MELGAR ROMEL (US)
US5436138A | 1995-07-25 | |||
US20160272950A1 | 2016-09-22 | |||
US20160340700A1 | 2016-11-24 | |||
US20040014764A1 | 2004-01-22 | |||
US6444641B1 | 2002-09-03 | |||
US20080286749A1 | 2008-11-20 | |||
US20120184465A1 | 2012-07-19 | |||
US20130224810A1 | 2013-08-29 | |||
US20050118665A1 | 2005-06-02 |
CLAIMS 1. A genetically modified microorganism, comprising: a first gene that encodes an acyl transferase; a second gene that encodes a peptide or protein, one or both of the first and second gene being heterologous with respect to a corresponding native microorganism; and a modified acyl-CoA biosynthetic pathway that is, compared to a native acyl-CoA biosynthetic pathway in the native microorganism, configured for one or more of: inducible biosynthesis of an acyl-CoA and over-accumulation of the acyl-CoA, the genetically modified microorganism being effective upon fermentation to cause acylation of the peptide or protein by the acyl transferase using the acyl-CoA to provide a N- acylated peptide or protein product. 2. The genetically modified microorganism of claim 1, characterized by inducible production of one or more of: the acyl transferase encoded by the first gene, the peptide or protein encoded by the second gene, and at least one gene of the modified acyl-CoA biosynthetic pathway. 3. The genetically modified microorganism of claim 2, comprising a phosphate-regulated promoter that is yibD or ugpB, operatively linked to one or more of: the first gene; the second gene; and at least one gene of the modified acyl-CoA biosynthetic pathway; one or more of the first, second, or the at least one gene of the modified acyl-CoA biosynthetic pathway being inducible by phosphate depletion of the fermentation medium. 4. The genetically modified microorganism of claim 1, the first gene encoding a Cg-Cig acyl transferase. 5. The genetically modified microorganism of claim 1, the first gene encoding a human acyl transferase. 6. The genetically modified microorganism of claim 5, the first gene encoding human N- myristoyl transferase 1. 7. The genetically modified microorganism of claim 1 , the first gene encoding one of a myristoyl transferase, a palmitoyl transferase, a N-myristoyl transferase, and a glycylpeptide N- tetradecanoyl transferase. 8. The genetically modified microorganism of claim 1 , the first gene encoding a glycylpeptide N-tetradecanoyl transferase comprising a mutation in an acyl-CoA binding site, the glycylpeptide N-tetradecanoyl transferase characterized by a modified acyl-CoA substrate specificity corresponding to the mutation. 9. The genetically modified microorganism of claim 1 , the second gene encoding a human peptide or protein. 10. The genetically modified microorganism of claim 1 , the second gene encoding one of: somatotropin, glucagon, insulin, fibroblast growth factor 21 , fibroblast growth factor 1 , fibroblast growth factor 2, fibroblast growth factor 7, fibroblast growth factor 18, fibroblast growth factor 19, enkephalin, galanin, gastric inhibitory peptide, pancreatic prohormone, calcitonin, neuropeptide W, neuropeptide Y, hirudin, coagulation factor VIII, coagulation factor IX, tissue plasminogen activator, follicle-stimulating hormone, erythropoietin, granulocyte colony-stimulating factor, interferon, and asparaginase. 11. The genetically modified microorganism of claim 1 , further comprising: a first oligonucleotide that encodes a protein tag, the first oligonucleotide operatively linked to the second gene so that expression using the first oligonucleotide and the second gene results in a product comprising the protein tag operatively linked to the N-terminus of the peptide or protein; and a third gene that encodes a cleaving enzyme configured to cleave the protein tag from the peptide or protein. 12. The genetically modified microorganism of claim 11, the protein tag being one or more of: a SUMO tag, a FLAG (octapeptide), a TRx (thioredoxin), a TAP (tandem affinity purification tag), a fluorescent protein. 13. The genetically modified microorganism of claim 11, the third gene being one or more of heterologous with respect to the native microorganism and inducible. 14. The genetically modified microorganism of claim 11, the third gene encoding the cleaving enzyme including one of: ulpl, enterokinase, a TEV (tobacco etch virus), a thrombin, and a GST-protease fusion protein. 15. The genetically modified microorganism of claim 11, further comprising: a second oligonucleotide that encodes a C-terminal tag, the second oligonucleotide operatively linked to the second gene so that expression using the second oligonucleotide and the second gene results in a product comprising the C-terminal tag and the peptide or protein. 16. The genetically modified microorganism of claim 15, the C-terminal tag being one of: a glutathione S-transferase, a maltose binding protein, a calmodulin binding peptide, a his-patch thiofusion, a tap affinity purification tag, an epitope tag, a reporter tag, a modified haloalkane dehalogenase, SUMO, a serine proteinase, a post-synaptic density protein, a streptavidin/biotin- based tag, a chitin binding domain tag, and a polyhistidine. 17. The genetically modified microorganism of claim 11, further comprising: 18. a third oligonucleotide that encodes a substrate, the third oligonucleotide operatively linked to the first oligonucleotide and the second gene so that expression using the first oligonucleotide, the third oligonucleotide, and the second gene produces a product comprising the protein tags, the substrate, and the peptide or protein. The genetically modified microorganism of claim 17, the substrate being a substrate for a glycylpeptide N- tetradecanoyltransferase. 19. The genetically modified microorganism of claim 17 the substrate for the acyltransferase of the peptide or protein encoded by the third oligonucleotide gene being a natural substrate for a glycylpeptide N-tetradecanoyltransferase. 20. The genetically modified microorganism of claim 1, further comprising: a fourth oligonucleotide that encodes a methionine aminopeptidase sensitive protease tag, the fourth oligonucleotide being operatively linked to the second gene so that expression using the fourth oligonucleotide and the second gene produces a product comprising the methionine aminopeptidase sensitive protease tag operatively linked to the N-terminus of the peptide or protein; and a third gene that encodes a cleaving enzyme configured to cleave the methionine aminopeptidase sensitive protease tag from the peptide or protein. 21. The genetically modified microorganism of claim 20, the third gene being homologous or heterologous. 22. The genetically modified microorganism of claim 20, the third gene being inducible. 23. The genetically modified microorganism of claim 1, the modified acyl-CoA biosynthetic pathway being configured to one or more of: induce expression of a gene encoding a homologous acyl-CoA synthase; express a heterologous acyl-CoA thioesterase; and mitigate degradation of the acyl-CoA by deletion of a gene. 24. The genetically modified microorganism of claim 23, the expression of the gene encoding a heterologous acyl-CoA thioesterase being inducible. 25. The genetically modified microorganism of claim 24, further comprising ayibD or ugpB gene promoter operatively linked to the gene for the heterologous acyl-CoA thioesterase effective to induce expression of the heterologous acyl-CoA thioesterase in the presence of phosphate depletion of a fermentation medium. 26. The genetically modified microorganism of claim 25, the heterologous acyl-CoA thioesterase being derived from Cinnamomum camphorum. 27. The genetically modified microorganism of claim 23, comprising an inducible promoter effective to induce expression of the gene encoding a homologous acyl-CoA synthase. 28. The genetically modified microorganism of claim 27, the inducible promoter being a yibD or ugpB gene promoter configured to induce expression of the homologous acyl-CoA synthase in the presence of phosphate depletion of a fermentation medium. 29. The genetically modified microorganism of claim 28, comprising deletion of a gene corresponding to an acyl-CoA degradation pathway of the corresponding native microorganism effective to mitigate degradation of the acyl-CoA. 30. The genetically modified microorganism of claim 23, the gene encoding fadE. The genetically modified microorganism of claim 23, the microorganism being configured to induce expression of the homologous acyl-CoA synthase, express the heterologous acyl-CoA thioesterase, and mitigate degradation of the acyl-CoA. 31. A method of in vivo acylation of a target peptide or protein in a genetically modified microorganism, comprising: expressing an acyl transferase encoded by a first gene; expressing a peptide or protein encoded by a second gene, one or both of the first and second gene being heterologous compared to a corresponding native microorganism; producing an acyl-CoA using a modified acyl-CoA biosynthetic pathway; and fermenting the microorganism under conditions effective to cause acylation of the peptide or protein by the acyl transferase using the acyl-CoA to provide aN-acylated peptide or protein product. 32. The method of claim 31, further comprising inducing one or more of: the expression of the acyl transferase; the expression of the peptide or protein, and the synthesis of the acyl-CoA. 33. The method of claim 31 the inducing comprising auto-inducing by phosphate depletion of the microorganism medium. 34. The method of claim 31 , comprising causing acylation of the peptide or protein using a Cg-Cis acyl transferase. 35. The method of claim 31 , comprising causing acylation of the peptide or protein using a human acyl transferase. 36. The method of claim 31 , comprising causing acylation of the peptide or protein using human N-myristoyl transferase 1. 37. The method of claim 31 , comprising causing acylation of the peptide or protein using one of a myristoyl transferase, a palmitoyl transferase, a N-myristoyl tranferase, a glycylpeptide N-tetradecanoyl transferase comprising a mutation in an acyl-CoA binding site, and a glycylpeptide N-tetradecanoyl transferase. 38. The method of claim 31 , comprising expressing the second gene encoding a human peptide or protein. 39. The method of claim 31 , comprising expressing the second gene encoding one of: somatotropin, glucagon, insulin, fibroblast growth factor 21 , fibroblast growth factor 1 , fibroblast growth factor 2, fibroblast growth factor 7, fibroblast growth factor 18, fibroblast growth factor 19, enkephalin, galanin, gastric inhibitory peptide, pancreatic prohormone, calcitonin, neuropeptide W, neuropeptide Y, hirudin, coagulation factor VIII, coagulation factor IX, tissue plasminogen activator, follicle-stimulating hormone, erythropoietin, granulocyte colony-stimulating factor, interferon, and asparaginase. 40. The method of claim 31 , further comprising: expressing a protein tag operatively linked to the N-terminus of the peptide or protein; and expressing a cleaving enzyme encoded by a third gene under conditions effective to cleave the protein tag from the peptide or protein. 41. The method of claim 40, one or more of: expressing the protein tag as one of: a SUMO tag, a FLAG (octapeptide), a TRx (thioredoxin), a TAP (tandem affinity purification tag), and a fluorescent protein; and expressing the cleaving enzyme as one of: ulpl, enterokinase, a TEV (tobacco etch virus), a thrombin, and a GST-protease fusion protein. 42. The method of claim 31, further comprising: expressing a C-terminal tag operatively linked to the peptide or protein such that fermenting the microorganism under conditions effective to cause acylation provides the N- acylated peptide or protein product comprising the C-terminal tag; and purifying the N-acylated peptide or protein product using the C-terminal tag. 43. The method of claim 31, the C-terminal tag being one of: a glutathione S -transferase, a maltose binding protein, a calmodulin binding peptide, an his-patch thiofusion, a tap affinity purification tag, an epitope tag, a reporter tag, a modified haloalkane dehalogenase, SUMO, serine proteinase, a post-synaptic density protein, a streptavidin/biotin-based tag, a chitin binding domain tag, and a polyhistidine. 44. The method of claim 31, further comprising: expressing a methionine aminopeptidase sensitive protease tag operatively linked to the N-terminus of the peptide or protein; expressing a cleaving enzyme; and cleaving the methionine aminopeptidase sensitive protease tag from the N-terminus of the peptide or protein. 45. The method of claim 31, further comprising: expressing a substrate operatively linked between the protein tag and the peptide or protein to produce a product comprising the protein tags, the substrate, and the peptide or protein. 46. The method of claim 31, the substrate being a substrate for a glycylpeptide N- tetradecanoyltransferase. 47. The method of claim 31, comprising synthesizing the acyl-CoA using the modified acyl- CoA biosynthetic pathway comprising one or more of: inducing expression of a homologous acyl-CoA synthase; expressing a heterologous acyl-CoA thioesterase; inducing expression of the heterologous acyl-CoA thioesterase; and mitigating degradation of the acyl-CoA by deletion of a gene. 48. The method of claim 46, the heterologous acyl-CoA thioesterase being derived from Cinnamomum camphorum. 49. The method of claim 46, the modified acyl-CoA biosynthetic pathway comprising deletion of a gene encoding fadE. 50. The method of claim 31, comprising inducing expression of the homologous acyl-CoA synthase, inducing expression of the heterologous acyl-CoA thioesterase, and mitigating degradation of the acyl-CoA. 51. A N-acylated therapeutic peptide or protein, produced by one of: fermentation of the genetically modified microorganism of any of claims 1-30; and the method of any of claims 31- 50. 52. The N-acylated therapeutic peptide or protein of claim 51, corresponding to N-acylation of one of: somatotropin, glucagon, insulin, fibroblast growth factor 21, fibroblast growth factor 1, fibroblast growth factor 2, fibroblast growth factor 7, fibroblast growth factor 18, fibroblast growth factor 19, enkephalin, galanin, gastric inhibitory peptide, pancreatic prohormone, calcitonin, neuropeptide W, neuropeptide Y, hirudin, coagulation factor VIII, coagulation factor IX, tissue plasminogen activator, follicle-stimulating hormone, erythropoietin, granulocyte colony-stimulating factor, interferon, and asparaginase. 53. The N-acylated therapeutic peptide or protein of claim 51, corresponding to N-acylation with one of a myristoyl group and a palmitoyl group. 54. A gene or plasmid construct comprising one or more of: SEQ ID NOs: 28, 30, 31, 32, 33, and 36. |
[0001] This application claims priority to U.S. Provisional Pat. App. No. 62/463,811, filed on February 27, 2017, which is incorporated by reference herein in its entirety.
BACKGROUND
[0002] The use of biologies to treat a myriad of conditions is on the rise, with an ever increasing percentage of the population benefiting from these drugs. The use of candidate proteins in effective clinical therapies, however, may often benefit from modification. For example, modification with polyethylene glycol chains (PEGylation) may increase the stability of biologies. However PEGylation may result in a heterogeneous population of molecules due to nonspecific chemistry, which may complicate the study, approval, and replication of these drugs. Moreover, PEGylation may not be effective in reducing immunogenicity and may result in the production of anti-PEG antibodies, leading to the loss of therapeutic efficacy, increased adverse reactions, and the like.
[0003] As an alternative to PEGylation, Lipidation, e.g., via N-acylation may enhance the binding of a desired protein to serum albumin or other carrier proteins, increasing drug half-life. Methods for the chemical synthesis of lipidated proteins have been developed, but these may use multiple steps, may have low specificity, may result in low yields, and the like. Biological synthesis of lipidated proteins has been demonstrated, e.g., myristoylation of proteins in E. coli. However, these approaches used the native ability of E. coli to uptake and activate free fatty acids from culture medium. Such approaches used addition of detergent solubilized fatty acids to the medium, and also the use of rich media, as fatty acid uptake and activation is known to be repressed in commercially relevant minimal media. Accordingly, such known methods may be low yield, laborious, expensive, and of low utility for production at larger scales.
[0004] The present application appreciates that modification of proteins and peptides, e.g., for production of therapeutics, may be a challenging endeavor. SUMMARY
[0005] In one embodiment, a genetically modified microorganism is provided. The genetically modified microorganism may include a first gene that encodes an acyl transferase. The genetically modified microorganism may include a second gene that encodes a peptide or protein. One or both of the first and second gene may be heterologous with respect to a corresponding native microorganism. The genetically modified microorganism may include a modified acyl-CoA biosynthetic pathway. Compared to a native acyl-CoA biosynthetic pathway in the native microorganism, the modified acyl-CoA biosynthetic pathway may be configured for one or more of: inducible biosynthesis of an acyl-CoA and over-accumulation of the acyl- CoA. The genetically modified microorganism may be effective upon fermentation to cause acylation of the peptide or protein by the acyl transferase using the acyl-CoA to provide a N- acylated peptide or protein product.
[0006] In another embodiment, a method of in vivo acylation of a target peptide or protein in a genetically modified microorganism is provided. The method may include expressing an acyl transferase encoded by a first gene. The method may include expressing a peptide or protein encoded by a second gene. One or both of the first and second gene may be heterologous compared to a corresponding native microorganism. The method may include producing an acyl-CoA using a modified acyl-CoA biosynthetic pathway. The method may include fermenting the microorganism under conditions effective to cause acylation of the peptide or protein by the acyl transferase using the acyl-CoA to provide a N-acylated peptide or protein product.
[0007] In one embodiment, a N-acylated therapeutic peptide or protein is provided. The N- acylated therapeutic peptide or protein may be produced by fermentation of any aspect of the genetically modified microorganism as described herein. The N-acylated therapeutic peptide or protein may be produced by any of the methods described herein. [0008] In another embodiment, a gene or plasmid construct is provided. The gene or plasmid construct may include any gene or oligonucleotide described herein, or any gene or oligonucleotide for any protein, peptide, enzyme, tag, or other expression product described herein. The gene or plasmid construct may include, for example, one or more of: SEQ ID NO: 28, 30, 31, 32, 33, and 36.
BRIEF DESCRIPTION OF THE SEQUENCES
[0009] SEQ ID NO: 1 is Primer tetA F.
atcaaaggga aaactgtcca tatgc
[0010] SEQ ID NO: 2 is Primer sac B R
Primer arsB tetA F.
[0011] SEQ ID NO: 3 is Primer arsB tetA F
caaatgaata gccaactcaa aattcacacc tattaccttc ctctgcactt cctaattttt gttgacactc tatc
[0012] SEQ ID NO: 4 is Primer Primer arsB sacB R.
aaataaagcg cacttttcta acaacctgtg ggggggatat cgccgctatc aaagggaaaa ctgtccatat gc
[0013] SEQ ID NO: 5 is Primer ompT tetA.
[0014] agatataaaa aatacatatt caatcattaa aacgattgaa tggagaactt tttcctaatt tttgttgaca ctctatc
[0015] SEQ ID NO: 6 is Primer ompT sacB.
gaaatggcta gttattcccc ggggcgattt tcacctcggg gaaattttag ttgatcaaag ggaaaactgt ccatatgc
[0016] SEQ ID NO: 7 is Primer500up.
aacggataag acgggcataa at
[0017] SEQ ID NO: 8 is Primer500 dn.
agattaaggg atgaaggaac gtc
[0018] SEQ ID NO: 9 is Primer 500up.
atttccgtgg acaactggtt a [0019] SEQ ID NO: 10 is Primer fadD_500dn.
ggacggcttc acacaaag
[0020] SEQ ID NO: 1 1 is Primer fadD_seq_F.
aactgaataa ttgcttgttt tt
[0021] SEQ ID NO: 12 is Primer fadD seq R. gctcaaacat atctaccaga ga
[0022] SEQ ID NO: 13 is Primer fadE_500up.
atgactaacg tcagaaatag c
[0023] SEQ ID NO. 14 is Primer fadE SOOdn.
cgggaggaat gatgtttaag
[0024] SEQ ID NO: 15 is Primer fadE_seq_F.
atgtttttac atccactaca acc
[0025] SEQ ID NO: 16 is Primer fadE seq R.
atccggatgg ctttaattt
[0026] SEQ ID NO: 17 is Primer fadE mid. atgggtacgt ttgaccacc
[0027] SEQ ID NO: 18 is Primer removeSUMO F. gggaacgcag cagct
[0028] SEQ ID NO: 19 is Primer removeSUMO R.
cattatatcc tccttaatag tattttataa aagttaaac
[0029] SEQ ID NO : 20 is Primer SL 1.
cagtccagtt acgctggagt c
[0030] SEQ ID NO: 21is Primer SR2.
ggtcaggtat gatttaaatg gtcagt
[0031] SEQ ID NO: 22 is Primer pCDF_piecel_F. gacgaattct ctagatatcg c [0032] SEQ ID NO: 23 is Primer pCDF_piecel_R.
gcaggtatct tcgagcca
[0033] SEQ ID NO: 24 is Primer pCDF_piece2_F.
tggctcgaag atacctgc
[0034] SEQ ID NO: 25 is Primer pCDF_piece2_R.
ggaaaccgtt gtggtctc
[0035] SEQ ID NO: 26 is Primer A80_hNMT-l_F.
aactcgttgc ctgctgag
[0036] SEQ ID NO: 27 is Primer A80_hNMT-l_R.
gtgatggtga tggtgatgca t
[0037] SEQ ID NO: 28 is vector
AarsB: :ugpBp-6xHIS-ulpl (383-1093 is ulpl. 203-285 ugpB).
ccaggcatca aataaaacga aaggctcagt cgaaagactg ggcctttcgt tttatctgtt gtttgtcggt gaacgctctc tactagagtc acactggctc accttcgggt gggcctttct gcgtttatac acagctaaca ccacgtcgtc cctatctgct gccctaggtc tatgagtggt tgctggataa ctctttctga caccttacta tcttacaaat gtaacaaaaa agttattttt ctgtaattcg agcatgtcat gttaccccgc gagcataaaa cgcgtatatt cagggagacc acaacggttt ccctctacaa ataattttgt ttaactttga attcaaaaga tctggtacca cctttaagaa ggagatatac atatgcgggg ttctcatcac catcatcacc atggtctggt tccgcgtgga tcccttgttc ctgaattaaa tgaaaaagac gatgaccaag tacaaaaagc tttggcatct agagaaaata ctcagttaat gaatagagat aatatagaga taacagtacg tgattttaag accttggcac cacgaagatg gctaaatgac actatcattg agttttttat gaaatacatt gaaaaatcta cccctaatac agtggcgttt aattcgtttt tctataccaa tttatcagaa aggggttatc aaggcgtccg gaggtggatg aagagaaaga agacacaaat tgataaactt gataaaatct ttacaccaat aaatttgaac caatcccact gggcgttggg cataattgat ttaaaaaaga aaactatagg ttacgtagat tcattatcga atggtccaaa tgctatgagt ttcgctatac tgactgactt gcaaaaatat gttatggagg aaagtaagca tacaatagga gaagactttg atttgattca tttagattgt ccgcagcaac caaatggcta cgactgtgga atatatgttt gtatgaatac tctctatgga agtgcagatg cgccattgga ttttgattat aaagatgcga ttaggatgag aagatttatt gcccatttga ttttaaccga cgctttaaaa taagaattcg aagcttgatc cggctgctaa caaagcccga aaggaagctg agttggctgc tgccaccgct gagcaataac tagcataacc ccttggggcc tctaaacggg tcttgagggg ttttttgctg aaaggaggaa ctatatccgg ate
[0038] SEQ ID NO: 29 is vector AompT-cure
[0039] ccgcgacagc gtctgccgca ttattcaaag cgatattcag cattactgga atetgegaat tgtcgccagt tcgctatgtt taagccccag cctgctcaaa aagaaattaa aaaacgaaaa taccagctat agecagattg tcacagagtg tegtatgegt tacgccgtac agatgttatt gatggataac aaaaatatca ctcaggtggc gcaattatgt ggctatagca gcacgtcgta ctttatctct gtttttaagg cgttttacgg cctgacaccg ttgaattatc tcgccaaaca gcgacaaaaa gtgatgtggt gaagggcaaa geggaaaegg ataagaeggg cataaatgag gaagaaatgg cgcgccctgc gaacgccaac taaaatttcc ccgaggtgaa aatcgccccg gggaataact agecatttea atgtaacaat taacccttaa aataaaccca gaaggttatt aactaaatca catagaaaac catcaattat agtatgtata aaataggega cagcaaccca attacaaatt aatggttcca gaatatcaca tcaaaaaaaa cgctgtataa tattataatt aacatgtaga caacttgtaa taaacattat cagtcaattg ttttgtttat tccatctgtg aegecgatta ttttctcaaa ataatgagat ggcgtgacac cataataatc tttaaatgea catatgaaat atgaagtact gttatagee
[0040] SEQ ID NO: 30 is vector yibD-fadD-GentR
aactgaataa ttgcttgttt ttaaagaaaa agaaacagcg gctggtccgc tgtttctgca ttcttacggt aaagataaaa ataaatagtg acgcgcttcg cgaatccatg tgggagttta ttcttgacac agatatttat gatataataa ctgagtaagc ttaacataag gaggaaaaac atatgttacg cagcagcaac gatgttacgc agcagggcag tcgccctaaa acaaagttag gtggctcaag tatgggcatc attegcacat gtaggctegg ccctgaccaa gtcaaatcca tgcgggctgc tcttgatctt ttcggtcgtg agttcggaga cgtagccacc tactcccaac ateagcegga ctccgattac ctegggaact tgetcegtag taagacattc ategegcttg ctgccttcga ecaagaageg gttgttggcg ctctcgcggc ttacgttctg cccaagtttg agcagccgcg tagtgagatc tatatctatg atetegcagt ctccggcgag caccggaggc agggcattgc caccgcgctc atcaatctcc tcaagcatga ggccaacgcg cttggtgctt atgtgatcta cgtgcaagca gattaeggtg acgatcccgc agtggctctc tatacaaagt tgggcatacg ggaagaagtg atgcactttg atatcgaccc aagtaccgcc acctatgccc aggcatcaaa taaaacgaaa ggctcagtcg aaagactggg cctttcgttt tatctgttgt ttgtcggtga acgctctcta ctagagtcac actggctcac cttcgggtgg gcctttctgc gtttatacac agctaacacc acgtcgtccc tatctgctgc cctaggtcta tgagtggttg ctggataacg tgcgtaattg tgetgatetc ttatatagct gctctcatta tctctctacc ctgaagtgac tctctcacct gtaaaaataa tatctcacag gcttaatagt ttcttaatac aaagcctgta aaacgtcagg ataacttcta tattcaggga gaccacaacg gtttccctct acaaataatt ttgtttaact ttcgtaaaga ggagaaatac tagttgaaga aggtttggct taaccgttat cccgcggacg ttccgacgga gatcaaccct gaccgttatc aatctctggt agatatgttt gagcagtcgg teg
[0041] SEQ ID NO: 31 is vector yibD-AfadE::CC FatBl-
ZeoR
atgtttttac atccactaca accatatcat cacaagtggt cagacctcct acaagtaagg ggcttttcgt tttactaaac tgaactttct geeggaatga cgctgatgcc acgaaagcta teggtaagtt tcggacgcca tteggtctta gcgcgcagca cttcgctacc tccttccagc tgcagcagat gttegcaaac cagacctgct tcactgctac cgcccgatac egtegtcagg ctctgtaaca cactatccat ggtacattca cgacgatatt cgatggtaaa gctactgata tgatggcttt cgaagatgct atctggcacg gtttccagaa tccagtcaac gtatttgatg ttgttgacat gttggttgat gtccaaatca ttccagcgcg gggtaagtcc cccttggata taatcggcgg tgctatcgtt caatttctgc ggttttttaa tttcctcatc tttcacggcc acgttgtcaa tgaaagcegg gecaatttea ccacgcactt cctccgggat tttagacaga egaegggtae gagtgttcat cataacgctc aggctcgtgc agegggtcag aatctccccc gtrttgcaat cacgcactaa gaaatcgtga cgacgcccgt tattgeegga cgcccctacc caacactcca cttcaactgt gtcgccccat geeggatage gctccacggc aacatgggta cgtttgacca cccaaataag ateaegctta gacatttcta acgtggtgcc aaaaccatct cccaggatac caacagattt ggcatggttg agtgccgcct cctgtaagtg gttcatgact gccacgatgc tagtactacg gtctgggccc acttcataag aacggatggc gaaggtgcgg cggaacacca gaecatgegg accgaaatgg tegtccagga gctgtggcgg atttggtttg ggtttccact ecagattegt ccactgcttt tccgccgcac taaaaatggt agtgataacc gcgaataaca tgctccaatc cggcagtttt ttaagggatt cggtgtagct aaatttggta ccgttgatca ttttcaggct ggtctgtgca ttgccggcac gtaactgtaa gtcagagcta cgcggtttca tcccacgtcc atcgcgagcc agcataactg ctttcatcga acaaaaagcg ctcgccaggg atgtggttgc catctagtat ttctcctctt tacgaaagtt aaacaaaatt atttgtagag ggaaaccgtt gtggtctccc tgaatataga agttatcctg aegttttaca ggctttgtat taagaaacta ttaagcctgt gagatattat ttttacaggt gagagagtca cttcagggta gagagataat gagagcagct atataagaga tcagcacaat tacgeaegtt atccagcaac cactcataga cctagggcag cagataggga cgacgtggtg ttagctgtgt tgacaattaa teateggcat agtatategg catagtataa tacgactcac tataggaggg ccatcatggc caagttgacc agtgccgttc cggtgctcac cgcgcgcgac gtegceggag eggtcgagtt ctggaccgac eggctegggt tctcccggga cttcgtggag gacgacttcg ccggtgtggt ccgggacgac gtgaccctgt tcatcagcgc ggtccaggac caggtggtgc cggacaacac cctggcctgg gtgtgggtgc gcggcctgga cgagctgtac gccgagtggt cggaggtcgt gtccacgaac ttccgggacg cctccgggcc ggccatgacc gagatcggcg agcagccgtg ggggcgggag ttcgccctgc gcgacccggc cggcaactgc gtgcactttg tggcagagga gcaggactga ggataagata acggagccga aaggctccgt ttctttatcc gctaattatt taaaattaaa gccatccgga tggttttc
[0042] SEQ IDNO : 32
gagaccacaa cggtttccct ctacaaataa ttttgtttaa ctttaaagag gagaaatact agatgcatca ccatcaccat cacatggcag atgaatcgga aaccgcggtt aaaccgccgg cgccgcccct tccgcagatg atggaaggta acggcaatgg gcatgagcat tgcagcgact gcgaaaacga ggaagataat tcgtataatc gtggtggact gtccccagcg aacgataccg gtgcaaaaaa aaagaagaaa aagcagaaaa agaaaaaaga gaaaggcagc gaaaccgata gcgctcaaga tcagccagtg aaaatgaact cgttgcctgc tgagcgtatc caagaaattc agaaggcaat tgaactgttt agcgtgggtc aaggcccagc caaaacgatg gaggaagcga gcaaacgttc gtatcagttc tgggatacgc aaccggtgcc gaagctcggt gaagtggtga atacgcacgg gcctgttgag ccggataagg acaatattcg tcaggagcca tatacgctgc ctcagggttt cacttgggac gccctggacc tgggtgaccg tggtgtgctg aaagaactgt acaccctgct taatgagaat tatgtagaag atgacgacaa catgttccgt tttgactata gcccggaatt cctgttatgg gcactccgtc cgccgggttg gctgccgcag tggcattgcg gtgtccgcgt agtttcgagc cgtaaactcg taggtttcat cagtgcaatc ccggccaaca ttcatatcta tgacaccgag aaaaaaatgg tagaaattaa cttcctgtgt gttcataaga agttgcgtag caaacgcgta gcgcctgtcc tcattcgtga aatcacgcgc cgcgtacatt tagaaggtat cttccaggca gtatatactg ctggcgtcgt gctcccaaaa ccggttggga cttgccgcta ttggcaccgc tctctgaatc cgcgtaagct gattgaagtt aaatttagcc atttgtcacg caacatgacc atgcagcgca ccatgaaact ttaccgtctg ccggaaaccc cgaaaactgc tggtttgcgc ccaatggaga cgaaagatat tcctgtcgtc catcagctgc tgacgcgtta tttaaaacag tttcacttaa ctcctgtcat gagccaggaa gaggttgaac attggtttta tccgcaagaa aacatcatcg acaccttcgt agtggagaat gcgaatggcg aagtcacgga ctttttatcc ttctatactt tgccgagcac catcatgaac catccgaccc ataaaagcct gaaggccgcg tactcatttt ataatgtcca cacgcagacc ccgttattgg atctgatgtc tgatgcgttg gtcctggcca aaatgaaagg tttcgacgtt tttaatgcgc tggacctgat ggagaacaaa acctttctgg aaaaattgaa attcggaatt ggcgatggta atctgcaata ctatctgtat aattggaaat gcccgtcgat gggtgcggaa aaagttggtc tggtactgca gtagtaagac gaattctcta gatatcgc
[0043] SEQ IDNO : 33 cagtccagtt acgctggagt ctgcccaggc atcaaataaa acgaaaggct cagtcgaaag actgggcctt tcgttttatc tgttgtttgt cggtgaacgc tctctactag agtcacactg gctcaccttc gggtgggcct ttctgcgttt atacacagct aacaccacgt cgtccctatc tgctgcccta ggtctatgag tggttgctgg ataacgtgcg taattgtgct gatctcttat atagctgctc tcattatctc tctaccctga agtgactctc tcacctgtaa aaataatatc tcacaggctt aatagtttct taatacaaag cctgtaaaac gtcaggataa cttctatatt cagggagacc acaacggttt ccctctacaa ataattttgt ttaactttta taaaatacta ttaaggagga tataatgtcg gacagtgaag tcaaccagga agcgaaaccg gaagtgaaac cggaagtcaa acctgaaacg cacattaatc tgaaagtcag cgatggttcc agtgaaatct tcttcaaaat taaaaaaact acgccgttac gtcgtttgat ggaagcattt gcgaaacgcc agggcaagga aatggattcc ctccgcttct tatatgacgg gattcgtatc caagcagacc aaaccccgga ggacctggac atggaagaca acgatattat tgaagcacat cgcgaacaga ttgggggcgg gaacgcagca gctgcgcgtc gccgtcgccg ctgcattacg ggggatgcac tggtcgcatt gcctgagggt gagagtgtgc gtattgcgga cattgtccct ggcgcgcgcc ccaactccga taacgcaatc gatctgaagg tcctggaccg ccacggcaat cccgtattag cagatcgttt attccattcg ggagaacatc cagtgtacac agtacgtact gtggaaggat tacgtgtcac cggaactgca aatcatccgc tgttgtgctt ggtagatgtt gcaggagtgc ctacactgtt gtggaaactg atcgacgaga tcaaaccagg cgattacgct gtaatccagc gtagtgcgtt ttcggtggac tgcgcgggtt ttgcgcgtgg caaacctgag ttcgccccta cgacttatac tgttggagtg cctggtctgg tccgtttttt agaagctcac catcgcgacc cagacgctca ggccatcgct gatgagttga cagacggtcg cttctattac gcaaaggtag cgagtgtaac agacgcaggg gtgcaacctg tctacagttt gcgtgttgac acagcggacc acgcatttat caccaatggc ttcgtctcgc atgcgacggg attgaccggg cttaactctg gattgactga aaatctctat tttcagggca tgtccccgat cctgggttac tggaaaatca aagggttagt gcagccaacc cgtctgttat tagaatacct ggaggaaaaa tacgaggaac acctgtacga gcgcgatgaa ggcgataaat ggcgcaataa aaaattcgaa ctcgggctgg aattcccaaa cttaccctat tatattgatg gagatgttaa attgacccag tctatggcaa tcattcgcta tattgcagat aaacataaca tgttgggcgg ctgtcctaag gagcgcgcgg aaattagtat gctggaaggc gcggtgctgg atatccgcta tggtgttagc cgcattgcgt actcgaaaga ttttgagacg ctcaaagttg attttctgag taaactgcct gaaatgttaa agatgtttga agatcgcttg tgtcacaaaa cgtatttaaa tggtgatcat gtcacccatc cagactttat gctgtatgat gcgcttgatg tggttttgta catggatccg atgtgcctgg atgcctttcc gaagctggtc tgtttcaaaa aacgcatcga ggctattccg caaatcgaca aatatctcaa atctagtaaa tacatcgcgt ggcctctgca gggctggcaa gcgacctttg gtgggggcga tcatccgcca aaataatgaa ctgaccattt aaatcatacc tgacc [0044] SEQ IDNO : 34
Χϋίΐ Xtiti Xtiti Xtiti X3.ii
[0045] SEQ IDNO : 35
MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKE MDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG Met Ser Asp Ser Glu Val Asn Gin
SEQ IDNO : 36
actgaccatt taaatcatac ctgacctcca tagcagaaag tcaaaagcct ccgaccggag gcttttgact tgatcggcac gtaagaggtt ccaactttca ccataatgaa ataagatcac taccgggcgt attttttgag ttatcgagat tttcaggagc taaggaagct aaaatgagcc atattcaacg ggaaacgtct tgctcgaggc cgcgattaaa ttccaacatg gatgctgatt tatatgggta taaatgggct cgcgataatg tcgggcaatc aggtgcgaca atctatcgat tgtatgggaa gcccgatgcg ccagagttgt ttctgaaaca tggcaaaggt agcgttgcca atgatgttac agatgagatg gtcaggctaa actggctgac ggaatttatg cctcttccga ccatcaagca ttttatccgt actcctgatg atgcatggtt actcaccact gcgatcccag ggaaaacagc attccaggta ttagaagaat atcctgattc aggtgaaaat attgttgatg cgctggcagt gttcctgcgc cggttgcatt cgattcctgt ttgtaattgt ccttttaacg gcgatcgcgt atttcgtctc gctcaggcgc aatcacgaat gaataacggt ttggttggtg cgagtgattt tgatgacgag cgtaatggct ggcctgttga acaagtctgg aaagaaatgc ataagctttt gccattctca ccggattcag tcgtcactca tggtgatttc tcacttgata accttatttt tgacgagggg aaattaatag gttgtattga tgttggacga gtcggaatcg cagaccgata ccaggatctt gccatcctat ggaactgcct cggtgagttt tctccttcat tacagaaacg gctttttcaa aaatatggta ttgataatcc tgatatgaat aaattgcagt ttcacttgat gctcgatgag tttttctaat gagggcccaa atgtaatcac ctggctcacc ttcgggtggg cctttctgcg ttgctggcgt ttttccatag gctccgcccc cctgacgagc atcacaaaaa tcgatgctca agtcagaggt ggcgaaaccc gacaggacta taaagatacc aggcgtttcc ccctggaagc tccctcgtgc gctctcctgt tccgaccctg ccgcttaccg gatacctgtc cgcctttctc ccttcgggaa gcgtggcgct ttctcatagc tcacgctgta ggtatctcag ttcggtgtag gtcgttcgct ccaagctggg ctgtgtgcac gaaccccccg ttcagcccga ccgctgcgcc ttatccggta actatcgtct tgagtccaac ccggtaagac acgacttatc gccactggca gcagccactg gtaacaggat tagcagagcg aggtatgtag gcggtgctac agagttcttg aagtggtggc ctaactacgg ctacactaga agaacagtat ttggtatctg cgctctgctg aagccagtta cctcggaaaa agagttggta gctcttgatc cggcaaacaa accaccgctg gtagcggtgg tttttttgtt tgcaagcagc agattacgcg cagaaaaaaa ggatctcaag aagatccttt gattttctac cgaagaaagg cccacccgtg aaggtgagcc agtgagttga ttgcagtcca gttacgctgg agtctgccca ggcatcaaat aaaacgaaag gctcagtcga aagactgggc ctttcgtttt atctgttgtt tgtcggtgaa cgctctctac tagagtcaca ctggctcacc ttcgggtggg cctttctgcg tttatacaca gctaacacca cgtcgtccct atctgctgcc ctaggtctat gagtggttgc tggataacgt gcgtaattgt gctgatctct tatatagctg ctctcattat ctctctaccc tgaagtgact ctctcacctg taaaaataat atctcacagg cttaatagtt tcttaataca aagcctgtaa aacgtcagga taacttctat attcagggag accacaacgg tttccctcta caaataattt tgtttaactt taaagaggag aaatactaga tgtcggacag tgaagtcaac caggaagcga aaccggaagt gaaaccggaa gtcaaacctg aaacgcacat taatctgaaa gtcagcgatg gttccagtga aatcttcttc aaaattaaaa aaactacgcc gttacgtcgt ttgatggaag catttgcgaa acgccagggc aaggaaatgg attccctccg cttcttatat gacgggattc gtatccaagc agaccaaacc ccggaagatc tggacatgga agacaacgat attattgaag cacatcgcga acagattggg ggcgggaacg cagcatctgc gcgccgcgaa aatctctatt ttcagggcat gtccccgatc ctgggttact ggaaaatcaa agggttagtg cagccaaccc gtctgttatt agaatacctg gaggaaaaat acgaggaaca cctgtacgag cgcgatgaag gcgataaatg gcgcaataaa aaattcgaac tcgggctgga attcccaaac ttaccctatt atattgatgg agatgttaaa ttgacccagt ctatggcaat cattcgctat attgcagata aacataacat gttgggcggc tgtcctaagg agcgcgcgga aattagtatg ctggaaggcg cggtgctgga tatccgctat ggtgttagcc gcattgcgta ctcgaaagat tttgagacgc tcaaagttga ttttctgagt aaactgcctg aaatgttaaa gatgtttgaa gatcgcttgt gtcacaaaac gtatttaaat ggtgatcatg tcacccatcc agactttatg ctgtatgatg cgcttgatgt ggttttgtac atggatccga tgtgcctgga tgcctttccg aagctggtct gtttcaaaaa acgcatcgag gctattccgc aaatcgacaa atatctcaaa tctagtaaat acatcgcgtg gcctctgcag ggctggcaag cgacctttgg tgggggcgat catccgccaa aatgataatc gcgcaaaaaa ccccgcttcg gcggggtttt ttcgcacgtc tccatcgctt gcccaagttg tgaagcacag ctaacaccac gtcgtcccta tctgctgccc taggtctatg agtggttgct ggataacgcc acggaaatca ataacctgaa gatatgtgcg acgagctttt cataaatctg tcataaatct gacgcataat gacgtcgcat taatgatcgc aacctattta ttatattcag ggagaccaca acggtttccc tctacaaata attttgttta actttgcttc aatctaaatt agtaaggagg tagtcaatga caaatcctgg tgtaagtgcc tggcaagtta ataccgcata taccgctggg cagttagtca cttataacgg caagacctac aagtgcttgc agcctcacac atccttggca ggttgggaac cgtccaatgt acccgccctt tggcaacttc agggctctgc cggtagtgcg gcgggttccg gtgaatttaa ctcgttgcct gctgagcgta tccaagaaat tcagaaggca attgaactgt ttagcgtggg tcaaggccca gccaaaacga tggaggaagc gagcaaacgt tcgtatcagt tctgggatac gcaaccggtg ccgaagctcg gtgaagtggt gaatacgcac gggcctgttg agccggataa ggacaatatt cgtcaggagc catatacgct gcctcagggt ttcacttggg acgccctgga cctgggtgac cgtggtgtgc tgaaagaact gtacaccctg cttaatgaga attatgtaga agatgacgac aacatgttcc gttttgacta tagcccggaa ttcctgttat gggcactccg tccgccgggt tggctgccgc agtggcattg cggtgtccgc gtagtttcga gccgtaaact cgtaggtttc atcagtgcaa tcccggccaa cattcatatc tatgacaccg agaaaaaaat ggtagaaatt aacttcctgt gtgttcataa gaagttgcgt agcaaacgcg tagcgcctgt cctcattcgt gaaatcacgc gccgcgtaca tttagaaggt atcttccagg cagtatatac tgctggcgtc gtgctcccaa aaccggttgg gacttgccgc tattggcacc gctctctgaa tccgcgtaag ctgattgaag ttaaatttag ccatttgtca cgcaacatga ccatgcagcg caccatgaaa ctttaccgtc tgccggaaac cccgaaaact gctggtttgc gcccaatgga gacgaaagat attcctgtcg tccatcagct gctgacgcgt tatttaaaac agtttcactt aactcctgtc atgagccagg aagaggttga acattggttt tatccgcaag aaaacatcat cgacaccttc gtagtggaga atgcgaatgg cgaagtcacg gactttttat ccttctatac tttgccgagc accatcatga accatccgac ccataaaagc ctgaaggccg cgtactcatt ttataatgtc cacacgcaga ccccgttatt ggatctgatg tctgatgcgt tggtcctggc caaaatgaaa ggtttcgacg tttttaatgc gctggacctg atggagaaca aaacctttct ggaaaaattg aaattcggaa ttggcgatgg taatctgcaa tactatctgt ataattggaa atgcccgtcg atgggtgcgg aaaaagttgg tctggtactg cagtagtaa
[0046] SEQ IDNO : 37:
GNAAAARR
BRIEF DESCRIPTION OF THE DRAWINGS
[0047] FIG. 1 is a schematic depicting some of the embodiments of the in vivo protein N- acylation through dynamic metabolic control of acyl-CoA biosynthesis.
[0048] FIG. 2 is a SDS-PAGE of purified samples (C-terminally purified GST) expressed in strains with or without expression of ulpl hydrolase and with or without a N-terminal SUMO- tag. [0049] FIG. 3 is a schematic depicting an embodiment of the in vivo protein N-acylation through dynamic acyl-CoA production in a myristoyl-CoA producing strain.
[0050] FIG. 4 shows improved Myristoyl-CoA (Myr-CoA) synthesis in genetically modified E. coli strains expressing an inducible thioesterase (TE), expressing an acyl CoA synthetase, and comprising mitigation of acyl CoA degradation before inductiongray) and 24 hours after induction (black).
[0051] FIG. 5 depicts MALDI (matrix-assisted laser desorption/ionization) spectra of purified processed protein (SUMO tag cleaved) with or without co-expression of the hNMT (human N-myristoltransferase-1).
[0052]
FIG. 6 depicts M depicts MALDI (matrix-assisted laser desorption/ionization) spectra of purified processed protein (SUMO tag cleaved) with or without co-expression of the hNMT (human N-myristoltransferase- 1) on a single plasmid or constructDET AILED DESCRIPTION
[0053] The present application is directed to a genetically modified organism, e.g., modified E. coli, and a corresponding fermentation process that may provide, for example, single pot, facile, commercially relevant production of N-terminally fatty acylated proteins and peptides, based on in vivo N-terminal acylation. A combination of expression vectors and metabolic engineering approaches may provide the production and activation of substrates for protein acylation or lipidation. This may include, for example, one or more of: (1) the expression of a target protein to be acylated and subsequent modification to expose a fatty acylation substrate, (2) in vivo generation of fatty acids and activation into corresponding fatty acyl-CoAs and (3) expression of an acyl transferase that may catalyze the acylation reaction.
[0054] A genetically modified microorganism may include a first gene encoding a acyl transferase, a second gene encoding a peptide or protein to by acylated, a third gene encoding a enzyme to remove a N-terminal tag from the second gene, a gene encoding a homologous acyl- CoA synthase, a gene encoding a heterologous acyl-CoA thioesterase, and deletion of a gene that mitigates degradation of acyl-CoA.
[0055] An exemplary embodiment is shown in FIG. 1, where (1) a target peptide for acylation may be encoded by a gene that may also encode a N-terminal tag and substrate and a C-terminal tag. The encoded gene may be represented as, for example SUMO-peptide- Glutathione S-transferase (GST). The protein target may be encoded by a gene that may be heterologously expressed in the genetically modified microorganism. For example, the target protein may be cloned into vector pNAP-1 (N-terminal acylation of proteins) bearing a high copy ColEl origin of replication and a kanamycin resistance marker. Such a vector may include, e.g., the low phosphate inducible E. coli yibD gene promoter operatively linked to the gene encoding SUMO-peptide-GST. The vector may also include a ribosomal binding site, e.g., to drive target protein expression. The ribosomal binding site may be optimized to drive target protein expression. A N-terminal SUMO tag, cleavable with ulpl hydrolase from Saccharomyces cerevisiae, may also be included to enhance expression. In addition to increasing expression, the SUMO tag may function as a cleavage moiety to reveal a N-terminal recognition sequence, e.g., GNAAAARR (SEQ ID NO: 36). Such a sequence may be a substrate for an acyl transferase such as human N-myristol transferase- 1 (hNMT-1) to provide N-acylation of the protein. For example, the target peptide may be operatively linked to a C-terminal tag such as GST to provide, for example, protein purification and quantification. Any peptide or protein may be the N-acylation target of interest and may be cloned into the SUMO-peptide-GST gene. Other suitable recognition sequences may be used.
[0056] As shown in FIG. 1, (3) a fatty acyl transferase may also be heterologously expressed in the genetically modified microorganism. For example, plasmid pCDF-hNMT-1, derived from pCDF-lb, contains the gene for human N-myristoyl transferase 1 (hNMT-1), with an 80 amino acid deletion to improve myristoylation. The vector plasmid may also bear, for example, the high copy CloDF13 origin and a spectinomycin resistance cassette. The vector plasmid may be constructed with the yibD gene promoter operatively linked to the acyl transferase gene to drive hNMT-1 expression upon phosphate depletion.
[0057] Also shown in FIG. 1 is (2) the generation of fatty acids and corresponding activation into fatty acyl-CoAs. Such fatty acyl-CoAs may be metabolically engineered for increased and/or inducible production and accumulation of the fatty acyl-CoAs. A system such as that described in FIG. 1 shows a genetically modified microorganism that may provide one or more of: a target protein or peptide to be N-acylated; an enzyme to acylate the target peptide or protein; and a fatty acyl CoA source for use by the acylating enzyme in vivo, e.g., without the need for exogenously added fatty acids.
[0058] FIG. 3 shows an exemplary embodiment of the genetically modified microorganism to provide inducible accumulation production of fatty acyl CoA. Inducible fatty acyl-CoA production may be accomplished, e.g., by (iii) deleting a native fadE gene from the E. coli chromosome, and (i) replacing the deleted native gene with, e.g., an inducible acyl-ACP thioesterase from Cinnamomum camphorum with a preference for myristoyl (C 14 acyl) substrates. Together these modifications mitigate fatty acyl-CoA beta oxidation and provide the conversion of biosynthetic fatty acyl-ACPs into intracellular free fatty acids. Additionally or alternatively, (ii) the native E. coli fadD gene encoding a fatty acyl-CoA synthetase is induced by replacement of the native promoter with the low phosphate inducible yibD gene promoter. Acyl transferase
[0059] The genetically modified microorganisms described herein may include a first gene that encodes an acyl transferase. This acyl transferase may catalyze the N-acylation of a target protein or peptide (3). The first gene may encode a Cg-Cig acyl transferase.
[0060] As exemplified in FIG. 1, the acyl transferase may be, e.g., human N-myristoyl transferase. In various embodiments, any acyl transferase that may recognize a target to be acylated and an acyl-CoA may be suitable. For example, acyl transferases that recognize a N- terminal tag or substrate may be used in some embodiments. Acyl transferases may be target protein sequence or acyl-CoA specific. N-Myristoyl transferase, a palmitoyl transferase, any C 8 - Ci 8 transferase, and N-myristoyl transferases may be encompassed as embodiments of the acyl transferase of the invention.
[0061] The following Examples of suitable glycylpeptide N-tetradecanoyltransferase proteins may be used as the acyl transferase in an embodiment of the genetically modified microorganism may include one or more of (by Uniprot number): P30419, P14743, Q9LTR9, P30418, 070310, P31717, Q8TFN1, 061613, 043010, Q8K1Q0, 074234, Q9UVX3, Q75EK2, A7YT82, Q5RAF3, Q4I061, Q6CMK4, Q7S3C8, Q6C7G2, Q6BJF4, Q4PB56, Q553B6, P34809, P34763, P0CP20, and Q81LW6.
Modification of acyl-CoA substrate specificity for acyl transfer reaction
[0062] Any Cg-Cig acyl-CoAs may be recognized by a N-acyl transferase with modified substrate specificity. For example, mutating acyl-CoA binding site (amino acids 30-50, 100- 110, 160-210, or 420-430) of yeast N-myristoyltransferase may be used to alter substrate specificity. Likewise, mutating the residues of the acyl-CoA binding site (amino acids 240-290) of human N-myristoyltransferase 1 may alter substrate specificity. Suitable wild-type enzymes exist that are known to react with acyl-CoAs other than myristoyl-CoA.
[0063] N-terminal acylation of peptides or proteins
[0064] The genetically modified microorganisms described herein may include a second gene that encodes a peptide or protein. This peptide or protein may be (i) the target protein to be N-acylated. In some embodiments, prior to acylation, the peptide or protein may be subject to a modification of the peptide or protein to expose a fatty acylation substrate.Any heterologous gene encoding a peptide of protein of interest may be used with the present invention. Similarly, any homologous gene, for example, those modified to be operatively connected to an inducible promoter may also be suitable acylation peptide or protein targets.
[0065] Suitable peptide and protein substrates for acylation, such as existing therapeutic peptides or proteins or peptides or proteins of potential therapeutic value may include, e.g., one or more of: somatotropin (Uniprot# P01241), glucagon (Uniprot# P01275), insulin (Uniprot# P01308), fibroblast growth factor 21 (Uniprot# Q9NSA1), fibroblast growth factor 1 ( (Uniprot# P05230), fibroblast growth factor 2 (Uniprot# P09038), fibroblast growth factor 7 (Uniprot# P21781), fibroblast growth factor 18 (Uniprot# 076093), fibroblast growth factor 19 (Uniprot# 095750), enkephalin (Uniprot# P01210), galanin (Uniprot# P22466), gastric inhibitory peptide (Uniprot# P09681), pancreatic prohormone (Uniprot# P01298), calcitonin (Uniprot# P01258), neuropeptide W (Uniprot# Q8N729), neuropeptide Y (Uniprot# P01303), hirudin (Uniprot# P01050), coagulation factor VIII (Uniprot# P00451), coagulation factor IX (Uniprot# P00740), tissue plasminogen activator (Uniprot# P00750), follicle-stimulating hormone (Uniprot# P01215), erythropoietin (Uniprot# P01588), granulocyte colony-stimulating factor (Uniprot# P09919), interferon (Uniprot# P01563), and asparaginase (Uniprot# P06608).
Modification of peptide substrate specificity for acyl transfer reaction
[0066] In some embodiments, a tag and/or a substrate may be added to the N-terminus of the target peptide or protein. For example, the vector pNAP-l(N-terminal acylation of proteins), or an equivalent vector, may include a gene encoding at least one tag-substrate-peptide.
The acyltransferase substrate
[0067] The peptide substrate for the acyl N-terminal transfer reaction may include peptides with the sequence X1X2X3X4X5X6X7X8 (SEQ ID NO: 34) where Xi may be glycine, X 2 and X 5 may be small uncharged residues, e.g., other than proline; Χβ may be any residue, e.g., other than proline and X 3 , X 4 , X7 and Xg may be any residues. Specificity may be broadened using N- acyl transferases corresponding mutations as described above for acyl substrate specificity modification.
The substrate for fatty acylation may be, for example, a naturally occurring sequence found inherently in the peptide of protein encoded by the second gene. The substrate may be a naturally occurring sequence represented by an oligonucleotide operatively linked to the second gene encoding a peptide or protein to be acylated. When cloned in this manner, the resultant expression product is a peptide or protein with an acylation substrate at the N-terminus. The substrate may also encode a heterologous substrate. Using a protease to expose a N-terminal peptide substrate for the acyl transfer reaction
[0068] In another embodiment, a protease, e.g., a protein naturally occurring in the microorganism, or an expressed heterologous protease may be used to prepare the N-terminus of the target protein or peptide for the N-terminal acylation reaction.
[0069] For example, a microorganism may be used that encodes a native or heterologous methionine aminopeptidase, for example E coli methionine aminopeptidase or human methionine aminopeptidase (Uniprot # P0AE18 and P50579, respectively) to remove a methionine when the following amino acid may be, for example, alanine, glycine, serine, threonine, asparagine, aspartate, isoleucine, proline, valine or leucine.
N-terminal tag
[0070] In an exemplary embodiment, the genetically modified microorganism may encode a ubiquitin-like-specific protease such as ubiquitin-like-protease 1 (Uniprot # Q02724). Ubiquitin-like protease 1 is able to remove a N-terminal peptide sequence such as a SUMO tag with sequence MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKE MDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG (SEQ ID NO: 35). In yet other exemplary embodiments,the starting amino acid on the peptide or protein substrate may exclude proline.
In some embodiments, a first oligonucleotide encoding a N-terminal protein tag may be operatively linked to the second gene so that upon expression of the second gene, a N-terminal protein tag may be linked to a peptide or protein encoded by the second gene. For example, the N-terminal tag may be a SUMO tag, a FLAG (octapeptide), a TRx (thioredoxin), a TAP (tandem affinity purification tag), a Lucy tag (fluorescent protein), and the like. Any appropriate cleavable N-terminal tag may be operatively linked to the N-acylation target peptide or protein. Further, the genetically modified microorganism may naturally endode a protease for removal of the N-terminal tag. Additionally or alternatively, a heterologously expressed protease may be expressed by a genetically modified microorganism. The protease may be, for example, an enterokinase, a TEV (tobacco etch virus), a thrombin, a GST-protease fusion protein, another substrate specific protease, and the like.C-terminal protein tags
[0071] A suitable, cleavable C-terminal protein tag may aid in the purification or expression of the acylation target peptide or protein. For example, glutathione S -transferase may be found in the gene for expression of the acylation target protein or peptide as shown in FIG. 1. Suitable C-tags may be substituted for GST including, for example, a maltose binding protein, calmodulin binding peptide, his-patch thiofusion, tap affinity purification, epitope tags, reporter tags such as alkaline phosphatase, modified haloalkane dehalogenase, SUMO, serine proteinase such as subtilisin, post-synaptic density protein, streptavidin/biotin-based tags, chitin binding domain tag, and polyhistidine.
Inducible production and accumulation of Acyl-CoA
[0072] The production and accumulation of at least one acyl-CoA compared to the corresponding native microorganism may be brought about, e.g., by one or more of: inducing expression of a homologous acyl-CoA synthase; expressing a heterologous acyl-CoA thioesterase; and mitigating degradation of the acyl-CoA.
Acyl-CoA thioesterase expression
[0073] Acyl-CoAs of different lengths, e.g., Cg-Cig acyl groups such as C 8 , C 10 , C 12 , C 14 , Ci 6 , and C 18 may be biosynthesized by varying the gene encoding the acyl-acp thioesterase. Table 1 summarizes examples of different acyl-acp thioesterases.
Table 1
EER87824 C14
EER88593 C14
GE3ESU6 C14
GE3ESU8 C16
GE3ESU7 C14
CAH09236 C12/C14
ABR43801 C14
AA077182 C14
ABG82470 C8
EEG55387 C14
EET81 1 13 C8
Cuphea leptopoda C10
Fatb2
EH 147208.1 C18
Q39513 C16
G3ESU9 C8
G3ESV0 C14
G3ESV1 C14
AAD42220 C14
EDQ65090 C14
EER98252 C18
EES 1 1822 C14
EEH52851 C14
ACL08376 C8
EDV77528 C12
BAH81730 C14
ABJ63754 C8
CAD883310 C8
EEI82584 C8
CAE80300 C8
ABN54268 C14
Q39554 C14
Q9SQI3 C16
[0074] In some embodiments, a heterologous thioesterase may lead to increased fatty acid production. For example, a genetically modified microorganism with a heterologous thioesterase such as C. camphora acyl-ACP thioesterase may increase myristic acid production via cleavage of myristate from myristotyl-ACP. Further, for example, the level of myristic acid produced mayt be increased by alleviating the inhibition of ACCase by acyl-ACPs (FIG. 3). A thioester of any substrate specificity may be used. Further, the substrate specificity of a known thioester may be modified. Any thioesters that would generally lead to the overproduction of a fatty acyl chain that is 8 to 18 carbons in length, e.g., Cg-Cig acyl groups such as C 8 , C 10 , C 12 , CM, Ci 6 , and C 18I may be used in the genetically modified organism as part of the modified acyl- CoA biosynthetic pathway. Acyl-CoA synthase
[0075] Fatty acids overproduced by the action of the thioesterasemay be activated by native or heterologous acyl-CoA synthase such as E. coli acyl-CoA synthase (encoded by fadD) with native or modified substrate specificity. For example, mutations on amino acid residues (4, 5, 9, 338, 372, 376, 447, 451) of fadD have been described as resulting in modified substrate specificity.
[0076] The acyl-CoA synthase may be encoded by a heterologous gene or by overexpression of the fadD (acyl-CoA synthetase) may occur by replacing the native promoter for the low phosphate inducible yibD gene promoter that results in accumulation of myristoyl-CoA. Accordingly, expression of the enzyme may occur under the fermentation conditions of low phosphate.
[0077] The thioesterase and acyl-Co synthase genes may be expressed on exogenous DNA or chromosomally.
Mitigation of acyl-CoA degradation
A third component of the modified acyl-CoA biosynthetic pathway of a genetically modified organism may include deletion the fadE gene. Deletion may mitigate or eliminate the beta oxidative pathway of acyl-CoAs, making the acyl-CoAs available for peptide acylation.
[0078] In various embodiments, a genetically modified microorganism is provided. The genetically modified microorganism may include a first gene that encodes an acyl transferase. The genetically modified microorganism may include a second gene that encodes a peptide or protein. One or both of the first and second gene may be heterologous with respect to a corresponding native microorganism. The genetically modified microorganism may include a modified acyl-CoA biosynthetic pathway. Compared to a native acyl-Co A biosynthetic pathway in the native microorganism, the modified acyl-CoA biosynthetic pathway may be configured for one or more of: inducible biosynthesis of an acyl-CoA and over-accumulation of the acyl- CoA. The genetically modified microorganism may be effective upon fermentation to cause acylation of the peptide or protein by the acyl transferase using the acyl-CoA to provide a N- acylated peptide or protein product. The genetically modified organism may be employed in any method described herein. The genetically modified organism may be employed to produce any N-acylated peptide or protein described herein.
[0079] In some embodiments, the genetically modified microorganism may be characterized by inducible production of one or more of: the acyl transferase encoded by the first gene, the peptide or protein encoded by the second gene, and the acyl-CoA. For example, the genetically modified microorganism may include a yibD or ugpB gene promoter. The yibD gene promoter may be operatively linked to one or more of, e.g. : the first gene; the second gene; and at least one modified acyl-CoA biosynthetic pathway gene corresponding to the modified acyl-CoA biosynthetic pathway. One or more of the first, second, and the at least one modified acyl-CoA biosynthetic pathway gene gene may be inducible by phosphate depletion of the fermentation medium.
[0080] In several embodiments, the first gene may encode a Cg-Cig acyl transferase, e.g., one of C 8 , Cio, C 12 , CM, C 16 , and C 18 . The first gene may encode a human acyl transferase. The first gene may encode, e.g., human N-myristoyl transferase 1. The first gene may encode one of a myristoyl transferase, a palmitoyl transferase, a N-myristoyl tranferase, and a glycylpeptide N- tetradecanoyl transferase. The first gene may encode a glycylpeptide N-tetradecanoyl transferase. The transferase, e.g., the glycylpeptide N-tetradecanoyl transferase, may include a mutation in an acyl-CoA binding site. The transferase, e.g., the glycylpeptide N-tetradecanoyl transferase, glycylpeptide N-tetradecanoyl transferase, may be characterized by a modified acyl- CoA substrate specificity corresponding to the mutation. An example of the first gene may include SEQ. ID NO. 32.
[0081] In various embodiments, the second gene may encode, e.g., one of: somatotropin, glucagon, insulin, fibroblast growth factor 21, fibroblast growth factor 1, fibroblast growth factor 2, fibroblast growth factor 7, fibroblast growth factor 18, fibroblast growth factor 19, enkephalin, galanin, gastric inhibitory peptide, pancreatic prohormone, calcitonin, neuropeptide W, neuropeptide Y, hirudin, coagulation factor VIII, coagulation factor IX, tissue plasminogen activator, follicle-stimulating hormone, erythropoietin, granulocyte colony-stimulating factor, interferon, and asparaginase. The second gene may encode a human peptide or protein. An example of the second gene may include SEQ. ID NO. 33.
[0082] In some embodiments, the genetically modified microorganism may include a first oligonucleotide that encodes a protein tag. The protein tag may be one or more of: a SUMO tag, a FLAG (octapeptide), a TRx (thioredoxin), a TAP (tandem affinity purification tag), a fluorescent protein . The first oligonucleotide may be operatively linked to the second gene so that expression using the first oligonucleotide and the second gene may result in a product that may include the protein tag operatively linked to the N-terminus of the peptide or protein. The genetically modified microorganism may include a third gene. The third gene may encode a cleaving enzyme configured to cleave the protein tag from the peptide or protein. The third gene may be one or more of heterologous with respect to the native microorganism and inducible. The third gene may encode the cleaving enzyme including one of: ulpl, enterokinase, a TEV (tobacco etch virus), a thrombin, GST-protease fusion protein, another substrate specific protease, and the like. An example of the third gene may include SEQ. ID NO. 28.
[0083] In several embodiments, the genetically modified microorganism may include a second oligonucleotide that may encodes a C-terminal tag. The second oligonucleotide may be operatively linked to the second gene so that expression using the second oligonucleotide and the second gene may result in a product that may include the C-terminal tag and the peptide or protein. The C-terminal tag may be, for example, one of: a glutathione S-transferase, a maltose binding protein, a calmodulin binding peptide, a his-patch thiofusion, a tap affinity purification tag, an epitope tag, a reporter tag such as alkaline phosphatase, a modified haloalkane dehalogenase, SUMO, a serine proteinase such as subtilisin, a post-synaptic density protein, a streptavidin/biotin-based tag, a chitin binding domain tag, and a polyhistidine. [0084] In various embodiments, the genetically modified microorganism may include a third oligonucleotide that encodes a substrate. The third oligonucleotide may be operatively linked to the first oligonucleotide and the second gene so that expression using the first oligonucleotide, the third oligonucleotide, and the second gene produces a product that may include the protein tag, the substrate, and the peptide or protein. The substrate may be, for example, a substrate for a glycylpeptide N-tetradecanoyltransferase. An example of the substrate encoded by the third oligonucleotide may include SEQ. ID NOS. 36.
[0085] In some embodiments, the genetically modified microorganism may include a fourth oligonucleotide that may encode, e.g., a methionine aminopeptidase sensitive protease tag. The fourth oligonucleotide may be operatively linked to the second gene so that expression using the fourth oligonucleotide and the second gene may produce a product that may include the methionine aminopeptidase sensitive protease tag operatively linked to the N-terminus of the peptide or protein. The genetically modified microorganism may include a third gene that encodes, e.g., a cleaving enzyme. The cleaving enzyme may be configured to cleave the methionine aminopeptidase sensitive protease tag from the peptide or protein. The third gene may be homologous or heterologous. The third gene may be inducible.
[0086] In several embodiments, the modified acyl-CoA biosynthetic pathway may be configured to induce expression of a homologous acyl-CoA synthase. The modified acyl-CoA biosynthetic pathway may be configured to express a heterologous acyl-CoA thioesterase. The modified acyl-CoA biosynthetic pathway may be configured to mitigate degradation of the acyl- CoA. The genetically modified microorganism may include, for example, deletion of a gene corresponding to an acyl-CoA degradation pathway of the corresponding native microorganism. Deletion of the gene may be effective to mitigate degradation of the acyl-CoA. The gene may encode, for example, fadE.
[0087] In various embodiments, the genetically modified microorganism may include an inducible promoter. The inducible promoter may be effective to induce expression of the homologous acyl-CoA synthase. The inducible promoter may be, for example, a yibD gene promoter configured to induce expression of the homologous acyl-CoA synthase in the presence of phosphate depletion of a fermentation medium. For example, the expression of the heterologous acyl-CoA thioesterase may be inducible. The genetically modified microorganism may include a a yibD gene promoter operatively linked to a gene for the heterologous acyl-CoA thioesterase effective to induce expression of the heterologous acyl-CoA thioesterase, e.g., in the presence of phosphate depletion of a fermentation medium. The heterologous acyl-CoA thioesterase may be selected for a preference for myristoyl substrates. The heterologous acyl- CoA thioesterase may be, for example, derived from Cinnctmomum cctmphorum. In some embodiments, the microorganism may be configured to induce expression of the homologous acyl-CoA synthase, to express the heterologous acyl-CoA thioesterase, and to mitigate degradation of the acyl-CoA.
[0088] In various embodiments, a method of in vivo acylation of a target peptide or protein in a genetically modified microorganism is provided. The method may include expressing an acyl transferase encoded by a first gene. The method may include expressing a peptide or protein encoded by a second gene. One or both of the first and second gene may be heterologous compared to a corresponding native microorganism. The method may include producing an acyl-CoA using a modified acyl-CoA biosynthetic pathway. The method may include fermenting the microorganism under conditions effective to cause acylation of the peptide or protein by the acyl transferase using the acyl-CoA to provide a N-acylated peptide or protein product.
[0089] In some embodiments, the method may include inducing one or more of: the expression of the acyl transferase; the expression of the peptide or protein, and the synthesis of the acyl-CoA. The inducing may include auto-inducing by phosphate depletion of the microorganism medium. The method may include causing acylation of the peptide or protein using a Cg-Cig acyl transferase, e.g., one of C 8 , C 10 , C 12 , CM, C 16 , and C 18 . The method may include causing acylation of the peptide or protein using a human acyl transferase. The method may include causing acylation of the peptide or protein using human N-myristoyl transferase 1. The method may include causing acylation of the peptide or protein using one of a myristoyl transferase, a palmitoyl transferase, a N-myristoyl transferase, a glycylpeptide N-tetradecanoyl transferase, and a glycylpeptide N-tetradecanoyl transferase. The transferase, e.g. the glycylpeptide N-tetradecanoyl transferase, may include a mutation in an acyl-CoA binding site.
[0090] In several embodiments, the method may include expressing the second gene encoding a human peptide or protein. The second gene may, for example, encode one of: somatotropin, glucagon, insulin, fibroblast growth factor 21, fibroblast growth factor 1, fibroblast growth factor 2, fibroblast growth factor 7, fibroblast growth factor 18, fibroblast growth factor 19, enkephalin, galanin, gastric inhibitory peptide, pancreatic prohormone, calcitonin, neuropeptide W, neuropeptide Y, hirudin, coagulation factor VIII, coagulation factor IX, tissue plasminogen activator, follicle-stimulating hormone, erythropoietin, granulocyte colony-stimulating factor, interferon, and asparaginase.
[0091] In various embodiments, the method may include expressing a protein tag operatively linked to the N-terminus of the peptide or protein. The method may include expressing a cleaving enzyme under conditions effective to cleave the protein tag from the peptide or protein. The method may include expressing the protein tag as one of: a SUMO tag, a FLAG (octapeptide), a TRx (thioredoxin), a TAP (tandem affinity purification tag), and a fluorescent protein. The method may include expressing the cleaving enzyme as one of: ulpl, enterokinase, a TEV (tobacco etch virus), a thrombin, a GST-protease fusion protein (e.g., a fusion protein of glutathione S-transferase and recombinant human rhinovirus (HRV 3C) protease, such as PRESCISSION™, GE Healthcare Bio-Sciences AB, Uppsala, Sweden), another substrate specific protease, and the like.
. The method may include expressing a C-terminal tag operatively linked to the peptide or protein such that fermenting the microorganism under conditions may be effective to cause acylationto provide the N-acylated peptide or protein product including the C-terminal tag. The method may include purifying the N-acylated peptide or protein product using the C-terminal tag. The C-terminal tag may be, for example, one of: a glutathione S -transferase, a maltose binding protein, a calmodulin binding peptide, an his-patch thiofusion, a tap affinity purification tag, an epitope tag, a reporter tag such as alkaline phosphatase, a modified haloalkane dehalogenase, SUMO, a serine proteinase such as subtilisin, a post-synaptic density protein, a streptavidin/biotin-based tag, a chitin binding domain tag, and a polyhistidine.
[0092] In some embodiments, the method may include expressing a methionine aminopeptidase sensitive protease tag operatively linked to the N-terminus of the peptide or protein. The method may include expressing a cleaving enzyme. The method may include cleaving the methionine aminopeptidase sensitive protease tag from the N-terminus of the peptide or protein. The method may include expressing a substrate operatively linked between the protein tag and the peptide or protein to produce a product including the protein tag, the substrate, and the peptide or protein. The substrate may be a substrate for a transferase, e.g., a glycylpeptide N-tetradecanoyltransferase.
[0093] In several embodiments, the modified acyl-CoA biosynthetic pathway may include deletion of a gene that encodes fadE. The method may include synthesizing the acyl-CoA using the modified acyl-CoA biosynthetic pathway. The modified acyl-CoA biosynthetic pathway may include inducing expression of a homologous acyl-CoA synthase. The modified acyl-CoA biosynthetic pathway may include expressing a heterologous acyl-CoA thioesterase. The modified acyl-CoA biosynthetic pathway may include inducing expression of the heterologous acyl-CoA thioesterase. The modified acyl-CoA biosynthetic pathway may include mitigating degradation of the acyl-CoA. The heterologous acyl-CoA thioesterase may include a preference for myristoyl substrates. For example, the heterologous acyl-CoA thioesterase may be derived from Cinnamomum camphorum. The method may include inducing expression of the homologous acyl-CoA synthase, inducing expression of the heterologous acyl-CoA thioesterase, and mitigating degradation of the acyl-CoA.
[0094] In various embodiments, a N-acylated therapeutic peptide or protein is provided. The N-acylated therapeutic peptide or protein may be produced by fermentation of any aspect of the genetically modified microorganism as described herein. The N-acylated therapeutic peptide or protein may be produced by any of the methods described herein.
[0095] In some embodiments, the N-acylated therapeutic peptide or protein may include a N-acylated human peptide or protein. The N-acylated therapeutic peptide or protein may correspond to N-acylation of one of: somatotropin, glucagon, insulin, fibroblast growth factor 21 , fibroblast growth factor 1 , fibroblast growth factor 2, fibroblast growth factor 7, fibroblast growth factor 18, fibroblast growth factor 19, enkephalin, galanin, gastric inhibitory peptide, pancreatic prohormone, calcitonin, neuropeptide W, neuropeptide Y, hirudin, coagulation factor VIII, coagulation factor IX, tissue plasminogen activator, follicle-stimulating hormone, erythropoietin, granulocyte colony-stimulating factor, interferon, and asparaginase. The N- acylated therapeutic peptide or protein may correspond to N-acylation with one of a myristoyl group and a palmitoyl group.
[0096] In various embodiments, a gene or plasmid construct is provided. The gene or plasmid construct may include any gene or oligonucleotide described herein, or any gene or oligonucleotide for any protein, peptide, enzyme, tag, or other expression product described herein. The gene or plasmid construct may include, for example, one or more of: SEQ ID NO: 28, 30, 31 , 32, 33, and 36.
EXAMPLES
[0097] The production of an exemplary genetically modified organism embodiment may now be described in the form of examples. While the embodiments may be described in considerable detail, it is not the intention to restrict or in any way limit the scope of the appended claims to such detail, or to any particular embodiment. Materials & Methods
[0098] Unless otherwise stated, all materials and reagents were of the highest grade possible and purchased from Sigma (St. Louis, MO). Luria Broth was used for routine strain and plasmid propagation and construction. Working antibiotic concentrations were as follows: kanamycin (35μg/mL), chloramphenicol (Cm. 35μg/mL), spectinomycin (Sp. lOC^g/mL), zeocin (Zeo. 50 μg/mL), gentamicin (Gent. lC^g/mL), blasticidin (Bsd. lOC^g/mL), tetracycline (Tet. 5μg/mL). Luria broth with low salt (Lennox formulation) was used to select for zeocin and blasticidin resistant clones.
Strain Construction
[0099] Chromosomal modifications were made using recombineering methodologies (Sharan, S. K.; Thomason, L. C; Kuznetsov, S. G.; Court, D. L., Recombineering: a homologous recombination-based method of genetic engineering. Nat Protoc 2009, 4 (2), 206- 23, the entire contents of which are incorporated herein by reference) either with direct antibiotic cassette integration or through scarless tet-sacB selection and counterselection, adapted from Li et al (Li, X. T.; Thomason, L. C; Sawitzke, J. A.; Costantino, N.; Court, D. L., Positive and negative selection using the tetA-sacB cassette: recombineering and PI transduction in Escherichia coli. Nucleic Acids Res 2013, 41 (22), e204, the entire contents of which are incorporated herein by reference). The recombineering plasmid pSIM5 and the tet-sacB selection/counterselection marker cassette were obtained from D. Court (NCI, https://redrecombmeenng.ncifcrf.gc ' /couri"lab.htinl). Oligonucleotides and synthetic linear DNA used for strain construction (GBLOCKS™), given in Table 2, were obtained from Integrated DNA Technologies (IDT, Coralville, IA). Briefly, the tet-sacB selection/counterselection cassette was initially amplified with tetA_F (SEQ ID NO: 1) and sacB_R(SEQ ID NO: 2). Subsequently, PCR amplification using the appropriate oligos was performed to add -50 bp flanking homology sequences to target specific genes (arsB known neutral site for chromosomal integration or ompT a membrane associated protease) using Econotaq (Lucigen Middleton, WI) according to manufacturer's instructions, with an initial 10 minutes denaturation at 94°, followed by 35 cycles of 94 °, for 15 seconds, 52 0 for 15 seconds, and 72 0 for 5 minutes. Cassettes for "curing" the tet-sacB cassette and both simultaneous arsB deletion and integration of a low phosphate inducible his-tagged ulpl hydrolase (codon optimized for E. coli) or deletion of ompT were obtained as Gblocks™ from IDT. To change the native promoter of the gene fadD to the low phosphate inducible yibD gene promoter and replace the fadE to with Fatbl, synthetic linear DNA coding the desired chromosomal changes, along with -50 bp of flanking homology sequences targeting fadD or fadE and an antibiotic cassette for direct selection (gentamicin for fadD and zeocin for fadE) were obtained as GBLOCKS™, and introduced by standard recombineering methods Chromosomal modifications were confirmed by PCR amplification and sequencing (Eton Biosciences) using paired oligonucleotides (SEQ ID NOs: 1-19), flanking the entire region.
Plasmid cloning
[00100] The design and construction of plasmids as discussed above utilized the primers. Synthetic linear DNA coding hNMT-1 (including a N terminal His6 tag) and its peptide substrate (including the N terminal SUMO tag and the C terminal GST tag) were obtained as GBLOCKS™. These included -20 bp flanking homology regions to clone them into expression vectors (pCDF for the enzyme and pSMART-HC for the substrate peptide) using NEBuilder® HiFi DNA Assembly Mix (New England Biolabs, Ipswich, MA) according to manufacturer's instructions. Briefly, pSMART-HC (Lucigen, Middleton, WI) was linearized using oligonucleotides SL1 (SEQ ID NO: 20) and SR2 ( SEQ ID NO: 21) and Q5® High-Fidelity PCR Mix (New England Biolabs, Ipswich, MA), with an initial 2 minutes denaturation at 94 °, followed by 35 cycles of 94 0 for 15 seconds, 60 0 for 15 seconds, and 72 0 for 1 minute. Similarly, pCDF was linearized in two pieces using as template a vector already containing the yibD gene promoter obtained from plasmid pCDF-mCherry (Addgene #65823). The PCR reactions used oligonucleotides sets pCDF_piecel_F/R (SEQ ID NOs: 22 and 23) and pCDF_piece2_F/R (SEQ ID NOs: 24 and 25), with an initial 2 minutes 30 seconds denaturation at 94 °, followed by 35 cycles of 94 0 for 15 seconds, 59/63 0 for 15 seconds (piece l/piece2), and 72 0 for 1 minute. The PCR products were gel purified using a DNA gel recovery kit (Zymo Research, Irvine, CA) and used together with 100 ng of the purchased GBLOCKS™ to perform a Gibson reaction for 15 minutes at 50 °.
[00101] Further modifications to the plasmids were obtained using Q5® High-Fidelity PCR Mix (New England Biolabs, Ipswich, MA). The N-terminal SUMO tag was removed from the peptide substrate to make pNAP-l-noSUMO using oligonucleotides remove SUMO_F/R (SEQ ID NOs: 18 and 19) with an initial 2 minutes 30 seconds denaturation at 94 °, followed by 35 cycles of 94 0 for 15 seconds, 61 0 for 15 seconds, and 72 0 for 2 minutes and 30 seconds. The first N-terminal 80 amino acids of hNMT-1 were deleted from pCDF-His-hNMT-1 to make pCDF-yibD-delta80-His-hNMT-l using oligonucleotides A80_hNMT-l_F/R (SEQ ID NOs: 26 and 27) with an initial 2 minutes 30 seconds denaturation at 94 °, followed by 35 cycles of 94 0 for 15 seconds, 63 0 for 15 seconds, and 72 0 for 2 minutes and 30 seconds. The PCR products were gel purified using a DNA gel recovery kit (Zymo Research, Irvine, CA), and circularized during one hour at room temperature, using T4 DNA ligase in lx T4 DNA ligase reaction buffer, in the presence of T4 polynucleotide kinase (3' phosphatase minus) and Dpnl, all purchased from New England Biolabs, Ipswich, MA. All plasmids sequences were confirmed by DNA sequencing (Eton Bioscience, NC) and deposited with Addgene.
Table 2 Microorganism Strains and Plasmids of the Examples
, a :: - at , yi - a s tu y
Shake Flask Experiments
[00102] Production of myristoyl-CoA, substrate peptides and hNMT-ldue to phosphate depletion was performed in vented cap square flasks (Genesee Scientific, San Diego, CA). Spectinomycin and/or kanamycin were added when appropriate. Cell cultures were started from frozen stocks in 50 ml (10 ml for myristoyl-CoA experiments) of Growth Medium. One liter of Growth Medium consists of 9 g ammonium sulfate, 0.25 g citrate, 2.5 g yeast extract, 45 g glucose, 5 mM of phosphate buffer, 200 mM MOPS buffer (pH=7.4), 2.5 mM magnesium sulfate, 0.06 mM calcium sulfate, 10 mg thiamine-HCl, 0.16 mM iron(II) sulfate, supplemented with 0.2 ml of trace metals (for 1 liter of trace metals: 10 ml sulfuric acid, 0.6 g cobalt (II) sulfate heptahydrate, 5 g copper (II) sulfate pentahydrate, 0.6 g zinc sulfate heptahydrate, 0.2 g sodium molybdate dihydrate, 0.1 g boric acid and 0.3 g manganese (II) sulfate monohydrate), pH 6.8. The cultures were left to grow to 3 OD (600 nm) by incubating at 30□ and 220 rpm overnight. Cells were induced by centrifuging and re-suspending them in Induction Medium (Growth Medium without phosphate or yeast extract); and incubating at 30 0 and 220 rpm. Cells were harvested 24 hours after induction.
Analytical Methods [00103] Myristoyl-CoA was extracted and quantified using conventional methods with some modifications as described below. Briefly, cells were pelleted by centrifugation and re- suspended in 0.5 ml of freshly made 100 mM potassium phosphate monobasic (pH 4.9) and 0.5 ml of acetonitrile:2-propanol:methanol (3: 1 : 1). Cells were lysed using a Branson 4cl5 sonicator (Branson Ultrasonics, Dansbury, CT) with 10 seconds, 30 seconds on/off cycles for 3 minutes at 50% tip amplitude. The cells were centrifuged at 14000 g and the supernatant was collected. The pellet was re-extracted using 0.5 ml of acetonitrile:2-propanol:methanol (3: 1 : 1). After centrifuging again, the new supernatant was combined with the previous one and dried under nitrogen gas. The dried extract was resuspended in 200 ul of methanol: water (1 : 1). Myristoyl- CoA was separated using an Acquity UPLC (Waters Co, Milford, MA) in a Waters BEH C18 50 mm reverse phase column (Waters Co, Milford, MA). A gradient starting at 80% solvent A (15 mM NaOH in water) and 20% solvent B (15 mM NaOH in AcN) was used, and decreased it to 60% solvent A over 0.5 minutes, then decreased to 0% solvent A over 1 minute. The flow ran at 0% solvent A for 0.5 minutes, before turning back to the initial 80% solvent A gradient. The flow ran at 80% solvent A to re-equilibrate the column for the next sample for 1.5 minutes. Samples were detected using a Xevo TQD™ mass spectrometer (Waters Co, Milford, MA). A calibration curve was also performed using purchased myristoyl-CoA at 2, 1.6, 0.4, 0.1 and 0.025 mg/L. Extractions were performed in triplicates before and after phosphate induction. Values were normalized to biomass levels and always measured in the linear range of our calibration curve.
[00104] SDS-PAGE was performed using Mini-PROTEAN® TGX™ 4-20% gradient gels (Bio-rad, Hercules, CA). Samples were mixed 1 : 1 with 2X Laemmli sample buffer (Bio-rad, Hercules, CA). -10 μg or -500 ng of total protein were loaded for lysates or purified proteins respectively. Protein gels were stained using Coomassie Blue.
[00105] Myristoylation of the GNAAAARR tagged sequences was confirmed using matrix assisted laser desorption/ionization (MALDI) coupled with time of flight mass spectrometry using a Voyager DE (Applied Biosystems, Foster City, CA). Mass spectra were collected in positive ion mode using an acceleration voltage of 25 kV and a delay of 750 ns. Each mass spectrum collected represents the sum of 32 laser shots. Sinapinic acid was used as the matrix and aldolase was used as an internal standard. Data was calibrated and analyzed using the VOYAGER™ 5 software.
Analysis
[00106] With these chromosomal modifications and plasmid constructs as described above, a complete system for in vivo acylation of a target peptide or protein was obtained. In FIG. 1, production of acyl-CoAs was achieved through dynamic metabolic control upon phosphate medium depletion (a). A N-terminal SUMO tagged protein/peptide target was expressed (b) in an E. coli strain expressing the ulpl hydrolase (c). The N-terminal SUMO tag was removed by ulpl to expose the acylation recognition sequence (d). Co-expression of hNMT-1 (e) resulted in the acyl group being transferred to the target protein/peptide (f).
[00107] In FIG. 3, heterologous C. camphora acyl-ACP thioesterase expression leads to increased myristic acid production by cleaving myristate from myristotyl-ACP and alleviating the inhibition of ACCase by acyl-ACPs (i). Overexpression of the fadD (acyl-CoA synthetase) by replacing its native promoter for the low phosphate inducible yibD gene promoter resulted in accumulation of myristoyl-CoA (ii). Deleting the fadE gene mitigated the beta oxidative pathway of acyl-CoAs, making them available for peptide lipidation (iii).
[00108] FIG. 2 is a SDS-PAGE of purified samples (C-terminally purified GST) expressed in strains with or without expression of ulpl hydrolase and with or without a N-terminal SUMO- tag. FIG. 2 demonstrates in vivo expression and N-terminal SUMO tag cleavage by the ulpl hydrolase.
[00109] FIG. 4 shows improved Myristoyl-CoA (Myr-CoA) synthesis in genetically modified E. coli strains expressing an inducible thioesterase (TE), expressing an acyl CoA synthetase, and comprising mitigation of acyl CoA degradation before inductiongray) and 24 hours after induction (black). DLF25 was a control strain; RLSOOl overexpressed the acyl-CoA synthetase; RLS002: fadE was deleted and the acyl-acp thioesterase was overexpressed (the thioesterase replaced fadE); RLS003: acylCoA was overexpressed, fadE was deleted, acyl-acp thioesterase was overexpressed. . RLSl l acylCoA was overexpressed, fadE was deleted, acyl- acp thioesterase was overexpressed, ulpl is present and the ompT gene was deleted. All strains were induced under low phosphate conditions to overexpress enzymes.
[00110] There are two bars per strain, before induction of acyl-CoA production (0 hr) and 24 hours after induction (24 hr). Control strains had minimal intracellular Myr-CoA. Overexpression of the fadD synthetase increased Myr-CoA pools. Deletion of fadE in combination with the overexpression of fadD and the TE lead to large increases in Myr-CoA. Pools were measured in cellular lysates 16 hrs post induction of the TE.The modifications of the microorganism as depicted in FIG. 3 lead to strain RLS 0011, which provided the biosynthesis and accumulation of myristoyl-CoA in vivo upon phosphate depletion. Introduction of plasmids pNAP-1 and pCDF-hNMT-1 into RLS_0011 provided the in vivo myristoylation of GNAAAARR-GST, which was confirmed by a shift in the center mass observed consistent with MALDI of purified proteins by ~220Da consistent with myristgoylation (FIG. 5).
[00111] FIG. 6 depicts M depicts MALDI (matrix-assisted laser desorption/ionization) spectra of purified processed protein (SUMO tag cleaved) with or without co-expression of the hNMT (human N-myristoltransferase- 1). In this exemplary embodiment a single plasmid or construct for expressing both proteins (SEQ ID NO: 36) was expressed in a genetically modified microorganism that also contained a modified acyl-CoA biosynthetic pathway. As shown in FIG. 6,
[00112] Accordingly, the genetically modified mirorganism of the present invention co expresses at least two genes and, in some embodiments, up to five genes. In the Examples given above, individual contructs were used to introduce exogenous DNA into the genetically modified microorganism. However, the invention described herein may also encompass constucts, or exogenous DNA material that comprises more than one modified gene in a single unit. For example, SEQ ID NO: 37 encodes: amino acids 174-989: KanR (antibiotic resistance gene); 1052-1639: ori (origin of replication); 1725-2111 : yibD promoter; 2130-3125: substrate protein (SUMO-substrate-GST); 3129-3418: phoB promoter; 447-4889: CBD-delta80 hNMT-1 (human myristoyl transferase 1 with the first 80 amino acids deleted and a chitin binding domain-CBD- fused to the N terminus.
[00113] One skilled in the art may readily appreciate that the present disclosure is well adapted to carry out the objects and obtain the ends and advantages mentioned, as well as those inherent therein. The present disclosure described herein are presently representative of preferred embodiments, are exemplary, and are not intended as limitations on the scope of the present disclosure. Changes therein and other uses may occur to those skilled in the art which are encompassed within the spirit of the invention as defined by the scope of the claims.
[00114] Definitions
As used herein the terms "polypeptide", "peptide" and "protein" are used interchangeably to refer to a polymer of amino acid residues. The term percent (%) amino acid sequence identity between to amino acid polymer chains is defined as the percentage of amino acid residues identical between the chains when the two sequences are aligned. To determine % amino acid identity, sequences are aligned and if necessary, gaps are introduced to achieve the maximum % sequence identity; conservative substitutions are not considered as part of the sequence identity. Amino acid sequence alignment procedures to determine percent identity are well known to those of skill in the art. Often publicly available computer software such as BLAST, BLAST2, ALIGN2 or Megalign (DNASTAR) software is used to align peptide sequences.
[00115] As used herein, a biomolecule that is heterologous in the context of the genetically modified microorganism, means that the heterologous biomolecule is not naturally found in an unmodified microorganism form which the genetically modified microorganism was derived. For example, in E. coli, genetically modified to express a human protein from a human gene, both the human protein and human gene in the genetically modified E. coli are heterologous compared to unmodified E. coli. The phrase or term native refers to naturally occurring or homologous indicating it would be found in an unmodified E. coli.
[00116] The terms lipidation, fatty acylation, acylation are all used in this specification to refer to the transfer of a fatty acid having a chain length of about C8-C18 from a fatty acyl-CoA to a peptide or protein thus resulting in an acylated, fatty acylated and lipidated protein.
[00117] Fatty acids that are saturated, monounsaturated or polyunsaturated may be used for protein N-acylation. Preferably the fatty acids contain between 8 and 18 carbons, although fatty acyl groups with between 2 and 26 carbons are encompassed. Acyl Co- As containing fatty acids known as: butanoic acid, hexanoic acid, octanoic acid, decanoic acid, dodecanoic acid, tridecnoic acid, tetradecanoic acid, pentadecanoic acid, hexadecanoic acid, heptadecanoic acid, octadecanoic, nonadecanoic acid, eicosanoic acid, docosanoic acid, tetracosanoic acid, butyric acid, caproic acid, caprylic acid, capric acid, lauric acid, myristic acid, palmitica acid, margaric acid, stearic acid, arachidic acid, behenic acid, lignoceric acid, tetradecenoic acid, myristoleic acid, myristol, palmitolyl, palmitoleic acid, hesadecenoic aicd, pentadecenoic acid, heptadecenoic acid, octadecenoic acid, oleic acid, gadoleic acid, eicosenoic acid, erucic acid, docosenoic acid, nervonic acid, hexadecadienoic acid, octadecadienoic aicd, linoleic acid, linolenic acid, octadecatrienoic acid, octadecatetraenoic acid, parinaric acid, gamma-linolenic acid, alpha-linolenic acid, arachidonic acid, timnodonic acid, brassic acid, clupanodonic acid, eicosadienoic acid, eicosatrienoic acid, eicosatetraenoic acid, eicosapentaenoic acid (EPA), docosapentaenoic acid (DP A), docosahexaenoic acid (DHA) may be used for protein N- acylation.
[00118] Although some of the genetic modifications of a genetically modified organism are described as occurring in a bacterial strain and particularly E. coli in the examples, it may be appreciated that the same genetic modification may be made any host microorganism including any prokaryotic and eukaryotic host microorganism. Some modifications of the genetically modified microorganism occur on exogenous vectors or plasmids. A plasmid as used herein may also be referred to as a vector or exogenous DNA. It may be appreciated that the same genetic modification may also occur by modification of the chromosome of the host microorganism.
To the extent that the term "includes" or "including" is used in the specification or the claims, it is intended to be inclusive in a manner similar to the term "comprising" as that term is interpreted when employed as a transitional word in a claim. Furthermore, to the extent that the term "or" is employed (e.g., A or B) it is intended to mean "A or B or both." When "only A or B but not both" is intended, then the term "only A or B but not both" will be employed. Thus, use of the term "or" herein is the inclusive, and not the exclusive use. As used in the specification and the claims, the singular forms "a," "an," and "the" include the plural. Finally, where the term "about" is used in conjunction with a number, it is intended to include ± 10% of the number. For example, "about 10" may mean from 9 to 11. The term wt % is meant to describe a comparison of the weight of one compound to the weight of the whole composition expressed as a percent. It can also be described as wt. %, or (w/w) %. As stated above, while the present application has been illustrated by the description of embodiments, and while the embodiments have been described in considerable detail, it is not the intention to restrict or in any way limit the scope of the appended claims to such detail. Additional advantages and modifications will readily appear to those skilled in the art, having the benefit of this application. Therefore, the application, in its broader aspects, is not limited to the specific details and illustrative examples shown. Departures may be made from such details and examples without departing from the spirit or scope of the general inventive concept.