer at 18 months after challenge. Three out of six control animals became sick with the prionoses Chronic Wasting Disease and were properly euthanized. None of the vaccinated animals had signs of the disease at 18-months. Protection for the progression of the disease is evident and due to the immune response elicited by the inoculations involving the polymerized PrP and PrP fragments.

DETAILED DESCRIPTION OF THE INVENTION

[0022] A first aspect of the present invention relates to a non-amyloidogenic, non-fibril logenic polymerized product comprising two or more protein and/or peptide units, where each unit is independently selected from the group consisting of an amyloid-beta (Αβ) peptide, an a-synuclein protein or peptide, a tau peptide or peptide, a TAR DNA-binding protein 43 (TDP-43) protein or peptide, an amylin protein or peptide, a PrP protein or peptide, and any combination thereof.

[0023] In accordance with this aspect of the invention suitable Αβ peptides of the polymerized product include, without limitation, Αβ 1-42 and peptides derived therefrom. The amino acid sequence of Αβ 1-42 is provided as SEQ ID NO: 1 below. daefrhdsgy evhhqklvff aedvgsnkga iiglmvggw ia (SEQ ID NO:l) [0024] Accordingly, in one embodiment of the invention, the Αβ peptide of the polymerized product comprises amino acid residues 1-42 of SEQ ID NO: 1.

Alternatively suitable Αβ peptides of the polymerized product include, without limitation, peptides comprising amino acid residues 1-16 of SEQ ID NO: l , amino acid residues 1-20 of SEQ ID NO: 1. amino acid residues 1-30 of SEQ ID NO: 1 , amino acid residues 1 -40 of SEQ ID NO: 1, amino acid residues 1-42 of SEQ ID NO: l , amino acid residues 10-30 of SEQ ID NO: l , amino acid residues 20-40 of SEQ ID NO: 1 , and amino acid residues 20-42 of SEQ ID NO: 1.

[0025] In another embodiment of the present invention, the Αβ peptide of the polymerized product contains two amino acid substitutions at amino acid residues 18 and 19 of SEQ ID NO: 1. In one embodiment the amino acid substitutions comprise a valine to lysine substitution at position 18 and a phenylalanine to lysine substitution at position 19 of SEQ ID NO: 1. Peptides having these two amino acid substitutions are referred to as Αβ ι 8 Κι 9 peptides and are derived from the amino acid sequence of SEQ ID NO:2 below. daefrhdsgy evhhqklkkf aedvgsnkga iiglmvggw ia (SEQ ID NO: 2)

[0026] Accordingly, suitable Αβ peptides comprising the double lysine substitution include, without limitation, peptides comprising amino acid residues 1 -30 of SEQ ID NO:2 (Αβ 1 -30Κι 8 Κ 19 ), amino acid residues 1 -40 of SEQ ID NO:2 (Αβ ΐ- 40K i 8 Ki 9 ), amino acid residues 1-42 of SEQ ID NO:2 (Αβ 1 -42Κι 8 Κι 9 ), amino acid residues 1 -20 of SEQ ID NO:2 (Αβ1-20Κ 18 Κι 9 ), amino acid residues 10-30 of SEQ ID NO:2 (Αβ10-30Κ, 8 Κ, 9 ), amino acid residues 10-40 of SEQ ID NO:2 (ΑβΙΟ- 40Ki 8 Ki 9 ), amino acid residues 10-42 of SEQ ID NO:2 (Αβ10-42Κ, 8 Κ (9 ), amino acid residues 20-40 of SEQ ID NO:2 (Αβ20-40Κι 8 Κ (9 ), and amino acid residues 20-42 of SEQ ID NO:2 (Αβ20-42Κ, 8 Κ ) 9 ).

[0027] The polymerized product of the present invention may comprise a homopolymer of an Αβ peptide or a copolymer of two or more different Αβ peptides. Alternatively, the polymerized product of the present invention may comprise a copolymer of an Αβ protein or peptide co-polymerized with any one or more of an a- synuclein protein or peptide, a tau protein or peptide, a TDP-43 protein or peptide, an amylin protein or peptide, and/or a PrP protein or peptide. In one embodiment of the present invention, the polymerized product comprises a copolymer of one or more Αβ peptides copolymerized with one or more a-synuclein proteins or peptides. In another embodiment of the present invention, the polymerized product comprises a copolymer of one or more Αβ peptides copolymerized with one or more tau proteins or peptides. In another embodiment of the present invention, the polymerized product comprises a copolymer of one or more Αβ peptides copolymerized with one or more TDP-43 proteins or peptides

[0028] The polymerized product of the present invention may also comprise an a-synuclein protein or peptide thereof. The a-synuclein protein comprises the amino acid sequence of SEQ ID NO:3.

1 mdvfmkglsk akegwaaae ktkqgvaeaa gktkegvlyv gsktkegwh gvatvaektk 61 eqvtnvggav vtgvtavaqk tvegagsiaa atgfvkkdql gkneegapqe giledmpvdp 121 dneayempse egyqdyepea (SEQ ID NO: 3) [0029] Accordingly, in one embodiment of the invention, the a-synuclein protein of the polymerized product comprises amino acid residues 1-140 of SEQ ID NO:3. Peptides of α-synuclein derived from the amino acid sequence of SEQ ID NO: 3 are also suitable for use in the polymerized product of the present invention. In one embodiment, the peptide comprises at least five contiguous amino acids of SEQ ID NO:3. In another embodiment, the peptide comprises at least 10, at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 90 or at least 100 contiguous amino acids of SEQ ID NO:3.

[0030] In one embodiment of the invention, the α-synuclein peptide is a C- terminal α-synuclein peptide as disclosed in WO 2004/041067 to Schenk at al., which is hereby incorporated by reference in its entirety. Suitable C-terminal a-synuclein peptides for use in the polymerized product of the present invention include, without limitation, peptides comprising amino acids residues 70- 140 of SEQ ID NO:3, amino acid residues 100- 140 of SEQ ID NO:3, amino acid residues 120- 140 of SEQ ID NO:3, amino acid residues 130- 140 of SEQ ID NO:3, or amino acid residues 135- 140 of SEQ ID NO:3.

[0031] The polymerized product of the present invention may comprise a homopolymer of an α-synuclein protein or peptide or a copolymer of two or more different α-synuclein proteins or peptides. Alternatively, the polymerized product of the present invention may comprise a copolymer of an α-synuclein protein or peptide co-polymerized with any one or more of an Αβ peptide, a tau protein or peptide, a TDP-43 protein or peptide, an amylin protein or peptide, and/or a PrP protein or peptide.

[0032] The pharmaceutical composition of the present invention may also comprise a tau protein or peptide thereof. Suitable tau proteins of the present invention include any of the eight isoforms of the human tau protein that are known in the art (see NCBI Accession Nos. NP_058519.3, NP_005901 , NP_058518.1 , NP_058525.1, NP_001 1 16539.1 , NP_001 1 16538.2, NP_001 190180.1 , and

NP_001 190181.1 , which are hereby incorporated by reference in their entirety). The tau isoforms vary in the number of N-terminal inserts resulting from the splicing of exons two and three, and microtubule-binding domains resulting from the splicing of exon ten. The amino acid sequence corresponding to human tau protein isoform 2 (441a.a), containing two N-terminal inserts and four microtubule binding (2N4R) domains is provided as SEQ ID NO:4 below. Met Ala Glu Pro Arg Gin Glu Phe Glu Val Met Glu Asp His Ala Gly 1 5 10 15

Thr Tyr Gly Leu Gly Asp Arg Lys Asp Gin Gly Gly Tyr Thr Met His

20 25 30

Gin Asp Gin Glu Gly Asp Thr Asp Ala Gly Leu Lys Glu Ser Pro Leu

35 40 45

Gin Thr Pro Thr Glu Asp Gly Ser Glu Glu Pro Gly Ser Glu Thr Ser

50 55 60

Asp Ala Lys Ser Thr Pro Thr Ala Glu Asp Val Thr Ala Pro Leu Val 65 70 75 80

Asp Glu Gly Ala Pro Gly Lys Gin Ala Ala Ala Gin Pro His Thr Glu

85 90 95

He Pro Glu Gly Thr Thr Ala Glu Glu Ala Gly He Gly Asp Thr Pro

100 105 110

Ser Leu Glu Asp Glu Ala Ala Gly His Val Thr Gin Ala Arg Met Val

115 120 125

Ser Lys Ser Lys Asp Gly Thr Gly Ser Asp Asp Lys Lys Ala Lys Gly

130 135 140

Ala Asp Gly Lys Thr Lys He Ala Thr Pro Arg Gly Ala Ala Pro Pro

145 150 155 160 Gly Gin Lys Gly Gin Ala Asn Ala Thr Arg lie Pro Ala Lys Thr Pro 165 170 175

Pro Ala Pro Lys Thr Pro Pro Ser Ser Gly Glu Pro Pro Lys Ser Gly

180 185 190

Asp Arg Ser Gly Tyr Ser Ser Pro Gly Ser Pro Gly Thr Pro Gly Ser

195 200 205

Arg Ser Arg Thr Pro Ser Leu Pro Thr Pro Pro Thr Arg Glu Pro Lys 210 215 220

Lys Val Ala Val Val Arg Thr Pro Pro Lys Ser Pro Ser Ser Ala Lys 225 230 235 240

Ser Arg Leu Gin Thr Ala Pro Val Pro Met Pro Asp Leu Lys Asn Val

245 250 255

Lys Ser Lys lie Gly Ser Thr Glu Asn Leu Lys His Gin Pro Gly Gly

260 265 270

Gly Lys Val Gin lie lie Asn Lys Lys Leu Asp Leu Ser Asn Val Gin

275 280 285

Ser Lys Cys Gly Ser Lys Asp Asn lie Lys His Val Pro Gly Gly Gly 290 295 300

Ser Val Gin lie Val Tyr Lys Pro Val Asp Leu Ser Lys Val Thr Ser 305 310 315 320

Lys Cys Gly Ser Leu Gly Asn lie His His Lys Pro Gly Gly Gly Gin

325 330 335

Val Glu Val Lys Ser Glu Lys Leu Asp Phe Lys Asp Arg Val Gin Ser

340 345 350

Lys lie Gly Ser Leu Asp Asn lie Thr His Val Pro Gly Gly Gly Asn

355 360 365 Lys Lys lie Glu Thr His Lys Leu Thr Phe Arg Glu Asn Ala Lys Ala 370 375 380

Lys Thr Asp His Gly Ala Glu lie Val Tyr Lys Ser Pro Val Val Ser 385 390 395 400

Gly Asp Thr Ser Pro Arg His Leu Ser Asn Val Ser Ser Thr Gly Ser

405 410 415

He Asp Met Val Asp Ser Pro Gin Leu Ala Thr Leu Ala Asp Glu Val 420 425 430

Ser Ala Ser Leu Ala Lys Gin Gly Leu (SEQ ID NO : 4 )

[0033] Accordingly, in one embodiment, a tau protein of the polymerized product of the present invention comprises amino acid residues 1-441 of SEQ ID NO:4. Alternatively, the composition of the invention comprises amino acid residues 1-758 of tau isoform 1 (NP_058519.3), amino acid residues 1-383 of tau isoform 3 (NP_058518.1 ), amino acid residues 1 -352 of tau isoform 4 (NP_058525.1), amino acid residues 1 -412 of tau isoform 5 (NP_001 1 16539.1 ), amino acid residue 1-776 of tau isoform 6 (NP_001 1 16538.2), amino acid residues 1 -381 of tau isoform 7 (NP_001 190180.1 ), and amino acid residues 1 -410 of tau isoform 8

(NP 001 190181.1 ).

[0034] The pharmaceutical composition of the present invention may also comprise tau peptides derived from the amino acid sequence of SEQ ID NO:4 or the amino acid sequence of any other tau isoform. In one embodiment, the tau peptide comprises at least five contiguous amino acids of a tau protein, e.g., the tau protein of SEQ ID NO:4. In anot er embodiment, the tau peptide comprises at least 10, at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 90, or at least 100 contiguous amino acids of a tau protein, e.g., the tau protein of SEQ ID NO:4. In yet another embodiment, the peptide comprises at least 200, at least 300, at least 400, or at least 500 contiguous amino acids, of a tau protein.

[0035] A number of tau peptides that are suitable for polymerization and incorporation into the polymerized product of the present invention are disclosed in U.S. Patent No. 8,012,936 to Sigurdsson et al., which is hereby incorporated by reference in its entirety. Suitable peptides include, without limitation, amino acid residues 1-30 of SEQ ID NO:4, amino acid residues 30-60 of SEQ ID NO:4, amino acid residues 60-90 of SEQ ID NO:4, amino acid residues 90-120 of SEQ ID NO:4, amino acid residues 120-150 of SEQ ID NO:4, amino acid residues 150-180 of SEQ ID NO:4, amino acid residues 210-240 of SEQ ID NO:4, amino acid residues 270- 300 of SEQ ID NO:4, amino acid residues 300-330 of SEQ ID NO:4, amino acid residues 330-360 of SEQ ID NO:4, amino acid residues 360-390 of SEQ ID NO:4, amino acid residues 390-420 of SEQ ID NO:4, amino acid residues 41 1-440 of SEQ ID NO 4, amino acid residues 133-162 of SEQ ID N04, amino acid residues 379- 409 of SEQ ID N04, amino acid residues 192-221 of SEQ ID NO:4, amino acid residues 221-250 of SEQ ID N04, or amino acid residues 184-213 of SEQ ID N04.

[0036] The polymerized product of the present invention may comprise a homopolymer of tau protein or peptide or a copolymer of two or more different tau proteins or peptides. Alternatively, the polymerized product of the present invention may comprise a copolymer of a tau protein or peptide co-polymerized with any one or more of an Αβ peptide, an -synuclein protein or peptide, a TDP43 protein or peptide, an amylin protein or peptide, and/or a PrP protein or peptide.

[0037] The polymerized product of the present invention may also comprise a

TAR DNA-binding protein 43 (TDP 43) or peptide thereof. The human TDP 43 protein comprises the amino acid sequence of SEQ ID NO:5.

1 mseyirvted endepieips eddgtvllst vtaqfpgacg Iryrnpvsqc mrgvrlvegi

61 lhapdagwgn lvywnypkd nkrkmdetda ssavkvkrav qktsdlivlg lpwktteqdl

121 keyfstfgev lmvqvkkdlk tghskgfgf rfteyetqvk vmsqrhmidg rwcdcklpns

181 kqsqdeplrs rkvf grcte dmtedelref fsqygdvmdv fipk frafa fvtfaddqia

241 qslcgedlii kgisvhisna epkhnsnrql ersgrfggnp ggfgnqggfg nsrgggaglg

301 nnqgsnmggg mnfgafsinp ammaaaqaal qsswgmmgml asqqnqsgps gnnqnqgnmq

361 repnqafgsg nnsysgsnsg aaigwgsasn agsgsgfngg fgssmdskss gwgm

(SEQ ID NO: 5)

[0038] Accordingly, in one embodiment of the invention, the TDP-43 protein of the polymerized product comprises amino acid residues 1-414 of SEQ ID NO:5. Peptides of TDP-43 derived from the amino acid sequence of SEQ ID NO:5 are also suitable for use in the pharmaceutical composition of the present invention. In one embodiment, the TDP-43 peptide comprises at least five contiguous amino acids of SEQ ID NO:5. In another embodiment, the TDP-43 peptide comprises at least 10, at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 90, at least 100, at least 150, at least 200, at least 250, or at least 300 contiguous amino acids of SEQ ID NO:5. [0039] The polymerized product of the present invention may comprise a homopolymer of a TDP-43 protein or peptide or a copolymer of two or more different TDP-43 proteins or peptides. Alternatively, the polymerized product of the present invention may comprise a copolymer of a TDP-43 protein or peptide co-polymerized with any one or more of an Αβ peptide, a tau protein or peptide, an a-synuclein protein or peptide, an amylin protein or peptide, and/or a PrP protein or peptide.

[0040] The polymerized product of the present invention can also comprise an amylin protein or peptide thereof. The human amylin protein comprises the amino acid sequence of SEQ ID NO:6. 1 hq ekrkcnt atcatqrlan flvhssnnfg ailsstnvgs ntygkrnave vlkreplnyl 61 pi (SEQ ID NO: 6)

[0041] Accordingly, in one embodiment of the invention, the amylin protein of the polymerized product comprises amino acid residues 1-62 of SEQ ID NO:6. Peptides of amylin derived from the amino acid sequence of SEQ ID NO:6 are also suitable for use in the pharmaceutical composition of the present invention. In one embodiment, the amylin peptide comprises at least five contiguous amino acids of SEQ ID NO:6. In another embodiment, the amylin peptide comprises at least 10, at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 55, at least 60 contiguous amino acids of SEQ ID NO:6.

[0042] The polymerized product of the present invention may comprise a homopolymer of an amylin protein or peptide or a copolymer of two or more different amylin proteins or peptides. Alternatively, the polymerized product of the present invention may comprise a copolymer of an amylin protein or peptide co-polymerized with any one or more of an Αβ peptide, a tau protein or peptide, an a-synuclein protein or peptide, a TDP-43 protein or peptide, and/or a PrP protein or peptide.

[0043] The polymerized product of the present invention may also comprise a prion protein or peptide thereof. The human prion protein comprises the amino acid sequence of SEQ ID NO: 7. 1 manlgcwmlv lfvatwsdlg lckkrpkpgg ntggsrypg qgspggnryp pqggggwgqp 61 gggwgqphg ggwgqp ggg wgqphgggwg qgggthsqwn kpskpktnmk hmagaaaaga 121 wgglggyvl gsamsrpiih fgsdyedryy renmhrypnq vyyrpmdeys nqnnfvhdcv 181 nitikqhtvt tttkgenfte tdvkmmerw eqmcitqyer esqayykrgs smvlfssppv 241 illisflifl ivg (SEQ ID NO:7)

[0044] Accordingly, in one embodiment of the invention, the prion protein of the polymerized product comprises amino acid residues 1-253 of SEQ ID NO:7 or analogs thereof. Peptides of prion protein derived from the amino acid sequence of SEQ ID NO:7 are also suitable for use in the polymerized product of the present invention. In one embodiment, the peptide comprises at least five contiguous amino acids of SEQ ID NO:7. In another embodiment, the peptide comprises at least 10, at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 90 or at least 100, at least 125, and least 150, at least 200, or at least 225 contiguous amino acids of SEQ ID NO:7.

[0045] The polymerized product of the present invention may comprise a homopolymer of an PrP protein or peptide or a copolymer of two or more different PrP proteins or peptides. Alternatively, the polymerized product of the present invention may comprise a copolymer of an PrP protein or peptide co-polymerized with any one or more of an Αβ peptide, a tau protein or peptide, an a-synuclein protein or peptide, a TDP-43 protein or peptide, and/or an amylin protein or peptide as described herein.

[0046] The polymerized product of the present invention may further comprise one or more polymerized ABri peptides (CSRTVKKNIIEEN; SEQ ID NO: 8), ADan peptides (CFNLFLNSQEKHY; SEQ ID NO:9), or ABri/ADan fusion peptides (CSRTVKKNIIEENGSGSGCFNLFLNSQEKHY; SEQ ID NO: 10) as disclosed in U.S. Patent Application Publication No. 20100284909 to Wisniewski et al., which is hereby incorporated by reference in its entirety.

[0047] The proteins and peptides of the polymerized product of the present invention may comprise naturally occurring peptides or analog peptides. Analog peptides typically differ from naturally occurring peptides at one, two, or a few positions, often by virtue of conservative substitutions. Analogs typically exhibit at least 80 or 90% sequence identity with natural peptides. Some analogs include unnatural amino acids or modifications of N or C terminal amino acids at one, two or a few positions. Examples of unnatural amino acids are D-amino acids, alpha amino acids, alpha-disubstituted amino acids, N-alkyl amino acids, lactic acid, 4- hydroxyproline, gamma-carboxyglutamate, epsilon-N,N,N-trimethyllysine, epsilon- N-acetyllysine, O-phosphoserine, N-acetylserine, N-formylmethionine, 3- methylhistidine, 5-hydroxylysine, omega-N-methylarginine, β-alanine, ornithine, norleucine, norvaline, hydroxproline, thyroxine, gamma-amino butyric acid, homoserine, citrulline, and isoaspartic acid. Analog peptides can be screened for prophylactic or therapeutic efficacy using animal models as described in the

Examples herein.

[0048] In another embodiment of the present invention, the polymerized product comprises a polymer of a fusion peptide. Suitable fusion peptides contain any first Αβ, α-synuclein, tau, TDP-43, amylin, or prion protein peptide of the present invention fused to any second Αβ, α-synuclein, tau, TDP-43, amylin, or prion protein peptide of the present invention. The fusion peptide preferably contains a short linker sequence coupling the first peptide to a second peptide. Preferred linker sequences include glycine-rich (e.g. G3.5) or serine-rich (e.g. GSG, GSGS, GSGSG, GS N G) linker sequences.

[0049] In accordance with this aspect of the present invention the polymerized product may contain a polymer or copolymer of any one or more of the Αβ, α- synuclein, tau, TDP-43, amylin, or prion protein proteins or peptides described herein further linked in-frame to an adjuvant polypeptide. The adjuvant polypeptide can be any adjuvant polypeptide known in the art, including, but not limited to, cholera toxin B, flagellin, human papillomavirus LI or L2 protein, herpes simplex glycoprotein D (gD), complement C4 binding protein, TL4 ligand, and IL- 1 β. The protein or peptides comprising the polymers of the polymerized product of the present invention may be linked directly to the adjuvant polypeptide or coupled to the adjuvant by way of a short linker sequence. Suitable linker sequences include glycine or serine-rich linkers described supra or other flexible immunoglobulin linkers as disclosed in U.S. Patent No. 5,516,637 to Huang et al, which is hereby incorporated by reference in its entirety.

[0050] In another embodiment, the polymerized product of the present invention may contain a polymer or copolymer of any one of the Αβ, α-synuclein, tau, TDP-43, amylin, or prion protein proteins or peptides described supra conjugated to an immunogenic carrier molecule. The immunogenic carrier molecule can be covalently or non-covalently bonded to the proteins or peptides as described herein. Suitable immunogenic carrier molecules include, but are not limited to, serum albumins, chicken egg ovalbumin, keyhole limpet hemocyanin, tetanus toxoid, thyroglobulin, pneumococcal capsular polysaccharides, CRM 197, immunoglobulin molecules, alum, and meningococcal outer membrane proteins. Other suitable immunogenic carrier molecules include T-cell epitopes, such as tetanus toxoid (e.g., the P2 and P30 epitopes), Hepatitis B surface antigen, pertussis, toxoid, diphtheria toxoid, measles virus F protein, Chlamydia trachomatis major outer membrane protein, Plasmodium falciparum circumsporozite T, P. falciparum CS antigen, Schistosoma mansoni triose phosphate isomersae, Escherichia coli TraT, and Influenza virus hemagluttinin (HA). Other suitable immunogenic carrier molecules include promiscuous T helper cell epitopes which are derived from hepatitis B virus, Bordetella pertussis, Clostridium tetani, Pertusaria trachythallina, E. coli, Chlamydia trachomatis, Diphtheria, P. falciparum, and Schistosoma mansoni {see U.S. Patent No. 6,906, 169 to Wang; U.S. Patent Application Publication No. 20030068325 to Wang, and WO 2002/096350 to Wang, which are hereby incorporated by reference in their entirety). Yet other suitable carriers include T-helper cell epitopes derived from tetanus toxin, cholera toxin B, pertussis toxin, diphtheria toxin, measles virus F protein, hepatitis B virus surface antigen, C. trachomitis major outer membrane protein, P. falciparum circumsporozoite, S. mansoni triose phosphate isomerase, or E. coil TraT (see WOO 1/42306 to Chain, which is hereby incorporated by reference in its entirety).

[0051] The peptides and proteins of the present invention can be linked to immunogenic carrier molecules by chemical crosslinking prior to polymerization. Techniques for linking a peptide immunogen to an immunogenic carrier molecule include the formation of disulfide linkages using N-succinimidyl-3-(2-pyridyl-thio) propionate (SPDP) and succinimidyl 4-(N-maleimidomethyl)cyclohexane- l - carboxylate (SMCC) (if the peptide lacks a sulfhydryl group, this can be provided by addition of a cysteine residue). These reagents create a disulfide linkage between themselves and peptide cysteine residues on one protein, and an amide linkage through the epsilon-amino on a lysine, or other free amino group in other amino acids. A variety of such disulfide/amide-forming agents are described by Jansen et ai., "Immunotoxins: Hybrid Molecules Combining High Specificity and Potent

Cytotoxicity," Immun Rev 62: 185-216 ( 1982), which is hereby incorporated by reference in its entirety. Other bifunctional coupling agents form a thioether rather than a disulfide linkage. Many of these thio-ether-forming agents are commercially available and include reactive esters of 6-maleimidocaproic acid, 2-bromoacetic acid, 2-iodoacetic acid, and 4-(N-maleimido-methyl)cyclohexane- l -carboxylic acid. The carboxyl groups can be activated by combining them with succinimide or 1-hydroxyl- 2-nitro-4-sulfonic acid, sodium salt.

[0052] The one or more proteins or peptides comprising the polymers or copolymers of the polymerized product of the present invention can be synthesized by solid phase or solution phase peptide synthesis, recombinant expression, or can be obtained from natural sources. Automatic peptide synthesizers are commercially available from numerous suppliers, such as Applied Biosystems, Foster City,

California. Standard techniques of chemical peptide synthesis are well known in the art (see e.g., SYNTHETIC PEPTIDES:A USERS GUIDE 93-210 (Gregory A. Grant ed., 1992), which is hereby incorporated by reference in its entirety). Protein or peptide production via recombinant expression can be carried out using bacteria, such as E. coli, yeast, insect or mammalian cells and expression systems. Procedures for recombinant protein/peptide expression are well known in the art and are described by Sambrook et al, Molecular Cloning: A Laboratory Manual (C.S.H.P. Press, NY 2d ed., 1989).

[0053] Recombinantly expressed peptides can be purified using any one of several methods readily known in the art, including ion exchange chromatography, hydrophobic interaction chromatography, affinity chromatography, gel filtration, and reverse phase chromatography. The peptide is preferably produced in purified form (preferably at least about 80% or 85% pure, more preferably at least about 90% or 95% pure) by conventional techniques. Depending on whether the recombinant host cell is made to secrete the peptide into growth medium (see U.S. Patent No. 6,596,509 to Bauer et al., which is hereby incorporated by reference in its entirety), the peptide can be isolated and purified by centrifugation (to separate cellular components from supernatant containing the secreted peptide) followed by sequential ammonium sulfate precipitation of the supernatant. The fraction containing the peptide is subjected to gel filtration in an appropriately sized dextran or polyacrylamide column to separate the peptides from other proteins. If necessary, the peptide fraction may be further purified by HPLC.

[0054] Polymerization of the proteins or peptides alone or conjugated to an adjuvant polypeptide or immunogenic earner molecule can be achieved using standard techniques known in the art. As used herein, polymerization refers to process of reacting two or more peptide and/or protein units together under suitable conditions to form three-dimensional networks or polymer chains. As described herein, the proteins and peptides can be polymerized by a reaction with a cross linking reagent. Suitable cross-linking reagents include, but are not limited to glutaraldehyde and l -Ethyl-3-[3-dimethylaminopropyl]carbodiimide hydrochloride (EDC) (see Goni et al., "Immunomodulation Targeting Abnormal Protein Conformation Reduced Pathology in a Mouse Model of Alzheimer's Disease," PLoS One 5( 10):el 3391

(2010), which is hereby incorporated by reference in its entirety). Alternatively, the proteins and peptides can be polymerized by cysteine oxidation induced disulfide cross linking.

[0055] Another aspect of the present invention is directed to a pharmaceutical composition comprising the polymerized product of the invention and a

pharmaceutical carrier.

[0056] In accordance with this aspect of the present invention, the

pharmaceutical composition may contain a single homopolymer of an Αβ protein or peptide, a-synuclein protein or peptide, tau protein or peptide, TDP-43 protein or peptide, amylin protein or peptide, or prion protein or peptide. Alternatively, the pharmaceutical composition may contain a mixture of one or more proteins or peptides, i.e. heteropolymers of the one or more aforementioned proteins and/or peptides.

[0057] The pharmaceutical composition of the present invention can further contain, in addition to peptide polymers, other pharmaceutically acceptable components {see REMINGTON'S PHARMACEUTICAL SCIENCE ( 19th ed., 1995), which is hereby incorporated by reference in its entirety). The incorporation of such 46941

- 20 - pharmaceutically acceptable components depends on the intended mode of

administration and therapeutic application of the pharmaceutical composition.

Typically, however, the pharmaceutical composition will include a pharmaceutically- acceptable, non-toxic carrier or diluent, which are defined as vehicles commonly used to formulate pharmaceutical compositions for animal or human administration. The diluent is selected so as not to affect the biological activity of the composition.

Exemplary carriers or diluents include distilled water, physiological phosphate- buffered saline, Ringer's solutions, dextrose solution, and Hank's solution.

[0058] Pharmaceutical compositions can also include large, slowly

i

metabolized macromolecules such as proteins, polysaccharides such as chitosan, polylactic acids, polyglycolic acids and copolymers (such as latex functionalized sepharose, agarose, cellulose), polymeric amino acids, amino acid copolymers, and lipid aggregates (such as oil droplets or liposomes).

[0059] The pharmaceutical composition of the present invention can further

I

contain an adjuvant. One class of preferred adjuvants is aluminum salts, such as aluminum hydroxide, aluminum phosphate, or aluminum sulfate. Such adjuvants can be used with or without other specific immunostimulating agents such as MPL or 3- DMP, QS-21 , flagellin, attenuated Salmonella (e.g., Salmonella typhimitrium), polymeric or monomeric amino acids such as polyglutamic acid or polylysine, or pluronic polyols. Oil-in-water emulsion formulations are also suitable adjuvants that can be used with or without other specific immunostimulating agents such as muramyl peptides (e.g., N-acetylmuramyl-L-threonyl-D-isoglutamine (thr-MDP), N- acetyl-normuramyl-L-alanyl-D-isoglutamine (nor-MDP), N-acetylmuramyl-L-alanyl- D-isoglutaminyl-L-alanine-2-( 1 '-2'dipalmitoyl-sn- -glycero-3- hydroxyphosphoryloxy)-ethylamine (MTP-PE), N-acetylglucsaminyl-N- acetylmuramyl-L-Al-D-isoglu-L-Ala-dipalmitoxy propylamide (DTP-DPP)

Theramide", or other bacterial cell wall components). A suitable oil-in-water emulsion is MF59 (containing 5% Squalene, 0.5% Tween 80, and 0.5% Span 85 (optionally containing various amounts of MTP-PE) formulated into submicron particles using a microfluidizer such as Model 1 10Y microfluidizer (Microfluidics, Newton MA) as described in WO90/ 14837 to Van Nest et al., which is hereby incorporated by reference in its entirety. Other suitable oil-in-water emulsions include SAF (containing 10% Squalene, 0.4% Tween 80, 5% pluronic-blocked polymer LI 21 , and thr-MDP, either microfluidized into a submicron emulsion or vortexed to generate a larger particle size emulsion) and Ribi " adjuvant system (RAS; containing 2% squalene, 0.2% Tween 80, and one or more bacterial cell wall components). Another class of preferred adjuvants is saponin adjuvants, such as Stimulon' M (QS-21 ) or particles generated therefrom such as ISCOMs

(immunostimulating complexes) and ISCOMATRIX. Other suitable adjuvants include incomplete or complete Freund's Adjuvant (IFA), cytokines, such as interleukins (IL-1 , IL-2, and IL- 12), macrophage colony stimulating factor (M-CSF), lysolecithin, tumor necrosis factor (TNF), and liposome polycation DNA particles. Such adjuvants are generally available from commercial sources.

[0060] In another embodiment of the present invention, the pharmaceutical composition further includes a delivery vehicle. Suitable delivery vehicles include, but are not limited to biodegradable microspheres, microparticles, nanoparticles, liposomes, collagen minipellets, and cochleates.

[0061] In one embodiment of this aspect of the invention, the pharmaceutical agent includes a mucosal delivery system. A preferred mucosal delivery system consists of attenuated Salmonella (e.g., Salmonella typhimurium) with a non-toxic fragment C of tetanus toxin (TetC) or glutathione 5-transferase (GST). Methods of mucosal vaccination via oral administration of 5. typhimurium are described in Goni et al, "Mucosal Vaccination Delays or Prevents Prion Infection via an Oral Route," Neuroscience 133:413-21 (2005), and Goni et al., "High Titers of Mucosal and Systemic Anti-PrP Antibodies Abrogate Oral Prion Infection in Mucosal-Vaccinated Mice," Neuroscience 153:679-686 (2008), which are hereby incorporated by reference in their entirety.

[0062] Another aspect of the present invention relates to a method of inducing an immune response against an amyloidogenic form of a protein or peptide in a subject. This method involves administering to the subject a polymerized product of the present invention under conditions effective to induce an immune response against the amyloidogenic form of the protein or peptide in the subject. In a preferred embodiment of this aspect of the present invention, a subject that would benefit from an immune response against an amyloidogenic form of a protein or peptide is selected prior to administering the polymerized product.

[0063] As used herein, an "amyloid protein", "amyloidogenic protein", and

"amyloidogenic form of a protein" are used interchangeably to encompasses any insoluble fibrous protein/peptide aggregate that is deposited intra- or extracellularly within the body. Amyloidogenic protein/peptide deposition may be organ-specific (e.g., central nervous system, pancreas, etc.) or systemic. In accordance with this aspect of the invention, amyloidogenic proteins/peptides subject to deposition include beta protein precursor, prion and prion proteins, oc-synuclein, tau, ABri precursor protein, ADan precursor protein, amylin, apolipoprotein AI, apolipoprotein All, lyzozyme, cystatin C, gelsolin, protein, atrial natriuretic factor, calcitonin, keratoepithelin, lactoferrin, immunoglobulin light chains, transthyretin, A

amyloidosis, p2-microglobulin, immunoglobulin heavy chains, fibrinogen alpha chains, prolactin, keratin, and medin. Amyloid deposition may occur as its own entity or as a result of another illness (e.g. , multiple myeloma, chronic infection, or chronic inflammatory disease).

[0064] In accordance with this aspect of the present invention, an immune response is the development of a beneficial humoral (antibody mediated) and/or a cellular (mediated by antigen-specific T cells or their secretion products) response directed against the polymerized, non-fibrillogenic proteins or peptides of the polymerized product and cross-reactive with any amyloidogenic protein. Such a response is an active response induced by administration of the immunogenic polymerized protein and/or peptides and represents a therapeutic means for clearing or removing amyloid protein deposits from the body of the subject.

[0065] The presence of a humoral immunological response can be determined and monitored by testing a biological sample (e.g., blood, plasma, serum, urine, saliva feces, CSF or lymph fluid) from the subject for the presence of antibodies directed to the immunogenic component of the administered polymerized product. Methods for detecting antibodies in a biological sample are well known in the art, e.g., ELISA, Dot blots, SDS-PAGE gels or ELISPOT. The presence of a cell-mediated immunological response can be determined by proliferation assays (CD4 + T cells) or CTL (cytotoxic T lymphocyte) assays which are readily known in the art. [0066] The present invention is further directed to a method of preventing and/or treating a condition mediated by an amyloidogenic protein or peptide in a subject. This method involves administering to the subject, a polymerized product of the present invention containing one or more polymers or co-polymers comprising an amyloid-beta (Αβ) peptide, an a-synuclein protein or peptide, a tau protein or peptide, a TAR DNA-binding protein 43 (TDP-43) protein or peptide, an amylin protein or peptide, a prion protein (PrP) or peptide or any combination thereof as described supra. The polymerized product is administered under conditions effective to treat the condition mediated by the amyloidogenic protein or peptide in the subject. In a preferred embodiment of this aspect of the present invention, a subject at risk of having or having a condition mediated by an amyloidogenic protein or peptide is selected prior to administering the polymerized product of the present invention.

[0067] Conditions or diseases associated with, or resulting from, the deposition of amyloidogenic proteins or peptides include, but are not limited to, Alzheimer's disease, diffuse Lewy body disease, Down's syndrome, fronto-temporal dementia, Parkinson's disease, hereditary cerebral hemorrhage with amyloidosis, kuru, Creutzfeldt- Jakob disease, Gerstmann-Straussler-Scheinker disease, fatal familial insomnia, British familial dementia, Danish familial dementia, familial corneal amyloidosis, Familial corneal dystrophies, medullary thyroid carcinoma, insulinoma, type 2 diabetes, isolated atrial amyloidosis, pituitary amyloidosis, aortic amyloidosis, plasma cell disorders, familial amyloidosis, senile cardiac amyloidosis, inflammation-associated amyloidosis, familial Mediterranean fever, dialysis- associated amyloidosis, systemic amyloidosis, and familial systemic amyloidosis. In accordance with this aspect of the present invention, administration of the

polymerized product is effective to stimulate an immune response in the subject that is effective at reducing and/or clearing the amyloidogenic protein that is causing or exacerbating the aforementioned disease conditions.

[0068] A second aspect of the present invention is directed to an isolated antibody or binding portion thereof having antigenic specificity for an epitope a non- amyloidogenic, non- fibril logenic polymerized product of the present invention. As described infra, the polymerized product of the present invention comprises two or more protein or peptide units, each unit independently selected from the group consisting of an amyloid-beta (Αβ) peptide, an a-synuclein protein or peptide, a tau protein or peptide, a TAR DNA-binding protein 43 (TDP-43) protein or peptide, an amylin protein or peptide, a prion protein (PrP) protein or peptide, and any combination thereof.

[0069] As used herein, "epitope" refers to an antigenic determinant of the one or more polymerized proteins or peptides of the present invention that is recognized by the isolated antibody. The epitope recognized by the antibody of the present invention may be a linear epitope, i.e. the primary structure of the amino acid sequence of the target proteins or peptides. Preferably, the linear epitope recognized by the isolated antibody of the present invention does not have amino acid sequence homology to a non-amyloid protein. Alternatively, the epitope recognized by the isolated antibody of the present invention is a non-linear or conformational epitope, i.e. the tertiary or quaternary structure of a polymerized protein or peptide. In one embodiment of the present invention, the non-linear or conformational epitope recognized by the isolated antibody of the present invention is a conformational epitope that is common to or shared with one or more, or all, amyloidogenic proteins. Accordingly, the isolated antibody of the present invention has antigenic specificity for a shared conformational epitope common to all amyloidogenic proteins known in the art.

[0070] An isolated antibody of the present invention encompasses any immunoglobulin molecule that specifically binds to an epitope of a polymerized product of the present invention. Preferably, the antibody of the present invention binds specifically to an epitope that is shared by a polymerized product of the present invention and one or more amyloidogenic proteins. As used herein, the term

"antibody" is meant to include intact immunoglobulins derived from natural sources or from recombinant sources, as well as immunoreactive portions (i.e., antigen binding portions) of intact immunoglobulins. The antibodies of the present invention may exist in a variety of forms including, for example, polyclonal antibodies, monoclonal antibodies, intracellular antibodies ("intrabodies"), antibody fragments (e.g. Fv, Fab and F(ab)2), as well as single chain antibodies (scFv), chimeric antibodies, and humanized antibodies (Ed Harlow and David Lane, USING

ANTIBODIES: A LABORATORY MANUAL (Cold Spring Harbor Laboratory R-ess, 1 99); Houston et al., "Protein Engineering of Antibody Binding Sites: Recovery of Specific Activity in an Anti-Digoxin Single-Chain Fv Analogue Produced in Escherichia coli " Proc Natl Acad Sci USA 85:5879-5883 ( 1988); Bird et al, "Single-Chain Antigen-Binding Proteins," Science 242:423-426 ( 1988)).

[0071] Antibodies of the present invention may also be synthetic antibodies.

A synthetic antibody is an antibody which is generated using recombinant DNA technology, such as, for example, an antibody expressed by a bacteriophage.

Alternatively, the synthetic antibody is generated by the synthesis of a DNA molecule encoding and expressing the antibody of the invention or the synthesis of an amino acid specifying the antibody, where the DNA or amino acid sequence has been obtained using synthetic DNA or amino acid sequence technology which is available and well known in the art.

[0072] Methods for monoclonal antibody production may be carried out using the techniques described herein or other well-known in the art ( MONOCLONAL ANTIBODIES - PRODUCTION, ENGINEERING AND CLINICAL APPLICATIONS (Mary A. Ritter and Heather M. Ladyman eds., 1995), which is hereby incorporated by reference in its entirety). Generally, the process involves obtaining immune cells (lymphocytes) from the spleen of a mammal which has been previously immunized with the antigen of interest (i.e., a polymerized protein or peptide product of the present invention) either in vivo or in vitro. Exemplary polymerized products comprising one or more Αβ peptides, a-synuclein proteins or peptides, tau proteins or peptides, TDP-43 proteins or peptides, amylin proteins or peptides, and a prion proteins or peptides are described supra.

[0073] The antibody-secreting lymphocytes are fused with myeloma cells or transformed cells, which are capable of replicating indefinitely in cell culture, thereby producing an immortal, immunoglobulin-secreting cell line. Fusion with mammalian myeloma cells or other fusion partners capable of replicating indefinitely in cell culture is achieved by standard and well-known techniques, for example, by using polyethylene glycol (PEG) or other fusing agents (Milstein and Kohler, "Derivation of Specific Antibody-Producing Tissue Culture and Tumor Lines by Cell Fusion," Eur J Immunol 6:51 1 ( 1976), which is hereby incorporated by reference in its entirety). The immortal cell line, which may be murine, but may also be derived from cells of other mammalian species, is selected to be deficient in enzymes necessary for the utilization of certain nutrients, to be capable of rapid growth, and have good fusion capability. The resulting fused cells, or hybridomas, are cultured, and the resulting colonies screened for the production of the desired monoclonal antibodies. Colonies producing such antibodies are cloned, and grown either in vivo or in vitro to produce large quantities of antibody.

[0074] Alternatively monoclonal antibodies can be made using recombinant

DNA methods as described in U.S. Patent 4,816,567 to Cabilly et al, which is hereby incorporated by reference in its entirety. The polynucleotides encoding a monoclonal antibody are isolated from mature B-cells or hybridoma cells, for example, by RT- PCR using oligonucleotide primers that specifically amplify the genes encoding the heavy and light chains of the antibody. The isolated polynucleotides encoding the heavy and light chains are then cloned into suitable expression vectors, which when transfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, and monoclonal antibodies are generated by the host cells. Also, recombinant monoclonal antibodies or fragments thereof of the desired species can be isolated from phage display libraries (McCafferty et al., "Phage Antibodies: Filamentous Phage Displaying Antibody Variable Domains," Nature 348:552-554 ( 1990);

Clackson et al., "Making Antibody Fragments using Phage Display Libraries," Nature 352:624-628 ( 1991 ); and Marks et al., "By-Passing Immunization. Human Antibodies from V-Gene Libraries Displayed on Phage," /. Mol. Biol. 222:581 -597 ( 1991 ), which are hereby incorporated by reference in their entirety).

[0075] The polynucleotide(s) encoding a monoclonal antibody can further be modified using recombinant DNA technology to generate alternative antibodies. For example, the constant domains of the light and heavy chains of a mouse monoclonal antibody can be substituted for those regions of a human antibody to generate a chimeric antibody. Alternatively, the constant domains of the light and heavy chains of a mouse monoclonal antibody can be substituted for a non-immunoglobulin polypeptide to generate a fusion antibody. In other embodiments, the constant regions are truncated or removed to generate the desired antibody fragment of a monoclonal antibody. Furthermore, site -directed or high-density mutagenesis of the variable region can be used to optimize specificity and affinity of a monoclonal antibody.

[0076] The monoclonal antibody of the present invention can be a humanized antibody. Humanized antibodies are antibodies that contain minimal sequences from non-human (e.g., murine) antibodies within the variable regions. Such antibodies are used therapeutically to reduce antigenicity and human anti-mouse antibody responses when administered to a human subject. In practice, humanized antibodies are typically human antibodies with minimal to no non-human sequences.

[0077] An antibody can be humanized by substituting the complementarity determining region (CDR) of a human antibody with that of a non-human antibody (e.g., mouse, rat, rabbit, hamster, etc.) having the desired specificity, affinity, and capability (Jones et al., "Replacing the Complementarity-Determining Regions in a Human Antibody With Those From a Mouse," Nature 321 :522-525 (1986);

Riechmann et al., "Reshaping Human Antibodies for Therapy," Nature 332:323-327 ( 1988); Verhoeyen et al., "Reshaping Human Antibodies: Grafting an Antilysozyme Activity," Science 239: 1534- 1536 (1988), which are hereby incorporated by reference in their entirety). The humanized antibody can be further modified by the substitution of additional residues either in the Fv framework region and/or within the replaced non-human residues to refine and optimize antibody specificity, affinity, and/or capability.

[0078] The monoclonal Αβ of the present invention can also be a human monoclonal Αβ. A human antibody is an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human. Human antibodies can be produced using various techniques known in the art. Immortalized human B lymphocytes immunized in vitro or isolated from an immunized individual that produce an antibody directed against a target antigen can be generated (See e.g., Reisfeld et al., MONOCLONAL ANTIBODIES AND CANCER THERAPV 77 (Alan R. Liss ed., 1985) and U.S. Patent No. 5,750,373 to Garrard, which are hereby incorporated by reference in their entirety). Also, the human antibody can be selected from a phage library, where that phage library expresses human antibodies (Vaughan et al., "Human Antibodies with Sub-Nanomolar Affinities Isolated from a Large Non-immunized Phage Display Library," Nature Biotechnology, 14:309-3 14 2 046941

- 28 -

( 1996); Sheets et al., "Efficient Construction of a Large Nonimmune Phage Antibody Library: The Production of High- Affinity Human Single-Chain Antibodies to Protein Antigens," Proc. Natl. Acad. Set U.S.A. 95:6157-6162 ( 1998); Hoogenboom et al., "By-passing Immunisation. Human Antibodies From Synthetic Repertoires of

Germline VH Gene Segments Rearranged In Vitro," J Mol Biol 227:381 -8 (1992); Marks et al., "By-passing Immunization. Human Antibodies from V-gene Libraries Displayed on Phage," J Mol Biol 222:581-97 ( 1991), which are hereby incorporated by reference in their entirety). Human antibodies can also be made in transgenic mice containing human immunoglobulin loci that are capable upon immunization of producing the full repertoire of human antibodies in the absence of endogenous immunoglobulin production. This approach is described in U.S. Patent Nos.

5,545,807 to Surani et al.; 5,545,806 to Lonberg et al.; 5,569,825 to Lonberg et al.; 5,625, 126 to Lonberg et al.; 5,633,425 to Lonberg et al.; and 5,661 ,016 to Lonberg et al., which are hereby incorporated by reference in their entirety

[0079] Procedures for raising polyclonal antibodies are also well known in the art. Typically, such antibodies are raised by administering the polymerized product of the present invention subcutaneously to rabbits {e.g., New Zealand white rabbits), goats, sheep, swine, or donkeys which have been bled to obtain pre-immune serum. The polymerized product can be injected in combination with an adjuvant. The rabbits are bled approximately every two weeks after the first injection and

periodically boosted with the same antigen three times every six weeks. Polyclonal antibodies are recovered from the serum by affinity chromatography using the corresponding polymerized product to capture the antibody. This and other procedures for raising polyclonal antibodies are disclosed in Ed Harlow and David Lane, USING ANTIBODIES: A LABORATORY MANUAL (Cold Spring Harbor Laboratory Press, 1988), which is hereby incorporated by reference in its entirety.

[0080] As noted above, in addition to whole antibodies, the present invention encompasses binding portions of such antibodies. Such binding portions include the monovalent Fab fragments, Fv fragments {e.g., single-chain antibody, scFv), and single variable VH and Vi, domains, and the bivalent F(ab')2 fragments, Bis-scFv, diabodies, triabodies, minibodies, etc. These antibody fragments can be made by conventional procedures, such as proteolytic fragmentation procedures, as described in James Goding, MONOCLONAL ANTIBODIES: PRINCIPLES AND PRACTICE 98- 1 18 (Academic Press, 1983) and Ed Harlow and David Lane, ANTIBODIES: A

LABORATORY MANUAL (Cold Spring Harbor Laboratory, 1988), which are hereby incorporated by reference in their entirety, or other methods known in the art.

[0081] Also suitable for use in the present invention are antibody fragments engineered to bind to intracellular proteins, i.e. intrabodies. Although amyloid protein deposits are generally extracellular, intracellular accumulation of certain amyloid proteins (e.g., Αβ1 -42) have been observed (D' Andrea et al., "Targeting Amyloid Beta: Targeting Intracellular Αβ42 for Alzheimer's Disease Drug Discover," Drug Development Research 56: 194-200 (2002); Knobloch et al., "Intracellular Abeta and Cognitive Deficits Precede beta-Amyloid Deposition in arcAbeta Mice," Neurobiol Aging 28(9).T 297-306 (2007), which are hereby incorporated by reference in their entirety). Accordingly, an intrabody can be used to bind selectively to an epitope of an amyloid protein within a cell. In a preferred embodiment, the intrabody recognizes an epitope of the Αβ 1 -42 oligomer accumulating within the perikaryon of affected neurons (e.g., pyramidal neurons) in AD.

[0082] Intrabodies are generally obtained by selecting a single variable domain from variable regions of an antibody having two variable domains (i.e., a heterodimer of a heavy chain variable domain and a light chain variable domain). Single chain Fv fragments, Fab fragments, ScFv-Ck fusion proteins, single chain diabodies, V H -CH1 fragments, and even whole IgG molecules are suitable formats for intrabody development (Kontermann R.E., "Intrabodies as Therapeutic Agents," Methods 34: 163-70 (2004), which is here by incorporated by reference in its entirety).

[0083] Intrabodies having antigen specificity for a conformational epitope of an amyloidogenic protein can be obtained from phage display, yeast surface display, or ribosome surface display. Methods for producing libraries of intrabodies and isolating intrabodies of interest are further described in U.S. Published Patent Application No. 20030104402 to Zauderer and U.S. Published Patent Application No. 20050276800 to Rabbitts, which are hereby incorporated by reference in their entirety. Methods for improving the stability and affinity binding characteristics of intrabodies are described in WO2008070363 to Zhenping; Contreras-Martinez et al., "Intracellular Ribosome Display via SecM Translation Arrest as a Selection for Antibodies with Enhanced Cytosolic Stability," J Mol Biol 372(2):5 13-24 (2007), which are hereby incorporated by reference in their entirety.

[0084] It may further be desirable, especially in the case of antibody fragments, to modify the antibody in order to increase its serum half-life. This can be achieved, for example, by incorporation of a salvage receptor binding epitope into the antibody fragment by mutation of the appropriate region in the antibody fragment or by incorporating the epitope into a peptide tag that is then fused to the antibody fragment at either end or in the middle (e.g., by DNA or peptide synthesis).

[0085] Antibody mimics are also suitable for use in accordance with the present invention. A number of antibody mimics are known in the art including, without limitation, those known as monobodies, which are derived from the tenth human fibronectin type III domain ( l0 Fn3) ( oide et al., "The Fibronectin Type III Domain as a Scaffold for Novel Binding Proteins," J Mol Biol 284: 1 141-1 151 (1998); Koide et al., "Probing Protein Conformational Changes in Living Cells by Using Designer Binding Proteins: Application to the Estrogen Receptor," Proc Natl Acad Sci USA 99: 1253-1258 (2002), each of which is hereby incorporated by reference in its entirety); and those known as affibodies, which are derived from the stable alpha-helical bacterial receptor domain Z of staphylococcal protein A (Nord et al., "Binding Proteins Selected from Combinatorial Libraries of an alpha-helical Bacterial Receptor Domain," Nature Biotechnol 15(8):772-777 ( 1997), which is hereby incorporated by reference in its entirety).

[0086] The present invention is further directed to a pharmaceutical composition containing the isolated antibody of the present invention as described supra. In a preferred embodiment, the isolated antibody recognizes and binds to a shared conformational epitope common to one or more amyloid proteins. The pharmaceutical composition of the present invention may contain an antibody mixture where all antibodies recognize the same conformational epitope. Alternatively, the pharmaceutical composition may contain an antibody mixture where one or more antibodies recognize one or more different conformational epitopes of amyloid proteins. The pharmaceutical composition of the present invention further contains a pharmaceutically acceptable carrier or other pharmaceutically acceptable components as described supra. [0087] Another aspect of the present invention relates to a method of treating a condition mediated by an amyloidogenic protein in a subject. This method involves administering to the subject an antibody of the present invention, where the antibody has antigen specificity for an epitope of a non-amyloidogenic, non-fibrillogenic polymerized product, wherein the polymerized product comprises two or more protein and or peptide units, each unit independently selected from the group consisting of an amyloid-beta (Αβ) peptide, an a-synuclein protein or peptide, a tau protein or peptide, a TAR DNA-binding protein 43 (TDP-43) protein or peptide, an amylin protein or peptide, a prion protein (PrP) protein or peptide, and any combination thereof.

Preferably the antibody has antigen specificity for a shared conformational epitope that is common to one or more amyloidogenic proteins. The antibody or a pharmaceutical composition containing the antibody is administered in an amount effective to treat the condition involving the amyloidogenic protein in the subject. In accordance with this aspect of the invention, the antibody or pharmaceutical composition containing the antibody is administered in an amount effective to generate passive immunity in the subject against one or more amyloidogenic proteins, thereby facilitating the clearance of amyloid deposits from the subject.

[0088] Conditions mediated by an amyloidogenic protein that are amenable to treatment in accordance with this aspect of the present invention are described supra.

[0089] In a preferred embodiment of this aspect of the present invention, a subject having a condition or at risk of developing a condition mediated by an amyloidogenic protein is selected prior to administration of the antibody of the present invention. Subjects amenable to treatment in accordance with the methods of the present invention include individuals at risk of developing an amyloid related disease but not showing symptoms, as well as subjects showing symptoms at the time of therapeutic intervention (i.e. antibody administration). Diseases subject to treatment include any disease associated with or caused by an amyloidogenic protein as described supra. The pharmaceutical compositions of the present invention contain polymerized products that are not endogenous to the body, or antibodies specific for only pathological protein conformations. Therefore, the risk of inducing an autoimmune response is avoided and prophylactic treatment using these pharmaceutical compositions of the present invention is particularly suitable. [0090] In the case of Alzheimer's disease, for example, virtually anyone is at risk of suffering from Alzheimer's disease if he or she lives long enough. Therefore, the compositions of the present invention can be administered prophylactically to the general population without the need for any assessment of the risk of the subject patient. However, the present methods and compositions are especially suitable for prophylactic treatment of individuals who have a known genetic risk of Alzheimer's disease or other condition related to an amyloidogenic protein. Genetic markers associated with a risk of Alzheimer's disease include mutations in the APP gene, particularly mutations at position 717 and positions 670 and 671 referred to as the Hardy and Swedish mutations respectively. Other markers of risk are mutations in the presenilin genes, PS 1 and PS2, and mutations in ApoE4, family history of AD, hypercholesterolemia, or atherosclerosis.

[0091] In asymptomatic patients, treatment can begin at any age (e.g., 10, 20,

30). Usually, however, it is not necessary to begin treatment until a patient reaches 40, 50, 60 or 70 years of age. Treatment typically entails multiple dosages over a period of time. Treatment can be monitored by assaying antibody, or activated T-cell or B-cell responses to the therapeutic agent (e.g., polymerized product) over time. If the response falls, a booster dosage is indicated. In the case of potential Down's syndrome patients, treatment can begin antenatally by administering the therapeutic agent to the mother or shortly after birth.

[0092] In prophylactic applications, the pharmaceutical compositions of the present invention are administered to a patient susceptible to, or otherwise at risk of, a particular disease in an amount sufficient to eliminate or reduce the risk or delay the onset of the disease. In therapeutic applications, pharmaceutical compositions are administered to a patient suspected of, or already suffering from an amyloidogenic disease in an amount sufficient to cure, or at least partially arrest, the symptoms of the disease and its complications. An amount adequate to accomplish this is defined as a therapeutically- or pharmaceutically-effective dose. In both prophylactic and therapeutic regimes, agents are usually administered in several dosages until a sufficient immune response has been achieved. Typically, the immune response is monitored and repeated dosages are given if the immune response starts to fade. [0093] Effective doses of the compositions of the present invention, for the treatment of the above described conditions vary depending upon many different factors, including means of administration, target site, physiological state of the patient, whether the patient is human or an animal, other medications administered, and whether treatment is prophylactic or therapeutic. Usually, the subject is a human, but in some diseases, such as prion protein related diseases, the subject can be a nonhuman mammal, such as a bovine. Other non-human mammals amenable to treatment in accordance with the methods of the present invention include primates, dogs, cats, rodents (e.g. , mouse, rat, guinea pig), horses, deer, cervids, cattle and cows, sheep, and pigs. Treatment dosages need to be titrated to optimize safety and efficacy, and could involve oral treatment.

[0094] When treatment of a subject involves the administration of a polymerized product of the present invention containing one or more polymerized or copolymerized Αβ, α-synuclein, tau, TDP-43, amylin, and/or PrP protein or peptide immunogens, the appropriate dosage will depend on whether adjuvant is coadministered, with higher dosages being required in the absence of adjuvant. The amount of an immunogen for administration sometimes varies from per patient and more usually from 5-50C^g per injection for human administration.

Occasionally, a higher dose of l -2mg per injection is used. Typically about 10, 20, 50 or 100μg is used for each human injection. The timing of injections can vary significantly from once a day, to once a week, to once a month, to once a year, to once a decade. Generally an effective dosage can be monitored by obtaining a fluid sample from the patient, generally a blood serum sample, and determining the titer of antibody developed against the immunogen, using methods well known in the art and readily adaptable to the specific antigen to be measured. Ideally, a sample is taken prior to initial dosing and subsequent samples are taken and titered after each immunization. Generally, a dose or dosing schedule which provides a detectable titer at least four times greater than control or "background" levels at a serum dilution of 1 : 100 is desirable, where background is defined relative to a control serum or relative to a plate background in ELISA assays.

[0095] On any given day that a dosage of immunogen is given, the dosage is greater than ^g/patient and usually greater than 10μg/patient if adjuvant is also administered, and greater than l C^g/patient and usually greater than 1 OO^ig/patient in the absence of adjuvant. A typical regimen consists of an immunization followed by booster injections at 6 weekly intervals. Another regimen consists of an

immunization followed by booster injections 1 , 2 and 12 months later. Another regimen entails an injection every two months for life. Alternatively, booster injections can be on an irregular basis as indicated by monitoring of immune response.

[0096] For passive immunization with a composition comprising an antibody of the present invention, the dosage ranges from about 0.0001 to 100 mg/kg, and more usually 0.01 to 5 mg kg of the host body weight. An exemplary treatment regime entails administration once per every two weeks or once a month or once every 3 to 6 months. In some methods, two or more monoclonal antibodies with different binding specificities are administered simultaneously, in which case the dosage of each antibody administered falls within the ranges indicated. Antibody is usually administered on multiple occasions. Intervals between single dosages can be weekly, monthly or yearly. Intervals can also be irregular as indicated by measuring blood levels of antibody to polymerized proteins or peptide in the patient. Alternatively, antibody can be administered as a sustained release formulation, in which case less frequent administration is required. Dosage and frequency vary depending on the half-life of the antibody in the patient. In general, human antibodies show the longest half life, followed by humanized antibodies, chimeric antibodies, and nonhuman antibodies. The dosage and frequency of administration can vary depending on whether the treatment is prophylactic or therapeutic. In prophylactic applications, a relatively low dosage is administered at relatively infrequent intervals over a long period of time. Some patients continue to receive treatment for the rest of their lives. In therapeutic applications, a relatively high dosage at relatively short intervals is sometimes required until progression of the disease is reduced or terminated, and preferably until the patient shows partial or complete amelioration of symptoms of disease. Thereafter, the patient can be administered a prophylactic regime.

[0097] Compositions of the present invention, i.e., polymerized products and antibodies, can be administered by parenteral, topical, intravenous, oral,

subcutaneous, intraperitoneal, intranasal or intramuscular means for prophylactic and/or therapeutic treatment. The most typical route of administration for compositions formulated to induce an immune response is subcutaneous although others can be equally effective. The next most common is intramuscular injection. This type of injection is most typically performed in the arm or leg muscles.

Intravenous injections as well as intraperitoneal injections, intra-arterial, intracranial, or intradermal injections are also effective in generating an immune response. In some methods, agents such as antibodies are injected directly into a particular tissue where deposits have accumulated, for example intracranial injection. Intramuscular injection or intravenous infusion are preferred for administration of antibody. In some methods, particular therapeutic antibodies are injected directly into the cranium. In some methods, antibodies are administered as a sustained release composition or device, such as a Medipad"" device.

[0098] The pharmaceutical agents of the present invention may be formulated for parenteral administration. Solutions or suspensions of the agent can be prepared in water suitably mixed with a surfactant such as hydroxypropylcellulose.

Dispersions can also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof in oils. Illustrative oils are those of petroleum, animal, vegetable, or synthetic origin, for example, peanut oil, soybean oil, or mineral oil. In general, water, saline, aqueous dextrose and related sugar solution, and glycols, such as propylene glycol or polyethylene glycol, are preferred liquid carriers, particularly for injectable solutions. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.

[0099] Pharmaceutical formulations suitable for injectable use include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions. In all cases, the form must be sterile and must be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms, such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol), suitable mixtures thereof, and vegetable oils. [0100] When it is desirable to deliver the pharmaceutical agents of the present invention systemicaily, they may be formulated for parenteral administration by injection, e.g., by bolus injection or continuous infusion. Formulations for injection may be presented in unit dosage form, e.g., in ampoules or in multi-dose containers, with an added preservative. The compositions may take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.

[0101] Intraperitoneal or intrathecal administration of the agents of the present invention can also be achieved using infusion pump devices such as those described by Medtronic, Northridge, CA. Such devices allow continuous infusion of desired compounds avoiding multiple injections and multiple manipulations.

[0102] In addition to the formulations described previously, the compositions of the present invention may also be formulated as a depot preparation. Such long acting formulations may be formulated with suitable polymeric or hydrophobic materials (for example as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salt.

[0103] Another aspect of the present invention relates to a method of diagnosing an amyloid disease in a subject. This method involves detecting, in the subject, the presence of an amyloidogenic proteins or peptides using a diagnostic reagent, where the diagnostic reagent is an antibody, or active binding fragment thereof, of the present invention. As described supra, the antibody has antigenic specificity for a conformational epitope of an amyloidogenic form of a protein.

Preferably the conformational epitope recognized by the antibody is shared with one or more other amyloidogenic protein or peptides. The diagnosis of the amyloid disease is based on the detection of an amyloidogenic protein or peptide in the subject.

[0104] Detecting the presence of amyloidogenic deposits in a subject using the diagnostic reagent can be achieved by obtaining a biological sample from the subject (e.g., blood, urine, cerebral spinal fluid), contacting the biological sample with the diagnostic antibody reagent, and detecting binding of the diagnostic antibody reagent to an amyloidogenic protein in the sample from the subject. Assays for carrying out the detection of an amyloid protein in a biological sample using a diagnostic antibody are well known in the art and include, without limitation, ELISA,

immunohistochemistry, western blot.

[0105] Alternatively, detecting the presence of amyloid deposits in a subject using diagnostic antibody reagent of the present invention can be achieved using in vivo imaging techniques. In vivo imaging involves administering to the subject the diagnostic antibody having antigenic specificity for a conformational epitope of a polymerized product containing two or more protein and/or peptide units where each unit is independently selected from the group consisting of Αβ, α-synuclein, tau, TDP- 43, amylin, and/or PrP proteins or peptides, and detecting the binding of the diagnostic agent to the amyloidogenic protein in vivo. As described supra, preferred antibodies bind to a conformational epitope of an amyloidogenic form of a protein or peptide without binding to the non-amyloidogenic proteins and without binding to the non-pathological forms of the amyloidogenic proteins.

[0106] Diagnostic antibodies or similar reagents can be administered by intravenous injection into the body of the patient, or directly into the brain by intracranial injection or by drilling a hole through the skull. The dosage of antibody should be within the same ranges as for treatment methods. Typically, the antibody is labeled, although in some methods, the primary antibody with affinity for the conformational epitope of an amyloid protein is unlabelled and a secondary labeling agent is used to bind to the primary antibody. The choice of label depends on the means of detection. For example, a fluorescent label is suitable for optical detection. Use of paramagnetic labels is suitable for tomographic detection without surgical intervention. Radioactive labels can also be detected using PET or SPECT.

[0107] Diagnosis is performed by comparing the number, size, and/or intensity of labeled amyloid protein deposits in a sample from the subject or in the subject, to corresponding baseline values. An appropriate baseline value can be the average level of amyloid protein deposition in a population of undiseased individuals. Alternatively, an appropriate baseline value may be the level of amyloid protein deposition in the same subject determined at an earlier time.

[0108] The diagnostic methods described above can also be used to monitor a subject's response to therapy. In this embodiment, detection of amyloid deposits in the subject is determined prior to the commencement of treatment. The level of amyloid deposition in the subject at this timepoint is used as a baseline value. At various times during the course of treatment the detection of amyloid deposits can be repeated, and the measured values thereafter compared with the baseline values. A decrease in values relative to baseline signals a positive response to treatment.

[0109] The present invention is further directed to a kit for performing the above described diagnostic and monitoring methods. Typically, such kits contain a diagnostic antibody reagent, preferably the antibody of the present invention that has antigenic specificity for a polymerized Αβ, α-synuclein, tau, TDP-43, amylin, and/or PrP protein or peptide product. The kit can also include a detectable label. The diagnostic antibody itself may contain the detectable label (e.g., fluorescent molecule, biotin, etc.) which is directly detectable or detectable via a secondary reaction (e.g., reaction with strepavidin). Alternatively, a second reagent containing the detectable label may be utilized, where the second reagent has binding specificity for the primary antibody. In a diagnostic kit suitable for measuring amyloid in a biological sample, the antibodies of the kit may be supplied prebound to a solid phase, such as to the wells of a microtiter dish.

[0110] Diagnostic kits of the present invention also include kits that are useful for detecting antibody production in a subject following administration of a polymerized protein or peptide of the present invention. Typically, such kits include a reagent that contains the antigenic epitope of the antibodies generated by the subject in a polymerized product as described supra. The kit also includes a detectable label, in a preferred embodiment, the label is typically in the form of labeled anti-idiotypic antibodies. The antigenic epitope reagents of the kit can be supplied prebound to a solid phase, such as to the wells of a microtiter dish. EXAMPLES

[0111] The following examples are provided to illustrate embodiments of the present invention but they are by no means intended to limit its scope.

Materials and Methods for Examples 1-4 [0112] Peptide Synthesis: The 42 amino acid Αβ peptide (SEQ ID N0: 1), the

ABri peptide (Cys-Ser-Arg-Thr-Val-Lys-Lys-Asn-Ile-Ile-Glu-Glu-Asn) (SEQ ID N0:8), and Αβ 1 -30Κ 18 Κ 19 (daefrhdsgy evhhqklkkf aedvgsnkga) (SEQ ID NO: 12) were synthesized on an ABI 430A peptide synthesizer (AME Bioscience, Chicago, IL) at the Keck peptide synthesis facility at Yale University, CT, using a Vydac C I 8 preparative column, 2.5 x 30 cm (Vydac Separations, Hesperia, CA). Standard protocols for tBOC (tert-butyloxycarbonyl) chemistry were used. The peptides were subsequently cleaved from the resins using hydrofluoric acid and purified by high- pressure liquid chromatography (HPLC) on a Vydac C 18 preparative column using linear gradients from 0-70% of acetonitrile in 0.1% trifluoroacetic acid. Mass spectroscopy of the lyophilized end-product was used to verify the expected molecular weight.

[0113] Peptide Polymerization and Assessment of Conformation. In order to make the peptides immunogenic and to potentially ensure a conformation specific immune response, the peptides were first subjected to controlled polymerization using the following protocol. Peptides were dissolved at 3 mg/ml, in lOOmM borate buffer saline (BBS), pH 7.4. Fresh 1% glutaraldehyde in BBS was prepared and added to the peptide to a final 5mM glutaraldehyde concentration and incubated in an

Eppendorf block at 800rpm at 56°C for 16hrs. The solution was then quenched with 0.5 M glycine to make the solution lOOmM in glycine. After five minutes the solution was diluted 1 :3 with BBS, dialyzed against 2mM BBS overnight at 4°C, aliquoted, and lyophilized.

[0114] For electron microscopic studies of the polymerized Αβ peptide, the original and polymerized peptides were incubated at 1 mg/ml in phosphate buffered saline, pH 7.4. The sample (3μ1 ) was put onto a carbon coated 400 mesh Cu/Rh grid (Ted Pella Inc., Redding, CA) and stained with 1% uranyl acetate in distilled water (Polysciences, Inc, Warrington, PA). Stained grids were examined under a Philips CM- 12 electron microscope (FEI; Eindhoven, The Netherlands) and photographed with a ( l k x lk) digital camera (Gatan, Inc., Pleasanton, CA).

[0115] Immunization of Mice. Animal studies were approved by the NYU

School of Medicine Institutional Animal Care and Use Committee and were consistent with the recommendations of the American Veterinary Association. Two transgenic (Tg) mouse models were used in these experiments. The first model, the 3xTg model, develops both plaque and tangle pathology (Oddo et al., "Triple- Transgenic Model of Alzheimer's Disease with Plaques and Tangles: Intracellular Abeta and Synaptic Dysfunction," Neuron 39:409-21 (2003), which is hereby incorporated by reference in its entirety). The second model, the TgSwDI model, develops extensive congophilic angiopathy (CAA) (Davis et al., "Early-Onset and Robust Cerebral Microvascular Accumulation of Amyloid Beta-Protein in Transgenic Mice Expressing Low Levels of a Vasculotropic Dutch/Iowa Mutant Form of Amyloid Beta-Protein Precursor," /. Biol. Chem. 279:20296-306 (2004), which is hereby incorporated by reference in its entirety). Starting at the age of 3 months mice were immunized 4 times biweekly, subcutaneously with 50μg/animal of polymerized peptide in sterile saline:Alum 9: 1, and thereafter 4 times bimonthly with 25 igjm\ma\ until the 12 month. At the age of 15- 16 months mice were subject to locomotor and cognitive behavioral testing (radial arm maze), followed by histological and biochemical analysis. Animals were bled from the caudal vein prior to inoculation (TO), after the 6 th inoculation (T6) and at the time of sacrifice (TF). The blood was collected in heparinized tubes and plasma separated and stored at -80°C.

[0116] Locomotor and Cognitive Behavioral Testing. Locomotor Activity:

A Hamilton-Kinder Smart-frame Photobeam System was used to make a

computerized recording of animal activity over a designated period of time.

Exploratory locomotor activity is recorded in a circular open field activity chamber measuring (70 x 70 cm). A video camera mounted above the chamber automatically recorded horizontal movements in the open field in each dimension {i.e., x, y, and two z planes). Total distance was measured in centimeters (cm) traveled and is defined as sequential movement interruptions of the animal measured relative to the background. The duration of the behavior was timed for 15 min. Results were reported based on distance traveled (cm), mean resting time, and maximum velocity of the animal.

[0117] Radial Arm Maze: Prior to testing, the mice were adapted to the room with lights on for 15 min. Spatial learning was evaluated using an eight-arm radial maze with a water well at the end of each arm. Clear Plexiglas guillotine doors, operated by a remote pulley system, controlled access to the arms from a central area from which the animals entered and exited the apparatus. After 3-4 days of adaptation, water-restricted mice (2 hours daily access to water) were given one training session per day for ten consecutive days. For each session, all arms were baited with saccharine flavored water, and animals were permitted to enter all arms until the eight rewards had been consumed. The number of errors (entries to previously visited arms) and time to complete each session were recorded.

[0118] Antibody Levels. Antibody levels were determined in duplicate on

1 : 100 dilutions of plasma using ELISA as described previously (Goni et al., "Mucosal Vaccination Delays or Prevents Prion Infection Via an Oral Route," Neurosci.

133:413-421 (2005); Asuni et al., "Αβ Derivative Vaccination in Alum Adjuvant Prevents Amyloid Deposition and Does Not Cause Brain Microhemorrhages in

Alzheimer's Model Mice," Eur. J. Neurosci. 24:2530-2542 (2006), which are hereby incorporated by reference in their entirety), in which 5 μξ/ ε Αβ1-40, Αβ 1-42, Αβΐ -30ΚΚ, or pABri was coated onto Immulon 2HB 96 well microtiter wells (Thermo, Waltham, MA). The bound antibodies were detected by a horseradish peroxidase labeled goat anti-mouse IgG (Amersham Biosciences, Piscataway, NJ) or a peroxidase conjugated goat anti-mouse IgM (Sigma; A8786). Tetramethyl benzidine (TMB; Pierce, Rockford, IL) was the color developing substrate and the readings were done at 450nm.

[0119] Histology. Mice were anesthetized with sodium pentobarbital ( 150 mg/kg, i.p.), perfused transaortically with phosphate buffer, and the brains processed as described previously (Asuni et al., "Αβ Derivative Vaccination in Alum Adjuvant Prevents Amyloid Deposition and Does Not Cause Brain Microhemorrhages in Alzheimer's Model Mice," Eur. J. Neurosci. 24:2530-2542 (2006); Sigurdsson et al., "An Attenuated Immune Response is Sufficient to Enhance Cognition in an

Alzheimer's Disease Mouse Model Immunized With Amyloid-β Derivatives," /.

Neurosci. 24:6277-6282 (2004), which are hereby incorporated by reference in their entirety). Serial coronal sections (40 μιη) were stained with a mixture of 4G8/6E10, monoclonal antibodies that recognizes Αβ and stains both pre~amyloid and Αβ plaques (Sadowski et al., "Blocking the Apolipoproteine/Amyloid β Interaction Reduces the Parenchymal and Vascular Amyloid-β Deposition and Prevents Memory Deficit in AD Transgenic Mice," Proc. Natl. Acad. Sci. (USA) 103: 18787- 18792 (2006); Scholtzova et al., "Induction of Toll-Like Receptor 9 Signaling as a Method for Ameliorating Alzheimer's Disease Related Pathology," J. Neurosci. 29: 1846- 1854 (2009), which are hereby incorporated by reference in their entirety).

Immunostaining was performed as described previously (Sadowski et al., "Blocking the Apolipoproteine/ Amyloid β Interaction Reduces the Parenchymal and Vascular Amyloid-β Deposition and Prevents Memory Deficit in AD Transgenic Mice," Proc. Natl. Acad. Sci. (USA) 103: 18787- 18792 (2006); Scholtzova et al., "Induction of Toll-Like Receptor 9 Signaling as a Method for Ameliorating Alzheimer's Disease Related Pathology," J. Neurosci. 29: 1846- 1854 (2009), which are hereby incorporated by reference in their entirety). All procedures were performed by an individual blinded to the experimental conditions of the study. The Αβ burden is defined as the percentage of area in the measurement field occupied by reaction product.

Example 1 - Locomotor and Cognitive Testing

[0120] In order to verify that cognitive testing was not confounded by differences in sensorimotor abilities in the polymerized peptide vaccinated versus control Tg3x and SwDI transgenic mice, locomotor testing was conducted first. There was no significant differences between SwDI Tg control mice and SwDI Tg mice vaccinated with polymerized Αβ 1-30 ΐ ΐ9 Κ, polymerized ABri peptide (ABri- Glut), or polymerized Αβ 1-42 peptide in distance traveled (Figure 1 A) or mean velocity (Vmean) (Figure 1 C). Αβ 1 -42 vaccinated Tg mice exhibited slower maximum velocity (Vmax) (Figure IB) (p=0.0234 post-hoc only; Αβ1 -42 versus control p<0.05) and longer resting time (Figure ID) (p=0.031 1 post-hoc only; Αβ1-42 versus control p<0.05) compared to controls. No significant differences between the Αβ 1-30ΐ 8Κ ΐ 9 Κ and ABri treated Tg animals versus controls in these parameters were observed (Figures I B and ID). There was no significant difference between Tg3x control mice and Tg3x mice vaccinated with a synthetic polymerized Αβ1-30 ι 8 Κΐ 9, polymerized ABri peptide (ABri-Glut), or the combination of Αβ 1 -30 KjgKjg and ABri polymerized peptides in distance traveled (Figure 2A), maximum velocity (Vmax) (Figure 2B), mean velocity (Vmean) (Figure 2C), or in resting time (Figure 2D).

[0121] Radial arm maze cognitive testing showed there were significant differences between the untreated control Tg3x mice (Tg control) versus Apri treated Tg mice and wild-type controls (Figure 3A). There was no difference between the wild-type controls and the ABri vaccinated Tg3x mice. There was also a significant difference between the untreated control Tg3x mice (Tg control) versus animals vaccinated with the polymerized Ap i-30KigK i 9 peptide and animals vaccinated with the combination of polymerized ABri and A i-30KigKi 9 peptides (Figure 3B).

[0122] Radial arm maze cognitive testing in the SwDI Tg mice showed there were significant differences between the untreated control SwDI Tg mice (Tg Control) versus the polymerized Αβ1 -42, Ap l-30KigKig, and Αβπ treated Tg mice and wild-type controls (Figure 3C). There was no difference between the wild-type controls and the vaccinated SwDI Tg mice.

Example 2 - Antibody Titers

[0123] In TgSwDI mice vaccinated with polymerized ABri, significant IgG and IgM titers were noted against Αβ 1~40, Αβ 1-42, and polymerized ABri at Tl and Tf (Figure 4A). In TgSwDI mice vaccinated with polymerized Αβ1-30Κ ΐ 8 Κι 9 , significant IgG and IgM titers were noted against Αβ1-40, Αβ1-42, and Αβ l- 30Ki 8 K 19 at Tl (Figure 4B). Significant IgM titers against Αβ1 -40, Αβ 1-42, and Αβ 1-30 K 18 Ki , and significant IgG titers against Αβ 1 -42 were observed at Tf (Figure 4B). In TgSwDI mice vaccinated with polymerized Αβ 1-42, significant IgG and IgM titers were also noted against Αβ 1—40, Αβ 1-42, and Αβ1-30Κι 8 Κ, 9 at Tl , and to a lesser extent at Tf (see Figure 4C).

[0124] In Tg3x mice vaccinated with polymerized ABri, significant IgG and

IgM titers were noted against Αβ1-42 and polymerized ABri at Tl and Tf (Figure 5A). Significant IgM titers against Αβ 1-40 were observed at Tl , and significant IgG titers against Αβ1 -40 were observed at Tf in these animals. In the polymerized Αβ ΐ- 30Ki 8 K| 9 vaccinated Tg3x mice, significant IgG and IgM titers were noted against Αβ 1-42 and Αβ 1-30Κ 18 Κ, 9 at T l and Tf, and significant IgM and IgG antibodies against Αβ 1 -40 were observed at Tf (Figure 5B). In Tg3x animals vaccinated with the combination of polymerized Αβ1 -30Κι 8 Κΐ9 and ABri, significant IgG and IgM titers were also noted against Αβ 1-42, Αβ 1-30Κι 8 Κι 9 . and ABri at Tl and Tf (see Figure 5C). Figure 5D shows that IgG and IgM antibody titer against Αβ 1 -40 and Αβ1 -42 does not differ significantly in vehicle treated transgenic 3xTg animals. Example 3 - Amyloid Burden

[0125] There was a significant reduction in hippocampal amyloid burden in

Tg3x animals administered polymerized ABri (Tg-pABri), polymerized Αβ ΐ- 30] 8 Ki9K (Tg-AB 1-30KK), or the combination of polymerized peptides (Tg- combined) compared to transgenic control (Tg-control) animals as shown in Figure 6A. There was also a significant reduction in PHFl in the hippocampus (Figure 6B) and cortex (Figure 6C), respectively, of Tg3x animals administered polymerized ABri or the combination of polymerized ABri and Αβ 1-30 ΐ 8 Κ ΐ 9 Κ. No significant difference in PHFl burden in the hippocampus or cortex was found between Tg- control and Tg- Αβ1-30 ΐ 8 Κ ΐ 9 Κ treated animals.

[0126] There was a significant reduction in the hippocampal amyloid burden in SwDI Tg animals vaccinated with polymerized ABri, Αβ1 -30Κ) 8 Κΐ 9, or Αβ 1-42 compared to control Tg mice (see Figure 7A). Example 4 - Apl-42 Peptide Polymerization and Assessment of Conformation

[0127] To examine the stability of polymerized peptide conformation over time, aged Αβ1 -42 was analyzed by electron microscopy. As shown in the EM photomicrograph of Figure 7B the polymerized Αβΐ -42 peptide is predominately in the form of spherical particles of ~200nm at 3 weeks post polymerization. Similarly, the EM photomicrograph of Figure 8 A shows that Αβ 1-42 peptide aged for 3 months after controlled polymerization with glutaraldehyde maintains the spherical particle form that is typical of oligomerized peptides/proteins without any evidence of fibril formation. In contrast, a non-polymerized Αβ 1-42 peptide from the same synthesis batch as the peptide in Figure 8A shows complete fibrillization at 3 months. Discussion of Examples 1-4

[0128] In summary, controlled polymerized forms of Αβ1-42 and Αβ ΐ-

30K( gKi 9 have been obtained. As demonstrated by EM analysis the Αβΐ -42 polymerized form does not produce fibrils when aged. The polymerized peptides are stable immunogens that produce an immune response that more specifically targets the oligomeric pathogenic form of Αβ without targeting the normal, physiological conformers of Αβ. Vaccination of TgSwDI and Tg3x animals with polymerized ABri, Αβ 1-42 or A l-30 igKi elicits a good antibody response and produces cognitive benefits. Administration of polymerized Αβ 1 -42 reduces amyloid beta pathology, reduces Αβ oligomer levels, and diminishes congophilic angiopathy, which is extensive in the SwDI animal model. As demonstrated herein, polymeric synthetic peptides have been designed that mimic the secondary structure found in amyloid and oligomeric forms of Αβ and pathological forms of tau. The antibody response elicited can target both amyloid and tau pathology resulting in a cognitive benefit, pathology burden reduction, and lack of apparent autoimmune toxicity. Collectively, this data demonstrates these polymeric synthetic peptides are excellent candidates for comprehensive immunomodulation in AD.

Materials and Methods for Example 5

[0129] Five White Tail deer were inoculated (vaccinated group) orally with an attenuated salmonella carrying deer PrP to stimulate the mucosal immune system. At the same time six White Tail deer were inoculated with the same strain of attenuated salmonella but without any insert or foreign protein to be delivered (Control group). The inoculations were repeated 4 times over a period of a few months following the protocol described by Goni et al., "High Titers of Mucosal and Systemic Anti-PrP Antibodies Abrogate Oral Prion Infection in Mucosal-Vaccinated Mice," Neurosci. 153:679-686 (2008), which is hereby incorporated by reference in its entirety.

[0130] Before the first inoculation (TO) and after the fourth inoculation (T5) samples of serum, saliva, and feces were taken and the specific antibodies against PrP were measured by ELISA. Subsequently vaccinated animals were orally boosted with a mixture of recombinant polymerized deer PrP protein and polymerized PrP fragments corresponding to amino acid residues 121 - 166; 13- 155; 155-200 and 169- 230 of the mouse prion protein of SEQ ID NO: 1 1 below.

1 manlgywlla lfvtmwtdvg lckkrpkpgg wntggsrypg qgspggnryp pqggtwgqph 61 gggwgqphgg s gqphggsw gqphggg gq gggthnqwnk pskpktnlk vagaaaagav 121 vgglggymlg samsrpmihf gndwedryyr enmyrypnqv yyrpvdqysn qnnfvhdcvn 181 itikqhtvtt ttkgenftet dvkmmerwe qmcvtqyqke sqayydgrrs sstvlfsspp 241 villisflif livg

[0131] The PrP peptides and recombinant protein were subject to controlled polymerization as described herein and Goni et al, "Immunomodulation Targeting Abnorraal Protein Conformation Reduces Pathology in a Mouse Model of

Alzheimer's Disease," PLoS One 5( !0):e l 3391 (2010), which is hereby incorporated by reference in its entirety. The polymerized PrP fragments and PrP protein were dissolved in sterile saline and delivered with 9: 1 sodium hydroxide (Alum).

[0132] Ten days after delivery of the first booster, serum, saliva, and feces samples were taken (T6). Two months later the same boost with polymerized PrP and polymerized PrP fragments was repeated. Ten days after the second booster, serum, saliva, and feces were collected (T7).

[0133] The animals were subsequently boosted again and then orally challenged by delivering Chronic Wasting Disease (CWD) brain homogenate in bait. Samples were taken at different times and survival was assessed to the time the animals showed clear signs of prion disease.

Example 5 - Administration of Polymerized PrP Protein/Peptides Protects

Against Chronic Wasting Disease in Deer

[0134] Figures 9 and 10 show the anti-PrP IgA antibody titers in feces and anti-PrP IgM antibody titers in plasma, respectively, in both control and vaccinated deer over the course of the treatment regimen described above. The control group did not develop any noticeable IgA titer whereas the vaccinated group showed some increase in mucosa titer after the immune response was established with the salmonella oral delivery. The IgA titers were initially very low (T5) but were greatly enhanced after the animals were boosted with the polymerized PrP and PrP fragments (T6 and T7) showing the importance of these antigenic preparation on generating a sustainable immune response (Figure 9). With regard to IgM antibody titers, the control group did not show any noticeable increase in antibody titer; whereas the vaccinated group showed some concomitant IgM titer in serum at the same time of the mucosal response (T5). Anti-PrP antibody titers in the vaccinated animals greatly increased after the two boosts with the polymerized PrP and PrP fragments showing that this type of boost could invoke a therapeutic serum response.

[0135] An analysis of the antibody specificity in the vaccinated deer found that the antibodies produced are specific to prion protein. Figure 10 contains immunoblot data using purified antibodies from T7 in vaccinated animal 781 and control animal 786. Lane 1 of the blot contains salmonella lysate, to which antibodies in both animals were highly reactive to. Lanes 4 and 5 contain deer PrP and polymerized deer PrP. The bands appearing in both lanes of the blot incubated with antibodies from the vaccinated animal but not in the lanes of the blot incubated with antibodies from the control animal indicate the generation and presence of deer PrP antibodies in the vaccinated, but not control animals. Lanes 2 and 3 contain sheep PrP and polymerized sheep PrP. The absence of bands in these lanes indicates the specificity of the antibody response observed in the vaccinated animals, i.e., the generated antibodies are specific for deer PrP.

[0136] PrP vaccination was clearly protective as indicated by the Kaplan

Meier survival curve of Figure 12. Both vaccinated and control animals were challenged with exposure to CWD. Three out of the six control animals became with sick prionoses CWD and had to be properly euthanized. In contrast, none of the vaccinated animals had any signs of disease over the course of 18 months after challenge.

[0137] Although preferred embodiments have been depicted and described in detail herein, it will be apparent to those skilled in the relevant art that various modifications, additions, substitutions, and the like can be made without departing from the spirit of the invention and these are therefore considered to be within the scope of the invention as defined in the claims which follow.