IRE1 SMALL MOLECULE INHIBITORS

CROSS-REFERENCE

[0001] This application claims benefit of U.S. Provisional Patent Application No.

62/513,956 filed on June 1, 2017, which is incorporated herein by reference in its entirety.

SEQUENCE LISTING

[0001.1] The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on May 23, 2018, is named 51089-710_601_SL.txt and is 23,840 bytes in size.

BACKGROUND

[0002] Aggressive tumors have evolved strategies that enable them to thrive under constant adverse conditions. For example, cancer cells respond to hypoxia, nutrient starvation, oxidative stress, and high metabolic demand by adjusting their protein folding capacity via the endoplasmic reticulum (ER) stress response pathway. There exists a need for improved methods and compositions to target cancer cells and counter their mechanisms of survival.

BRIEF SUMMARY

[0003] Provided in one aspect is a compound of Formula (I), or a pharmaceutically acceptable salt, or solvate thereof:

Formula (I)

wherein, is a substituted C ₃ -Ci ₀ cycloalkyl that is substituted with 1-3R ¹ and 0-3R ² ; Each R ¹ is independently -OR ⁶ , -SR ⁶ , -S(=0)R ⁷ , -S(=0) ₂ R ⁷ , or -N(R ⁶ ) ₂ ;

Each R ² is independently H, halogen, -CN, -OR ⁸ , -SR ⁸ , -S(=0)R ⁹ , -S(=0) ₂ R ⁹ , -

S(=0) ₂ N(R ⁸ ) ₂ , -NR ⁸ S(=0) ₂ R ⁹ , -C(=0)R ⁹ , -OC(=0)R ⁹ , -C0 ₂ R ⁸ , -OC0 ₂ R ⁹ , -N(R ⁸ ) ₂ , - OC(=0)N(R ⁸ ) ₂ , -NR ⁸ C(=0)R ⁹ , -NR ⁸ C(=0)OR ⁹ , optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ fluoroalkyl, optionally substituted Ci-C ₄ heteroalkyl, optionally substituted C3-C ₆ cycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;

Each R ⁶ is independently H, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci- C ₄ heteroalkyl, optionally substituted Ci-C ₄ fluoroalkyl, -X-optionally substituted Ci- C ₄ alkyl, -X-optionally substituted Ci-C ₄ heteroalkyl, -X-optionally substituted Ci- C ₄ fluoroalkyl, optionally substituted C ₃ -C ₆ cycloalkyl, optionally substituted C ₂ - Cioheterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;

Or two R ⁶ are taken together with the N atom to which they are attached to form an

optionally substituted heterocycle;

X is -(C=0)-;

Each R ⁷ is independently optionally substituted Ci-C ₄ alkyl, optionally substituted Ci- C ₄ heteroalkyl, or optionally substituted Ci-C ₄ fluoroalkyl, optionally substituted C ₃ - C ₆ cycloalkyl, optionally substituted C ₂ -Cioheterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;

Each R ⁸ is independently H, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci- C ₄ heteroalkyl, optionally substituted Ci-C ₄ fiuoroalkyl, , optionally substituted C ₃ - C ₆ cycloalkyl, optionally substituted C ₂ -Cioheterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;

Or two R ⁸ are taken together with the N atom to which they are attached to form an

optionally substituted heterocycle;

Each R ⁹ is independently optionally substituted Ci-C ₄ alkyl, optionally substituted Ci- C ₄ heteroalkyl, or optionally substituted Ci-C ₄ fluoroalkyl, optionally substituted C ₃ - C ₆ cycloalkyl, optionally substituted C ₂ -Ci ₀ heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;

A ² is N or CR ^A ;

R ^A , R ^A1 , R ^A2 , R ^A3 are each independently H, halogen, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ fluoroalkyl, optionally substituted aryl, or -OR ¹⁰ ;

or R^ or R^ are taken together with the carbon atoms that they are attached to form an optionally substituted carbocycle;

R ¹⁰ is independently H, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci- C ₄ fluoroalkyl;

L ¹ and L ² are each independently -CHY-, -CH ₂ - or - H-; with the provision that if L ¹ is -

CHY- or -CH ₂ -, then L ² is -NH- or if L ² is -CHY- or -CH ₂ -, then L ¹ is H;

Y is -OH, - H ₂ , or optionally substituted Ci-C ₄ alkyl; R ³ and R ⁵ are each independently H, halogen, -CN, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ fluoroalkyl, or -OR ¹¹ ;

R ¹¹ is independently H, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci-

C ₄ fluoroalkyl;

R ⁴ is H, halogen, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-

C ₄ fluoroalkyl, or -OR ^D ;

R ^D is H, optionally substituted Ci-C alkyl, optionally substituted heterocyclyl containing at least one N atom, or -(optionally substituted Ci-C ₄ alkylene)-N(R ¹² )2; wherein if R ^E is substituted then R ^D is substituted with 0-4 R ¹³ ;

R ¹² is independently H, or optionally substituted Ci-C alkyl, or optionally substituted Ci-

C fluoroalkyl;

Each R ¹³ is independently H, halogen, -CN, -OR ¹⁴ , -SR ¹⁴ , -S(=0)R ¹⁵ , -S(=0) ₂ R ¹⁵ , - S(=0) ₂ N(R ¹⁴ ) ₂ , -NR ¹⁴ S(=0) ₂ R ¹⁵ , -C(=0)R ¹⁵ , -OC(=0)R ¹⁵ , -C0 ₂ R ¹⁴ , -OC0 ₂ R ¹⁵ , - N(R ¹⁴ ) ₂ , -OC(=0)N(R ¹⁴ ) ₂ , -NR ¹⁴ C(=0)R ¹⁵ , -NR ¹⁴ C(=0)OR ¹⁵ , optionally substituted Ci-C alkyl, optionally substituted Ci-C fluoroalkyl, optionally substituted Ci- C ₄ heteroalkyl, optionally substituted C3-C ₆ cycloalkyl, optionally substituted C ₂ - Cioheterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;

Each R ¹⁴ is independently hydrogen, optionally substituted Ci-C alkyl, optionally

substituted Ci-C fluoroalkyl, optionally substituted Ci-C heteroalkyl, optionally substituted C3-Ciocycloalkyl, optionally substituted C ₂ -Cioheterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl; or

two R ¹⁴ are taken together with the N atom to which they are attached to form an

optionally substituted heterocycle, and

Each R ¹⁵ is independently optionally substituted Ci-C ₄ alkyl, optionally substituted Ci- C ₄ fluoroalkyl, optionally substituted Ci-C ₄ heteroalkyl, optionally substituted C ₃ - Ciocycloalkyl, optionally substituted C ₂ -Ci ₀ heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl.

[0004] In some embodiments, is substituted C -C ₇ cycloalkyl that is substituted with 1-3R ¹ and 0-3R ² .

q is 0, 1, 2, or 3.

[0006] In some embodiments, is

[0007] In some embodiments is

q is 0, 1, 2, or 3.

[0008] In some embodiments, q is 0 or 1. In some embodiments, each R ⁶ is independently H, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ heteroalkyl, optionally substituted Ci-C ₄ fluoroalkyl, -X-optionally substituted Ci-C ₄ alkyl, -X-optionally substituted Ci-C ₄ heteroalkyl, or -X-optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, each R ² is independently H, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ heteroalkyl, d Ci-C ₄ fluoroalkyl.

[0009] In some embo

; R ⁶ is H, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ heteroalkyl, optionally substituted Ci-C ₄ fluoroalkyl, -X-optionally substituted Ci-C ₄ alkyl, -X-optionally substituted Ci- C ₄ heteroalkyl, or -X-optionally substituted Ci-C ₄ fluoroalkyl;

q is 0 or 1; and

R ² is H, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ heteroalkyl, or optionally substituted Ci-C ₄ fluoroalkyl.

[0010] In some embodiments, A ² is N. In some embodiments, A ² is CR ^A . In some embodiments, R ^A is H, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci- C ₄ fluoroalkyl. In some embodiments, R ^A is H. In some embodiments, R ^A1 is H, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R ^A1 is H. In some embodiments, R ^A2 is H, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R^ is H. In some embodiments, R ^A3 is H, halogen, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ fluoroalkyl, optionally substituted aryl, or -OR ¹⁰ _. In some embodiments, R ^A3 is H, halogen, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ fluoroalkyl, or -OR ¹⁰ _. In some embodiments, R ^A3 is optionally substituted Ci-C ₄ alkyl In some embodiments, R ^A3 is methyl, ethyl, propyl or butyl _. In some embodiments, R ^A3 is -OR ¹⁰ and R ¹⁰ is methyl, ethyl, propyl or butyl _. In some embodiments, L ¹ and L ² are each - H-. In some embodiments, L ¹ is -CH ₂ - and L ² is - H-. In some

embodiments, L ¹ is -NH- and L ² is -CH ₂ -.

[0011] In some embodiments,

[0012]

[0013] In some embodiments, R ³ is H, halogen, -CN, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R ³ is optionally substituted

Ci-C ₄ alkyl. In some embodiments, R ³ is methyl, ethyl, propyl, or butyl. In some embodiments,

R ³ is optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R ³ is -CF ₃ or -CH ₂ CF ₃ . In some embodiments, R ⁵ is H, halogen, -CN, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R ⁵ is H. In some embodiments, R ⁵ is optionally substituted Ci-C ₄ alkyl. In some embodiments, R ⁵ is methyl, ethyl, propyl, or butyl. In some embodiments, R ⁵ is optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R ⁵ is - CF ₃ or -CH ₂ CF ₃ . In some embodiments, R ⁴ is H. In some embodiments, R ⁴ is -OR ^D . In some embodiments, R ^D is optionally substituted heterocyclyl containing at least one N atom; wherein if R ^D is substituted then R ^D is substituted with 0-4 R ¹³ .

D is:

r is 0, 1, or 2.

D is:

[0016] In some embodiments, R ^D is -(optionally substituted C ₁ -C ₄ alkylene)-N(R ¹² ) ₂ ; wherein if R ^D is substituted then R ^D is substituted with 0-4 R ¹³ . In some embodiments, R ^D is - CH ₂ -CH ₂ -CH ₂ -CH ₂ -N(R ¹² ) ₂ , -CH ₂ -CH ₂ -CH ₂ -N(R ¹² ) ₂ , -CH ₂ -CH ₂ -N(R ¹² ) ₂ , or -CH ₂ -N(R ¹² ) ₂ . In some embodiments, each R ¹² is independently H or Ci-C ₄ alkyl.

[0017] In some embodiments, the compound has the structure of formula (la)

[0018] In some embodiments, the compound has the structure of formula (lb)

[0019] In some embodiments, the compound has the structure of formula (Ic)

[0020] In som e embodiments,

q is 0 or 1.

[0021] In some embodiments, each R is independently H, optionally substituted Ci- C ₄ alkyl, optionally substituted Ci-C ₄ heteroalkyl, optionally substituted Ci-C ₄ fluoroalkyl, -X- optionally substituted Ci-C ₄ alkyl, -X-optionally substituted Ci-C ₄ heteroalkyl, or -X-optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, each R ² is independently H, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ heteroalkyl, or optionally substituted Ci- C ₄ fiuoroalkyl. In some embodiments, A ² is N. In some embodiments, A ² is CR ^A . In some embodiments, R ^A is H, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci- C ₄ fluoroalkyl. In some embodiments, R ^A is H. In some embodiments, R ^A1 is H, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R ^A1 is H. In some embodiments, R ^A2 is H, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R^ is H. In some embodiments, R ^A3 is H, halogen, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ fluoroalkyl, optionally substituted aryl, or -OR ¹⁰ _. In some embodiments, R ^A3 is H, halogen, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ fluoroalkyl, or -OR ¹⁰ _. In some embodiments, R ^A3 is optionally substituted Ci-C ₄ alkyl _. In some embodiments, R ^A3 is methyl, ethyl, propyl or butyl _. In some embodiments, L ¹ and L ² are each - H-. In some embodiments, L ¹ is -CH ₂ - and L ² is - H-. In some embodiments, L ¹ is -NH- and L ² is -CH ₂ -. In some embodiments, R ³ is halogen, -CN, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci-C ₄ fluoroalkyl. In some

embodiments, R ³ is optionally substituted Ci-C ₄ alkyl. In some embodiments, R ³ is methyl, ethyl, propyl, or butyl. In some embodiments, R ³ is optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R ³ is -CF ₃ or -CH ₂ CF ₃ . In some embodiments, R ⁵ is H, halogen, -CN, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R ⁵ is H. In some embodiments, R ⁵ is optionally substituted Ci-C ₄ alkyl. In some embodiments, R ⁵ is methyl, ethyl, propyl, or butyl. In some embodiments, R ⁵ is optionally substituted Ci- C ₄ fluoroalkyl. In some embodiments, R ⁵ is -CF ₃ or -CH ₂ CF ₃ .

0022] In some embodiments, the compound has the structure of formula (Id)

q is 0 or 1.

[0024] In some embodiments, each R ⁶ is independently H, optionally substituted Ci-

C ₄ alkyl, optionally substituted C ₁ -C ₄ heteroalkyl, optionally substituted C ₁ -C ₄ fluoroalkyl, -X- optionally substituted C ₁ -C ₄ alkyl, -X-optionally substituted C ₁ -C ₄ heteroalkyl, or -X-optionally substituted C ₁ -C ₄ fluoroalkyl. In some embodiments, each R ² is independently H, optionally substituted C ₁ -C ₄ alkyl, optionally substituted C ₁ -C ₄ heteroalkyl, or optionally substituted Ci- C ₄ fluoroalkyl. In some embodiments, A ² is N. In some embodiments, A ² is CR ^A . In some embodiments, R ^A is H, optionally substituted Ci-Qalkyl, or optionally substituted Ci- C ₄ fluoroalkyl. In some embodiments, R ^A is H. In some embodiments, R ^A1 is H, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R ^A1 is H. In some embodiments, R ^A2 is H, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R^ is H. In some embodiments, R ^A3 is H, halogen, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ fluoroalkyl, optionally substituted aryl, or -OR ¹⁰ _. In some embodiments, R ^A3 is H, halogen, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ fluoroalkyl, or -OR ¹⁰ _. In some embodiments, R ^A3 is optionally substituted Ci-C ₄ alkyl In some embodiments, R ^A3 is methyl, ethyl, propyl or butyl _. In some embodiments, L ¹ and L ² are each - H-. In some embodiments, L ¹ is -CH ₂ - and L ² is - H-. In some embodiments, L ¹ is -NH- and L ² is -CH ₂ -. In some embodiments, R ³ is H, halogen, -CN, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci-C ₄ fluoroalkyl. In some

embodiments, R ³ is optionally substituted Ci-C ₄ alkyl. In some embodiments, R ³ is methyl, ethyl, propyl, or butyl. In some embodiments, R ³ is optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R ³ is -CF ₃ or -CH ₂ CF ₃ . In some embodiments, R ⁵ is H, halogen, -CN, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R ⁵ is H. In some embodiments, R ⁵ is optionally substituted Ci-C ₄ alkyl. In some embodiments, R ⁵ is methyl, ethyl, propyl, or butyl. In some embodiments, R ⁵ is optionally substituted Ci- C ₄ fluoroalkyl. In some embodiments, R ⁵ is -CF ₃ or -CH ₂ CF ₃ . In some embodiments, R ^D is optionally substituted heterocyclyl containing at least one N atom; wherein if R ^D is substituted then R ^D is substituted with 0-4 R ¹³ .

D is:

[0026] In some embodiments, R ^D is -(optionally substituted C ₁ -C ₄ alkylene)-N(R ¹² ) ₂ ; wherein if R ^D is substituted then R ^D is substituted with 0-4 R ¹³ . In some embodiments, R ^D is - CH ₂ -CH ₂ -CH ₂ -CH ₂ -N(R ¹² ) ₂ , -CH ₂ -CH ₂ -CH ₂ -N(R ¹² ) ₂ , -CH ₂ -CH ₂ -N(R ¹² ) ₂ , or -CH ₂ -N(R ¹² ) ₂ . In some embodiments, each R ¹² is independently H or Ci-C ₄ alkyl.

[0027] In some embodiments, the compound or pharmaceutically acceptable salt, or solvate thereof, selectively binds to IREla at one or more binding sites. In some embodiments, the IREla comprises an RNase domain, a kinase domain, or any combination thereof. In some embodiments, the kinase domain is an auto-transphosphorylation kinase domain. In some embodiments, the kinase domain comprises an ATP -binding pocket. In some embodiments, the kinase domain comprises an activation loop. In some embodiments, at least one binding site is within the RNase domain. In some embodiments, at least one binding site is within the kinase domain. In some embodiments, the at least one binding site is within the ATP -binding pocket of the kinase domain. In some embodiments, In some embodiments, the at least one binding site is within the activation loop of the kinase domain. In some embodiments, binding occurs at a first binding site. In some embodiments, the first binding site is located within the RNase domain, kinase domain, ATP -binding pocket, or activation loop. In some embodiments, the first binding site comprises at least one amino acid residue of within amino acid residues 465-977 of SEQ ID NO: 1. In some embodiments, the first binding site comprises at least one amino acid residue within amino acid residues 568-833 of SEQ ID NO: 1. In some embodiments, the first binding site comprises at least one amino acid residue within amino acid residues 577-586, 597, 599, 626, 642-643, 645, 648, 688, 692-693, 695, or 711 of SEQ ID NO: 1. In some embodiments, the first binding site comprises at least one amino acid residue within amino acid residues 710-725 or 729-736 of SEQ ID NO: 1. In some embodiments, the first binding site comprises at least one amino acid residue within amino acid residues 835-963 of SEQ ID NO: 1. In some

embodiments, binding further occurs at a second binding site. In some embodiments, the second binding site is located within the RNase domain, the kinase domain, the ATP -binding pocket, or the activation loop. In some embodiments, the second binding site comprises at least one amino acid residue of within amino acid residues 465-977 of SEQ ID NO: 1. In some embodiments, the second binding site comprises at least one amino acid residue within amino acid residues 568- 833 of SEQ ID NO: 1. In some embodiments, the second binding site comprises at least one amino acid residue within amino acid residues 577-586, 597, 599, 626, 642-643, 645, 648, 688, 692-693, 695, or 711 of SEQ ID NO: 1. In some embodiments, the second binding site comprises at least one amino acid residue within amino acid residues 710-725 or 729-736 of SEQ ID NO: 1. In some embodiments, the second binding site comprises at least one amino acid residue within amino acid residues 835-963 of SEQ ID NO: 1. In some embodiments, binding occurs when the IREla is in a homo-dimerized conformation. In some embodiments, binding occurs when the IREla is in an oligomerized conformation. In some embodiments, binding occurs when the IREla is in a non-oligomerized or non-dimerized conformation. In some embodiments, binding occurs when the IREla is in an ATP -bound state. In some embodiments, binding occurs when the IREla is in a non- ATP -bound state. In some embodiments, the compound selectively binds to a first IREla. In some embodiments, selectively binding to the first IREla blocks dimerization of the first IREla to a second IREla. In some embodiments, selectively binding to the first IREla blocks auto-transphosphorylation of the first IREla. In some embodiments, selectively binding to the first IREla blocks auto-transphosphorylation of a second IREla to which the first IREla is dimerized. In some embodiments, selectively binding to the first IREla blocks activation of the first IREla. In some embodiments, selectively binding to the first IREla blocks activation a second IREla to which the first IREla is dimerized. In some embodiments, selectively binding to the first IREla blocks kinase activity of the first IREla. In some embodiments, selectively binding to the first IREla blocks kinase activity of a second IREla to which the first IREla is dimerized. In some embodiments, selectively binding to the first IREla blocks RNase activity of the first IREla. In some embodiments, selectively binding to the first IREla blocks RNase activity of a second IREla to which the first IREla is dimerized.

[0028] In another aspect, provided herein is a compound that selectively binds a first

IREla at two or more sites, wherein when the compound is bound to the first IREla protein, the compound binds to an ATP -binding pocket of the first IREla and blocks the binding of ATP to the first IREla. In some embodiments, the ATP binding pocket is comprised within a kinase domain. In some embodiments, the ATP binding pocket is comprised within amino acid residues 465-977 of SEQ ID NO: 1 In some embodiments, the ATP binding pocket is comprised within amino acid residues 568-833 of SEQ ID NO: 1. In some embodiments, the ATP binding pocket comprises one or more of amino acid resides 577-586, 597, 599, 626, 642-643, 645, 648, 688, 692-693, 695, or 711 of SEQ ID NO: 1.

[0029] In another aspect, provided herein is a pharmaceutical composition comprising any one of the compounds described herein, or a pharmaceutically acceptable salt or solvate thereof. In some embodiments, the pharmaceutical composition further comprises one or more pharmaceutically acceptable excipients.

[0030] In another aspect, provided herein is a method for treating or ameliorating the effects of a disease associated with altered IREl signaling, the method comprising administering to a subject in need thereof a pharmaceutical composition, wherein the pharmaceutical composition comprises the compound of any one of the compounds described herein. In some embodiments, the disease is cancer. In some embodiments, the cancer is a solid cancer or a hematologic cancer. In some embodiments, the cancer is ovarian cancer, lung cancer, bladder cancer, breast cancer, or triple negative breast cancer (TNBC).

[0031] In another aspect, provided herein is a method for treating or ameliorating a cell proliferative disorder, the method comprising administering a pharmaceutical composition comprising a compound, or a pharmaceutically acceptable salt, or solvate thereof, that selectively binds to at least one amino acid residue of a IREl family protein comprising an RNase domain and kinase domain. In some embodiments, the IREl family protein is IREla. In some embodiments, the compound binds to an ATP -binding site of IREla. In some embodiments, the cell proliferative disorder is cancer. In some embodiments, the cancer is a solid cancer or a hematologic cancer. BRIEF DESCRIPTION OF THE DRAWINGS

[0032] The novel features of the invention are set forth with particularity in the appended claims. A better understanding of the features and advantages of the present invention will be obtained by reference to the following detailed description that sets forth illustrative

embodiments, in which the principles of the invention are utilized, and the accompanying drawings of which:

[0033] Figure 1 shows an example diagram of the domain structure of IREla. A signal peptide (P) and transmembrane (TM) region are indicated.

[0034] Figure 2 shows an example alignment of the C-terminal half IRE1 orthologues from yeast (Sclrel) (SEQ ID NO: 4), human (Hslrel) (SEQ ID NO: 5), mouse (Mmlrel) (SEQ ID NO: 6), and rat (RnlREl) (SEQ ID NO: 7). Stars indicate kinase domain dimer interface residues. Circles indicate Kinase extension nuclease (KEN) domain dimer interface residues. Triangles indicate putative nuclease active site residues. Yellow highlighted residues are highly conserved in Irel orthologues. Green highlighted residues are invariant in all analyzed Irel orthologues. Blue highlighted residues are invariant in analyzed RNaseL and Irel orthologues.

DETAILED DESCRIPTION

Certain Terminology

[0035] Unless otherwise stated, the following terms used in this application have the definitions given below. The use of the term "including" as well as other forms, such as

"include", "includes," and "included," is not limiting. The section headings used herein are for organizational purposes only and are not to be construed as limiting the subject matter described.

[0036] As used herein and in the appended claims, the singular forms "a," "and," and

"the" include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to "an agent" includes a plurality of such agents, and reference to "the cell" includes reference to one or more cells (or to a plurality of cells) and equivalents thereof known to those skilled in the art, and so forth. When ranges are used herein for physical properties, such as molecular weight, or chemical properties, such as chemical formulae, all combinations and subcombinations of ranges and specific embodiments therein are intended to be included. The term "about" when referring to a number or a numerical range means that the number or numerical range referred to is an approximation within experimental variability (or within statistical experimental error), and thus the number or numerical range may vary between 1% and 15% of the stated number or numerical range. The term "comprising" (and related terms such as "comprise" or "comprises" or "having" or "including") is not intended to exclude that in other certain embodiments, for example, an embodiment of any composition of matter, composition, method, or process, or the like, described herein, may "consist of or "consist essentially of the described features.

Definitions

[0037] As used in the specification and appended claims, unless specified to the contrary, the following terms have the meaning indicated below.

[0038] "Amino" refers to the - H ₂ radical.

[0039] "Cyano" refers to the -CN radical.

[0040] "Nitro" refers to the -N0 ₂ radical.

[0041] "Oxa" refers to the -O- radical.

[0042] "Oxo" refers to the =0 radical.

[0043] "Thioxo" refers to the =S radical.

[0044] "Imino" refers to the =N-H radical.

[0045] "Oximo" refers to the =N-OH radical.

[0046] As used herein, Ci-C _x includes C ₁ -C ₂ , C ₁ -C ₃ . . . Ci-C _x . By way of example only, a group designated as "C ₁ -C ₄ " indicates that there are one to four carbon atoms in the moiety, i.e. groups containing 1 carbon atom, 2 carbon atoms, 3 carbon atoms or 4 carbon atoms. Thus, by way of example only, "C ₁ -C ₄ alkyl" indicates that there are one to four carbon atoms in the alkyl group, i.e., the alkyl group is selected from among methyl, ethyl, propyl, z ^' so-propyl, «-butyl, iso- butyl, sec-butyl, and /-butyl.

[0047] An "alkyl" group refers to an aliphatic hydrocarbon group. The alkyl group is branched or straight chain. In some embodiments, the "alkyl" group has 1 to 10 carbon atoms, i.e. a Ci-Cioalkyl. Whenever it appears herein, a numerical range such as "1 to 10" refers to each integer in the given range; e.g., "1 to 10 carbon atoms" means that the alkyl group consist of 1 carbon atom, 2 carbon atoms, 3 carbon atoms, 4 carbon atoms, 5 carbon atoms,6 carbon atoms, etc., up to and including 10 carbon atoms, although the present definition also covers the occurrence of the term "alkyl" where no numerical range is designated. In some embodiments, an alkyl is a Ci-C ₆ alkyl. In one aspect the alkyl is methyl, ethyl, propyl, iso-propyl, n-butyl, iso- butyl, sec-butyl, or t-butyl. Typical alkyl groups include, but are in no way limited to, methyl, ethyl, propyl, isopropyl, butyl, isobutyl, sec-butyl, tertiary butyl, pentyl, neopentyl, or hexyl.

[0048] An "alkylene" group refers refers to a divalent alkyl radical. Any of the above mentioned monovalent alkyl groups may be an alkylene by abstraction of a second hydrogen atom from the alkyl. In some embodiments, an alkelene is a Ci-C ₆ alkylene. In other

embodiments, an alkylene is a Ci-C ₄ alkylene. In certain embodiments, an alkylene comprises one to four carbon atoms (e.g., C ₁ -C ₄ alkylene). In other embodiments, an alkylene comprises one to three carbon atoms (e.g., C ₁ -C ₃ alkylene). In other embodiments, an alkylene comprises one to two carbon atoms (e.g., C ₁ -C ₂ alkylene). In other embodiments, an alkylene comprises one carbon atom (e.g., Ci alkylene). In other embodiments, an alkylene comprises two carbon atoms (e.g., C ₂ alkylene). In other embodiments, an alkylene comprises two to four carbon atoms (e.g., C ₂ -C4 alkylene). Typical alkylene groups include, but are not limited to, -CH ₂ -, -CH(CH ₃ )- , -C(CH ₃ ) ₂ -, -CH ₂ CH ₂ -, -CH ₂ CH(CH ₃ )-, -CH ₂ C(CH ₃ ) ₂ -, -CH ₂ CH ₂ CH ₂ -, -CH ₂ CH ₂ CH ₂ CH ₂ -, and the like.

[0049] The term "alkenyl" refers to a type of alkyl group in which at least one carbon- carbon double bond is present. In one embodiment, an alkenyl group has the formula - C(R)=CR ₂ , wherein R refers to the remaining portions of the alkenyl group, which may be the same or different. In some embodiments, R is H or an alkyl. In some embodiments, an alkenyl is selected from ethenyl (i.e., vinyl), propenyl (i.e., allyl), butenyl, pentenyl, pentadienyl, and the like. Non-limiting examples of an alkenyl group include -CH=CH ₂ , -C(CH ₃ )=CH ₂ , - CH=CHCH ₃ , -C(CH ₃ )=CHCH ₃ , and -CH ₂ CH=CH ₂ .

[0050] The term "alkynyl" refers to a type of alkyl group in which at least one carbon- carbon triple bond is present. In one embodiment, an alkenyl group has the formula -C≡C-R, wherein R refers to the remaining portions of the alkynyl group. In some embodiments, R is H or an alkyl. In some embodiments, an alkynyl is selected from ethynyl, propynyl, butynyl, pentynyl, hexynyl, and the like. Non-limiting examples of an alkynyl group include -C≡CH, - C≡CCH ₃ -C≡CCH ₂ CH ₃ , -CH ₂ C≡CH.

[0051] An "alkoxy" group refers to a (alkyl)O- group, where alkyl is as defined herein.

[0052] The term "alkylamine" refers to the -N(alkyl) _x H _y group, where x is 0 and y is 2, or where x is 1 and y is 1, or where x is 2 and y is 0.

[0053] The term "aromatic" refers to a planar ring having a delocalized π-electron system containing 4n+2 π electrons, where n is an integer. The term "aromatic" includes both carbocyclic aryl ("aryl", e.g., phenyl) and heterocyclic aryl (or "heteroaryl" or "heteroaromatic") groups (e.g., pyridine). The term includes monocyclic or fused-ring polycyclic (i.e., rings which share adjacent pairs of carbon atoms) groups.

[0054] The term "carbocyclic" or "carbocycle" refers to a ring or ring system where the atoms forming the backbone of the ring are all carbon atoms. The term thus distinguishes carbocyclic from "heterocyclic" rings or "heterocycles" in which the ring backbone contains at least one atom which is different from carbon. In some embodiments, at least one of the two rings of a bicyclic carbocycle is aromatic. In some embodiments, both rings of a bicyclic carbocycle are aromatic. Carbocycle includes cycloalkyl and aryl.

[0055] As used herein, the term "aryl" refers to an aromatic ring wherein each of the atoms forming the ring is a carbon atom. In one aspect, aryl is phenyl or a naphthyl. In some embodiments, an aryl is a phenyl. In some embodiments, an aryl is a C6-C ₁₀ aryl. Depending on the structure, an aryl group is a monoradical or a diradical (i.e., an arylene group).

[0056] The term "cycloalkyl" refers to a monocyclic or polycyclic aliphatic, non- aromatic radical, wherein each of the atoms forming the ring (i.e. skeletal atoms) is a carbon atom. In some embodiments, cycloalkyls are spirocyclic or bridged compounds. In some embodiments, cycloalkyls are optionally fused with an aromatic ring, and the point of attachment is at a carbon that is not an aromatic ring carbon atom. In some embodiments, cycloalkyl groups include groups having from 3 to 10 ring atoms. In some embodiments, cycloalkyl groups include groups having from 3 to 6 ring atoms. In some embodiments, cycloalkyl groups are selected from among cyclopropyl, cyclobutyl, cyclopentyl, cyclopentenyl, cyclohexyl, cyclohexenyl, cycloheptyl, cyclooctyl, spiro[2.2]pentyl, norbornyl and bicycle[l . l . l]pentyl. In some embodiments, a cycloalkyl is a C3-C ₆ cycloalkyl. In some embodiments, a cycloalkyl is a monocyclic cycloalkyl. Monocyclic cycloalkyls include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, and cyclooctyl. Polycyclic cycloalkyls include, for example, adamantyl, norbornyl (i.e., bicyclo[2.2.1]heptanyl), norbornenyl, decalinyl,

7,7-dimethyl-bicyclo[2.2.1]heptanyl, and the like.

[0057] The term "cycloalkylene" refers to a monocyclic or polycyclic aliphatic, non- aromatic divalent radical, wherein each of the atoms forming the ring (i.e. skeletal atoms) is a carbon atom. In some embodiments, cycloalkylene are spirocyclic or bridged compounds. In some embodiments, cycloalkylenes are optionally fused with an aromatic ring, and the point of attachment is at a carbon that is not an aromatic ring carbon atom. In some embodiments, cycloalkylene groups include groups having from 3 to 10 ring atoms. In some embodiments, cycloalkylene groups include groups having from 3 to 6 ring atoms.

[0058] The term "halo" or, alternatively, "halogen" or "halide" means fluoro, chloro, bromo or iodo. In some embodiments, halo is fluoro, chloro, or bromo.

[0059] The term "haloalkyl" refers to an alkyl in which one or more hydrogen atoms are replaced by a halogen atom. In one aspect, a fluoralkyl is a Ci-Cefluoroalkyl.

[0060] The term "fluoroalkyl" refers to an alkyl in which one or more hydrogen atoms are replaced by a fluorine atom. In one aspect, a fluoralkyl is a Ci-Cefluoroalkyl. In some embodiments, a fluoroalkyl is selected from trifluoromethyl, difluoromethyl, fluoromethyl, 2,2,2-trifluoroethyl, 1 -fluoromethyl -2 -fluoroethyl, and the like.

[0061] The term "heteroalkyl" refers to an alkyl group in which one or more skeletal atoms of the alkyl are selected from an atom other than carbon, e.g., oxygen, nitrogen (e.g. - H-, -N(alkyl)-, sulfur, or combinations thereof. A heteroalkyl is attached to the rest of the molecule at a carbon atom of the heteroalkyl. In one aspect, a heteroalkyl is a Ci-C ₆ heteroalkyl. [0062] The term "heteroalkylene" refers to an alkylene group in which one or more skeletal atoms of the alkylene are selected from an atom other than carbon, e.g., oxygen, nitrogen (e.g. - H-, -N(alkyl)-, sulfur, or combinations thereof. In some embodiments, a heteroalkylene is attached to the rest of the molecule at a carbon atom of the heteroalkylene. In one aspect, a heteroalkylene is a Ci-C ₆ heteroalkylene.

[0063] As used herein, the term "heteroatom" refers to an atom of any element other than carbon or hydrogen. In some embodiments, the heteroatom is nitrogen, oxygen, or sulfur. In some embodiments, the heteroatom is nitrogen or oxygen. In some embodiments, the heteroatom is nitrogen.

[0064] The term "heterocycle" or "heterocyclic" refers to heteroaromatic rings (also known as heteroaryls) and heterocycloalkyl rings (also known as heteroalicyclic groups) containing one to four heteroatoms in the ring(s), where each heteroatom in the ring(s) is selected from O, S and N, wherein each heterocyclic group has from 3 to 10 atoms in its ring system, and with the proviso that any ring does not contain two adjacent O or S atoms. In some

embodiments, heterocycles are monocyclic, bicyclic, polycyclic, spirocyclic or bridged compounds. Non-aromatic heterocyclic groups (also known as heterocycloalkyls) include rings having 3 to 10 atoms in its ring system and aromatic heterocyclic groups include rings having 5 to 10 atoms in its ring system. The heterocyclic groups include benzo-fused ring systems.

Examples of non-aromatic heterocyclic groups are pyrrolidinyl, tetrahydrofuranyl,

dihydrofuranyl, tetrahydrothienyl, oxazolidinonyl, tetrahydropyranyl, dihydropyranyl, tetrahydrothiopyranyl, piperidinyl, morpholinyl, thiomorpholinyl, thioxanyl, piperazinyl, aziridinyl, azetidinyl, oxetanyl, thietanyl, homopiperidinyl, oxepanyl, thiepanyl, oxazepinyl, diazepinyl, thiazepinyl, 1,2,3,6-tetrahydropyridinyl, pyrrolin-2-yl, pyrrolin-3-yl, indolinyl, 2H- pyranyl, 4H-pyranyl, dioxanyl, 1,3-dioxolanyl, pyrazolinyl, dithianyl, dithiolanyl,

dihydropyranyl, dihydrothienyl, dihydrofuranyl, pyrazolidinyl, imidazolinyl, imidazolidinyl, 3 - azabicyclo[3.1.0]hexanyl, 3-azabicyclo[4.1.0]heptanyl, 3H-indolyl, indolin-2-onyl, isoindolin-1- onyl, isoindoline-l,3-dionyl, 3,4-dihydroisoquinolin-l(2H)-onyl, 3,4-dihydroquinolin-2(lH)- onyl, isoindoline-l,3-dithionyl, benzo[d]oxazol-2(3H)-onyl, lH-benzo[d]imidazol-2(3H)-onyl, benzo[d]thiazol-2(3H)-onyl, and quinolizinyl. Examples of aromatic heterocyclic groups are pyridinyl, imidazolyl, pyrimidinyl, pyrazolyl, triazolyl, pyrazinyl, tetrazolyl, furyl, thienyl, isoxazolyl, thiazolyl, oxazolyl, isothiazolyl, pyrrolyl, quinolinyl, isoquinolinyl, indolyl, benzimidazolyl, benzofuranyl, cinnolinyl, indazolyl, indolizinyl, phthalazinyl, pyridazinyl, triazinyl, isoindolyl, pteridinyl, purinyl, oxadiazolyl, thiadiazolyl, furazanyl, benzofurazanyl, benzothiophenyl, benzothiazolyl, benzoxazolyl, quinazolinyl, quinoxalinyl, naphthyridinyl, and furopyridinyl. The foregoing groups are either C-attached (or C-linked) or N-attached where such is possible. For instance, a group derived from pyrrole includes both pyrrol- 1-yl (TV- attached) or pyrrol-3-yl (C-attached). Further, a group derived from imidazole includes imidazol-l-yl or imidazol-3-yl (both TV-attached) or imidazol-2-yl, imidazol-4-yl or imidazol-5-yl (all C-attached). The heterocyclic groups include benzo-fused ring systems. Non-aromatic heterocycles are optionally substituted with one or two oxo (=0) moieties, such as pyrrolidin-2- one. In some embodiments, at least one of the two rings of a bicyclic heterocycle is aromatic. In some embodiments, both rings of a bicyclic heterocycle are aromatic.

[0065] The terms "heteroaryl" or, alternatively, "heteroaromatic" refers to an aryl group that includes one or more ring heteroatoms selected from nitrogen, oxygen and sulfur.

Illustrative examples of heteroaryl groups include monocyclic heteroaryls and bicyclcic heteroaryls. Monocyclic heteroaryls include pyridinyl, imidazolyl, pyrimidinyl, pyrazolyl, triazolyl, pyrazinyl, tetrazolyl, furyl, thienyl, isoxazolyl, thiazolyl, oxazolyl, isothiazolyl, pyrrolyl, pyridazinyl, triazinyl, oxadiazolyl, thiadiazolyl, and furazanyl. Bicyclic heteroaryls include indolizine, indole, benzofuran, benzothiophene, indazole, benzimidazole, purine, quinolizine, quinoline, isoquinoline, cinnoline, phthalazine, quinazoline, quinoxaline, 1,8- naphthyridine, and pteridine. In some embodiments, a heteroaryl contains 0-4 N atoms in the ring. In some embodiments, a heteroaryl contains 1-4 N atoms in the ring. In some embodiments, a heteroaryl contains 0-4 N atoms, 0-1 O atoms, and 0-1 S atoms in the ring. In some

embodiments, a heteroaryl contains 1-4 N atoms, 0-1 O atoms, and 0-1 S atoms in the ring. In some embodiments, heteroaryl is a Ci-C ₉ heteroaryl. In some embodiments, monocyclic heteroaryl is a Ci-Csheteroaryl. In some embodiments, monocyclic heteroaryl is a 5-membered or 6-membered heteroaryl. In some embodiments, bicyclic heteroaryl is a Ce-Cgheteroaryl.

[0066] A "heterocycloalkyl" or "heteroalicyclic" group refers to a cycloalkyl group that includes at least one heteroatom selected from nitrogen, oxygen and sulfur. In some

embodiments, a heterocycloalkyl is a spirocyclic or bridged compound. In some embodiments, a heterocycloalkyl is fused with an aryl or heteroaryl. In some embodiments, the heterocycloalkyl is oxazolidinonyl, pyrrolidinyl, tetrahydrofuranyl, tetrahydrothienyl, tetrahydropyranyl, tetrahydrothiopyranyl, piperidinyl, morpholinyl, thiomorpholinyl, piperazinyl, piperidin-2-onyl, pyrrolidine-2,5-dithionyl, pyrrolidine-2,5-dionyl, pyrrolidinonyl, imidazolidinyl, imidazolidin-2- onyl, or thiazolidin-2-onyl. The term heteroalicyclic also includes all ring forms of the carbohydrates, including but not limited to the monosaccharides, the disaccharides and the oligosaccharides. In one aspect, a heterocycloalkyl is a C ₂ -Ci ₀ heterocycloalkyl. In another aspect, a heterocycloalkyl is a C4-Cioheterocycloalkyl. In some embodiments, a heterocycloalkyl contains 0-2 N atoms in the ring. In some embodiments, a heterocycloalkyl contains 0-2 N atoms, 0-2 O atoms and 0-1 S atoms in the ring. [0067] The term "bond" or "single bond" refers to a chemical bond between two atoms, or two moieties when the atoms joined by the bond are considered to be part of larger substructure. In one aspect, when a group described herein is a bond, the referenced group is absent thereby allowing a bond to be formed between the remaining identified groups.

[0068] The term "moiety" refers to a specific segment or functional group of a molecule.

Chemical moieties are often recognized chemical entities embedded in or appended to a molecule.

[0069] The term "optionally substituted" or "substituted" means that the referenced group is optionally substituted with one or more additional group(s) individually and independently selected from D, halogen, -CN, - H ₂ , - H(alkyl), -CH ₂ N(alkyl) ₂ , -N(alkyl) ₂ , -OH, -C0 ₂ H, - C0 ₂ alkyl, -CH ₂ H ₂ , -C(=0) H ₂ , -C(=0) H(alkyl), -C(=0)N(alkyl) ₂ , -S(=0) ₂ H ₂ , - S(=0) ₂ H(alkyl), -S(=0) ₂ N(alkyl) ₂ , alkyl, cycloalkyl, fluoroalkyl, heteroalkyl, alkoxy, fluoroalkoxy, heterocycloalkyl, aryl, heteroaryl, aryloxy, alkylthio, arylthio, alkylsulfoxide, arylsulfoxide, alkylsulfone, and arylsulfone. In some other embodiments, optional substituents are independently selected from D, halogen, -CN, -NH ₂ , -NH(CH ₃ ), -N(CH ₃ ) ₂ , -OH, -C0 ₂ H, - C0 ₂ (Ci-C ₄ alkyl), -CH ₂ NH ₂ , -C(=0)NH ₂ , -C(=0)NH(Ci-C ₄ alkyl), -C(=0)N(Ci-C ₄ alkyl) ₂ , - S(=0) ₂ NH ₂ , -S(=0) ₂ NH(Ci-C ₄ alkyl), -S(=0) ₂ N(Ci-C ₄ alkyl) ₂ , Ci-C ₄ alkyl, C ₃ -C ₆ cycloalkyl, Ci- C ₄ fluoroalkyl, Ci-C ₄ heteroalkyl, Ci-C ₄ alkoxy, Ci-C ₄ fluoroalkoxy, -SCi-C ₄ alkyl, -S(=0)Ci- C alkyl, and In some embodiments, optional substituents are independently selected from D, halogen, -CN, -NH ₂ , -OH, -NH(CH ₃ ), -N(CH ₃ ) ₂ , -CH ₃ , -CH ₂ CH ₃ , -CH ₂ NH ₂ , - CF ₃ , -OCH ₃ , and -OCF ₃ . In some embodiments, substituted groups are substituted with one or two of the preceding groups. In some embodiments, an optional substituent on an aliphatic carbon atom (acyclic or cyclic) includes oxo (=0).

[0070] A "tautomer" refers to a molecule wherein a proton shift from one atom of a molecule to another atom of the same molecule is possible. The compounds presented herein may, in certain embodiments, exist as tautomers. In circumstances where tautomerization is possible, a chemical equilibrium of the tautomers will exist. The exact ratio of the tautomers depends on several factors, including physical state, temperature, solvent, and pH. Some examples of tautomeric equilibrium include:

[0071] "Optional" or "optionally" means that a subsequently described event or circumstance may or may not occur and that the description includes instances when the event or circumstance occurs and instances in which it does not. For example, "optionally substituted aryl" means that the aryl radical may or may not be substituted and that the description includes both substituted aryl radicals and aryl radicals having no substitution.

[0072] "Pharmaceutically acceptable salt" includes both acid and base addition salts. A pharmaceutically acceptable salt of any one of the pyrazole compounds described herein is intended to encompass any and all pharmaceutically suitable salt forms. Preferred

pharmaceutically acceptable salts of the compounds described herein are pharmaceutically acceptable acid addition salts and pharmaceutically acceptable base addition salts.

[0073] "Pharmaceutically acceptable acid addition salt" refers to those salts which retain the biological effectiveness and properties of the free bases, which are not biologically or otherwise undesirable, and which are formed with inorganic acids such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, hydroiodic acid, hydrofluoric acid, phosphorous acid, and the like. Also included are salts that are formed with organic acids such as aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic acids, hydroxy alkanoic acids, alkanedioic acids, aromatic acids, aliphatic and. aromatic sulfonic acids, etc. and include, for example, acetic acid, trifluoroacetic acid, propionic acid, glycolic acid, pyruvic acid, oxalic acid, maleic acid, malonic acid, succinic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, cinnamic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, p-toluenesulfonic acid, salicylic acid, and the like. Exemplary salts thus include sulfates, pyrosulfates, bisulfates, sulfites, bisulfites, nitrates, phosphates, monohydrogenphosphates, dihydrogenphosphates, metaphosphates, pyrophosphates, chlorides, bromides, iodides, acetates, trifluoroacetates, propionates, caprylates, isobutyrates, oxalates, malonates, succinate suberates, sebacates, fumarates, maleates, mandelates, benzoates, chlorobenzoates, methylbenzoates, dinitrobenzoates, phthalates, benzenesulfonates, toluenesulfonates, phenylacetates, citrates, lactates, malates, tartrates, methanesulfonates, and the like. Also contemplated are salts of amino acids, such as arginates, gluconates, and galacturonates (see, for example, Berge S.M. et al., "Pharmaceutical Salts," Journal of Pharmaceutical Science, 66: 1-19 (1997)). Acid addition salts of basic compounds may be prepared by contacting the free base forms with a sufficient amount of the desired acid to produce the salt according to methods and techniques with which a skilled artisan is familiar.

[0074] "Pharmaceutically acceptable base addition salt" refers to those salts that retain the biological effectiveness and properties of the free acids, which are not biologically or otherwise undesirable. These salts are prepared from addition of an inorganic base or an organic base to the free acid. Pharmaceutically acceptable base addition salts may be formed with metals or amines, such as alkali and alkaline earth metals or organic amines. Salts derived from inorganic bases include, but are not limited to, sodium, potassium, lithium, ammonium, calcium, magnesium, iron, zinc, copper, manganese, aluminum salts and the like. Salts derived from organic bases include, but are not limited to, salts of primary, secondary, and tertiary amines, substituted amines including naturally occurring substituted amines, cyclic amines and basic ion exchange resins, for example, isopropylamine, trimethylamine, diethylamine, triethylamine, tripropylamine, ethanolamine, diethanolamine, 2-dimethylaminoethanol, 2-diethylaminoethanol, dicyclohexylamine, lysine, arginine, histidine, caffeine, procaine, N,N-dibenzylethylenediamine, chloroprocaine, hydrabamine, choline, betaine, ethylenediamine, ethylenedianiline, N- methylglucamine, glucosamine, methylglucamine, theobromine, purines, piperazine, piperidine, N-ethylpiperidine, polyamine resins and the like. See Berge et al., supra.

[0075] "Prodrug" is meant to indicate a compound that may be converted under physiological conditions or by solvolysis to a biologically active compound described herein. Thus, the term "prodrug" refers to a precursor of a biologically active compound that is pharmaceutically acceptable. A prodrug may be inactive when administered to a subject, but is converted in vivo to an active compound, for example, by hydrolysis. The prodrug compound often offers advantages of solubility, tissue compatibility or delayed release in a mammalian organism {see, e.g., Bundgard, H., Design of Prodrugs (1985), pp. 7-9, 21-24 (Elsevier,

Amsterdam).

[0076] A discussion of prodrugs is provided in Higuchi, T., et al., "Pro-drugs as Novel

Delivery Systems," A.C.S. Symposium Series, Vol. 14, and in Bioreversible Carriers in Drug Design, ed. Edward B. Roche, American Pharmaceutical Association and Pergamon Press, 1987. [0077] The term "prodrug" is also meant to include any covalently bonded carriers, which release the active compound in vivo when such prodrug is administered to a mammalian subject. Prodrugs of an active compound, as described herein, may be prepared by modifying functional groups present in the active compound in such a way that the modifications are cleaved, either in routine manipulation or in vivo, to the parent active compound. Prodrugs include compounds wherein a hydroxy, amino or mercapto group is bonded to any group that, when the prodrug of the active compound is administered to a mammalian subject, cleaves to form a free hydroxy, free amino or free mercapto group, respectively. Examples of prodrugs include, but are not limited to, acetate, formate and benzoate derivatives of alcohol or amine functional groups in the active compounds and the like.

[0078] The term "acceptable" with respect to a formulation, composition or ingredient, as used herein, means having no persistent detrimental effect on the general health of the subject being treated.

[0079] The term "modulate" as used herein, means to interact with a target either directly or indirectly so as to alter the activity of the target, including, by way of example only, to enhance the activity of the target, to inhibit the activity of the target, to limit the activity of the target, or to extend the activity of the target.

[0080] The term "modulator" as used herein, refers to a molecule that interacts with a target either directly or indirectly. The interactions include, but are not limited to, the interactions of an agonist, partial agonist, an inverse agonist, antagonist, degrader, or combinations thereof. In some embodiments, a modulator is an agonist.

[0081] The terms "administer," "administering", "administration," and the like, as used herein, refer to the methods that may be used to enable delivery of compounds or compositions to the desired site of biological action. These methods include, but are not limited to oral routes, intraduodenal routes, parenteral injection (including intravenous, subcutaneous, intraperitoneal, intramuscular, intravascular or infusion), topical and rectal administration. Those of skill in the art are familiar with administration techniques that can be employed with the compounds and methods described herein. In some embodiments, the compounds and compositions described herein are administered orally.

[0082] The terms "co-administration" or the like, as used herein, are meant to encompass administration of the selected therapeutic agents to a single patient, and are intended to include treatment regimens in which the agents are administered by the same or different route of administration or at the same or different time.

[0083] The terms "effective amount" or "therapeutically effective amount," as used herein, refer to a sufficient amount of an agent or a compound being administered, which will relieve to some extent one or more of the symptoms of the disease or condition being treated. The result includes reduction and/or alleviation of the signs, symptoms, or causes of a disease, or any other desired alteration of a biological system. For example, an "effective amount" for therapeutic uses is the amount of the composition comprising a compound as disclosed herein required to provide a clinically significant decrease in disease symptoms. An appropriate "effective" amount in any individual case is optionally determined using techniques, such as a dose escalation study.

[0084] The terms "enhance" or "enhancing," as used herein, means to increase or prolong either in potency or duration a desired effect. Thus, in regard to enhancing the effect of therapeutic agents, the term "enhancing" refers to the ability to increase or prolong, either in potency or duration, the effect of other therapeutic agents on a system. An "enhancing-effective amount," as used herein, refers to an amount adequate to enhance the effect of another therapeutic agent in a desired system.

[0085] The term "pharmaceutical combination" as used herein, means a product that results from the mixing or combining of more than one active ingredient and includes both fixed and non-fixed combinations of the active ingredients. The term "fixed combination" means that the active ingredients, e.g. a compound described herein, or a pharmaceutically acceptable salt thereof, and a co-agent, are both administered to a patient simultaneously in the form of a single entity or dosage. The term "non-fixed combination" means that the active ingredients, e.g. a compound described herein, or a pharmaceutically acceptable salt thereof, and a co-agent, are administered to a patient as separate entities either simultaneously, concurrently or sequentially with no specific intervening time limits, wherein such administration provides effective levels of the two compounds in the body of the patient. The latter also applies to cocktail therapy, e.g. the administration of three or more active ingredients.

[0086] The terms "kit" and "article of manufacture" are used as synonyms.

[0087] The term "subject" or "patient" encompasses mammals. Examples of mammals include, but are not limited to, any member of the Mammalian class: humans, non-human primates such as chimpanzees, and other apes and monkey species; farm animals such as cattle, horses, sheep, goats, swine; domestic animals such as rabbits, dogs, and cats; laboratory animals including rodents, such as rats, mice and guinea pigs, and the like. In one aspect, the mammal is a human.

[0088] As used herein, "treatment" or "treating " or "palliating" or "ameliorating" are used interchangeably herein. These terms refers to an approach for obtaining beneficial or desired results including but not limited to therapeutic benefit and/or a prophylactic benefit. By "therapeutic benefit" is meant eradication or amelioration of the underlying disorder being treated. Also, a therapeutic benefit is achieved with the eradication or amelioration of one or more of the physiological symptoms associated with the underlying disorder such that an improvement is observed in the patient, notwithstanding that the patient may still be afflicted with the underlying disorder. For prophylactic benefit, the compositions may be administered to a patient at risk of developing a particular disease, or to a patient reporting one or more of the physiological symptoms of a disease, even though a diagnosis of this disease may not have been made.

Compounds

[0089] Compounds described herein, including pharmaceutically acceptable salts, and pharmaceutically acceptable solvates thereof, that modulate IRE1 mediated signaling, directly or indirectly.

[0090] Provided in one aspect is a compound of Formula (I), or a pharmaceutically acceptable salt, or solvate thereof:

Formula (I)

wherein, is a substituted C ₃ -Ci ₀ cycloalkyl that is substituted with 1-3R ¹ and 0-3R ² ; Each R ¹ is independently -OR ⁶ , -SR ⁶ , -S(=0)R ⁷ , -S(=0) ₂ R ⁷ , or -N(R ⁶ ) ₂ ;

Each R ² is independently H, halogen, -CN, -OR ⁸ , -SR ⁸ , -S(=0)R ⁹ , -S(=0) ₂ R ⁹ , -

S(=0) ₂ N(R ⁸ ) ₂ , - R ⁸ S(=0) ₂ R ⁹ , -C(=0)R ⁹ , -OC(=0)R ⁹ , -C0 ₂ R ⁸ , -OC0 ₂ R ⁹ , -N(R ⁸ ) ₂ , - OC(=0)N(R ⁸ ) ₂ , - R ⁸ C(=0)R ⁹ , - R ⁸ C(=0)OR ⁹ , optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ fluoroalkyl, optionally substituted Ci-C ₄ heteroalkyl, optionally substituted C ₃ -C ₆ cycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;

Each R ⁶ is independently H, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci- C ₄ heteroalkyl, optionally substituted Ci-C ₄ fluoroalkyl, -X-optionally substituted Ci- C ₄ alkyl, -X-optionally substituted Ci-C ₄ heteroalkyl, -X-optionally substituted Ci- C ₄ fluoroalkyl, optionally substituted C ₃ -C ₆ cycloalkyl, optionally substituted C ₂ - Cioheterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl; Or two R ⁶ are taken together with the N atom to which they are attached to form an optionally substituted heterocycle;

X is -(C=0)-;

Each R ⁷ is independently optionally substituted Ci-C ₄ alkyl, optionally substituted Ci- C ₄ heteroalkyl, or optionally substituted Ci-C ₄ fluoroalkyl, optionally substituted C ₃ - C ₆ cycloalkyl, optionally substituted C ₂ -Ci ₀ heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;

Each R ⁸ is independently H, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci- C ₄ heteroalkyl, optionally substituted Ci-C ₄ fiuoroalkyl, , optionally substituted C ₃ - C ₆ cycloalkyl, optionally substituted C ₂ -Ci ₀ heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;

Or two R ⁸ are taken together with the N atom to which they are attached to form an

optionally substituted heterocycle;

Each R ⁹ is independently optionally substituted Ci-C ₄ alkyl, optionally substituted Ci- C ₄ heteroalkyl, or optionally substituted Ci-C ₄ fluoroalkyl, optionally substituted C ₃ - C ₆ cycloalkyl, optionally substituted C ₂ -Cioheterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;

A ² is N or CR ^A ;

R ^A , R ^A1 , R ^A2 , R ^A3 are each independently H, halogen, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ fiuoroalkyl, optionally substituted aryl, or -OR ¹⁰ ;

or R^ or R^ are taken together with the carbon atoms that they are attached to form an optionally substituted carbocycle;

R ¹⁰ is independently H, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci- C ₄ fiuoroalkyl;

L ¹ and L ² are each independently -CHY-, -CH ₂ - or - H-; with the provision that if L ¹ is -

CHY- or -CH ₂ -, then L ² is -NH- or if L ² is -CHY- or -CH ₂ -, then L ¹ is H;

Y is -OH, - H ₂ , or optionally substituted Ci-C ₄ alkyl;

R ³ and R ⁵ are each independently H, halogen, -CN, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ fiuoroalkyl, or -OR ¹¹ ;

R ¹¹ is independently H, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci-

C ₄ fluoroalkyl;

R ⁴ is H, halogen, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci- C ₄ fluoroalkyl, or -OR ^D ; R ^D is H, optionally substituted Ci-C ₄ alkyl, optionally substituted heterocyclyl containing at least one N atom, or -(optionally substituted C ₁ -C ₄ alkylene)-N(R ¹² ) ₂ ; wherein if R ^E is substituted then R ^D is substituted with 0-4 R ¹³ ;

R ¹² is independently H, or optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci-

C ₄ fluoroalkyl;

Each R ¹³ is independently H, halogen, -CN, -OR ¹⁴ , -SR ¹⁴ , -S(=0)R ¹⁵ , -S(=0) ₂ R ¹⁵ , - S(=0) ₂ N(R ¹⁴ ) ₂ , - R ¹⁴ S(=0) ₂ R ¹⁵ , -C(=0)R ¹⁵ , -OC(=0)R ¹⁵ , -C0 ₂ R ¹⁴ , -OC0 ₂ R ¹⁵ , - N(R ¹⁴ ) ₂ , -OC(=0)N(R ¹⁴ ) ₂ , - R ¹⁴ C(=0)R ¹⁵ , - R ¹⁴ C(=0)OR ¹⁵ , optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ fluoroalkyl, optionally substituted Ci- C ₄ heteroalkyl, optionally substituted C ₃ -C ₆ cycloalkyl, optionally substituted C ₂ - Cioheterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl;

Each R ¹⁴ is independently hydrogen, optionally substituted Ci-C ₄ alkyl, optionally

substituted Ci-C ₄ fluoroalkyl, optionally substituted Ci-C ₄ heteroalkyl, optionally substituted C ₃ -Ci ₀ cycloalkyl, optionally substituted C ₂ -Ci ₀ heterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl; or

two R ¹⁴ are taken together with the N atom to which they are attached to form an

optionally substituted heterocycle, and

Each R ¹⁵ is independently optionally substituted Ci-C ₄ alkyl, optionally substituted Ci- C ₄ fluoroalkyl, optionally substituted Ci-C ₄ heteroalkyl, optionally substituted C ₃ - Ciocycloalkyl, optionally substituted C ₂ -Cioheterocycloalkyl, optionally substituted aryl, or optionally substituted heteroaryl.

[0091] In some embodiments, substituted C ₄ -C7 cycloalkyl that is substituted with 1-3R ¹ and 0-3R ² .

q is 0, 1, 2, or 3. [0093] In some embodiments is

q is 0, 1, 2, or 3.

[0094] In some embodiments is

q is 0, 1, 2, or 3.

[0095] In some embodiments, q is 0 or 1. In some embodiments, each R ⁶ is

independently H, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ heteroalkyl, optionally substituted Ci-C ₄ fluoroalkyl, -X-optionally substituted Ci-C ₄ alkyl, -X-optionally substituted Ci-C ₄ heteroalkyl, or -X-optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, each R ² is independently H, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ heteroalkyl, or optionally substituted Ci-C ₄ fluoroalkyl.

[0096] In some embodiments is

R ⁶ is H, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ heteroalkyl, optionally substituted Ci-C ₄ fluoroalkyl, -X-optionally substituted Ci-C ₄ alkyl, -X-optionally substituted Ci- C ₄ heteroalkyl, or -X-optionally substituted Ci-C ₄ fluoroalkyl;

q is 0 or 1; and

R ² is H, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ heteroalkyl, or optionally substituted Ci-C ₄ fluoroalkyl.

[0097] In some embodiments, A ² is N. In some embodiments, A ² is CR ^A . In some embodiments, R ^A is H, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci- C ₄ fluoroalkyl. In some embodiments, R ^A is H. In some embodiments, R ^A1 is H, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R ^A1 is H. In some embodiments, R ^A2 is H, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R^ is H. In some embodiments, R ^A3 is H, halogen, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ fluoroalkyl, optionally substituted aryl, or -OR ¹⁰ _. In some embodiments, R ^A3 is H, halogen, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ fluoroalkyl, or -OR ¹⁰ _. In some embodiments, R ^A3 is optionally substituted Ci-C ₄ alkyl In some embodiments, R ^A3 is methyl, ethyl, propyl or butyl _. In some embodiments, R ^A3 is -OR ¹⁰ and R ¹⁰ is methyl, ethyl, propyl or butyl _. In some embodiments, L ¹ aanndd LL ²² aarree eeaacchh -- HH--.. IInn ssoommee eemmbbooddiimments, L ¹ is -CH ₂ - and L ² is - H-. In some

embodiments, L ¹ is -NH- and L ² is -CH ₂ -

[0098] In some embodiments,

[0099]

[00100] In some embodiments, R ³ is H, halogen, -CN, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R ³ is optionally substituted Ci-C ₄ alkyl. In some embodiments, R ³ is methyl, ethyl, propyl, or butyl. In some embodiments, R ³ is optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R ³ is -CF ₃ or -CH ₂ CF ₃ . In some embodiments, R ⁵ is H, halogen, -CN, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R ⁵ is H. In some embodiments, R ⁵ is optionally substituted Ci-C ₄ alkyl. In some embodiments, R ⁵ is methyl, ethyl, propyl, or butyl. In some embodiments, R ⁵ is optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R ⁵ is - CF ₃ or -CH ₂ CF ₃ . In some embodiments, R ⁴ is H. In some embodiments, R ⁴ is -OR ^D . In some embodiments, R ^D is optionally substituted heterocyclyl containing at least one N atom; wherein if R ^D is substituted then R ^D is substituted with 0-4 R ¹³ .

[00101] In some embodiments, R ^D is:

r is 0, 1, or 2.

D is:

[00103] In some embodiments, R ^D is -(optionally substituted C ₁ -C ₄ alkylene)-N(R ¹² ) ₂ ; wherein if R ^D is substituted then R ^D is substituted with 0-4 R ¹³ . In some embodiments, R ^D is - CH ₂ -CH ₂ -CH ₂ -CH ₂ -N(R ¹² ) ₂ , -CH ₂ -CH ₂ -CH ₂ -N(R ¹² ) ₂ , -CH ₂ -CH ₂ -N(R ¹² ) ₂ , or -CH ₂ -N(R ¹² ) ₂ . In some embodiments, each R ¹² is independently H or Ci-C ₄ alkyl.

[00104] In some embodiments the compound has the structure of formula (la)

[00105] In some embodiments, the compound has the structure of formula (lb)

[00106] In some embodiments, the compound has the structure of formula (Ic)

[00107] In so me embodiments,

q is 0 or 1.

[00108] In some embodiments, each R is independently H, optionally substituted Ci-

C ₄ alkyl, optionally substituted Ci-C ₄ heteroalkyl, optionally substituted Ci-C ₄ fluoroalkyl, -X- optionally substituted Ci-C ₄ alkyl, -X-optionally substituted Ci-C ₄ heteroalkyl, or -X-optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, each R ² is independently H, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ heteroalkyl, or optionally substituted Ci- C ₄ fluoroalkyl. In some embodiments, A ² is N. In some embodiments, A ² is CR ^A . In some embodiments, R ^A is H, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci- C ₄ fiuoroalkyl. In some embodiments, R ^A is H. In some embodiments, R ^A1 is H, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R ^A1 is H. In some embodiments, R ^A2 is H, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R^ is H. In some embodiments, R ^A3 is H, halogen, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ fluoroalkyl, optionally substituted aryl, or -OR ¹⁰ _. In some embodiments, R ^A3 is H, halogen, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ fiuoroalkyl, or -OR ¹⁰ _. In some embodiments, R ^A3 is optionally substituted Ci-C ₄ alkyl In some embodiments, R ^A3 is methyl, ethyl, propyl or butyl _. In some embodiments, L ¹ and L ² are each - H-. In some embodiments, L ¹ is -CH ₂ - and L ² is - H-. In some embodiments, L ¹ is - H- and L ² is -CH ₂ -. In some embodiments, R ³ is halogen, -CN, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci-C ₄ fluoroalkyl. In some

embodiments, R ³ is optionally substituted Ci-C ₄ alkyl. In some embodiments, R ³ is methyl, ethyl, propyl, or butyl. In some embodiments, R ³ is optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R ³ is -CF ₃ or -CH ₂ CF ₃ . In some embodiments, R ⁵ is H, halogen, -CN, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R ⁵ is H. In some embodiments, R ⁵ is optionally substituted Ci-C ₄ alkyl. In some embodiments, R ⁵ is methyl, ethyl, propyl, or butyl. In some embodiments, R ⁵ is optionally substituted Ci- C ₄ fluoroalkyl. In some embodiments, R ⁵ is -CF ₃ or -CH ₂ CF ₃ .

00109] In some embodiments, the compound has the structure of formula (Id)

q is 0 or 1.

[00111] In some embodiments, each R ⁶ is independently H, optionally substituted Ci-

C ₄ alkyl, optionally substituted Ci-C ₄ heteroalkyl, optionally substituted Ci-C ₄ fluoroalkyl, -X- optionally substituted Ci-C ₄ alkyl, -X-optionally substituted Ci-C ₄ heteroalkyl, or -X-optionally substituted Ci-C ₄ fiuoroalkyl. In some embodiments, each R ² is independently H, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ heteroalkyl, or optionally substituted Ci- C ₄ fluoroalkyl. In some embodiments, A ² is N. In some embodiments, A ² is CR ^A . In some embodiments, R ^A is H, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci- C ₄ fluoroalkyl. In some embodiments, R ^A is H. In some embodiments, R ^A1 is H, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R ^A1 is H. In some embodiments, R ^A2 is H, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R^ is H. In some embodiments, R ^A3 is H, halogen, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ fluoroalkyl, optionally substituted aryl, or -OR ¹⁰ _. In some embodiments, R ^A3 is H, halogen, optionally substituted Ci-C ₄ alkyl, optionally substituted Ci-C ₄ fiuoroalkyl, or -OR ¹⁰ _. In some embodiments, R ^A3 is optionally substituted Ci-C ₄ alkyl _. In some embodiments, R ^A3 is methyl, ethyl, propyl or butyl _. In some embodiments, L ¹ and L ² are each - H-. In some embodiments, L ¹ is -CH ₂ - and L ² is - H-. In some embodiments, L ¹ is -NH- and L ² is -CH ₂ -. In some embodiments, R ³ is H, halogen, -CN, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci-C ₄ fluoroalkyl. In some

embodiments, R ³ is optionally substituted Ci-C ₄ alkyl. In some embodiments, R ³ is methyl, ethyl, propyl, or butyl. In some embodiments, R ³ is optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R ³ is -CF ₃ or -CH ₂ CF ₃ . In some embodiments, R ⁵ is H, halogen, -CN, optionally substituted Ci-C ₄ alkyl, or optionally substituted Ci-C ₄ fluoroalkyl. In some embodiments, R ⁵ is H. In some embodiments, R ⁵ is optionally substituted Ci-C ₄ alkyl. In some embodiments, R ⁵ is methyl, ethyl, propyl, or butyl. In some embodiments, R ⁵ is optionally substituted Ci- C ₄ fluoroalkyl. In some embodiments, R ⁵ is -CF ₃ or -CH ₂ CF ₃ . In some embodiments, R ^D is optionally substituted heterocyclyl containing at least one N atom; wherein if R ^D is substituted then R ^D is substituted with 0-4 R ¹³ .

D is:

[00113] In some embodiments, R ^D is -(optionally substituted C ₁ -C ₄ alkylene)-N(R ¹² ) ₂ ; wherein if R ^D is substituted then R ^D is substituted with 0-4 R ¹³ . In some embodiments, R ^D is - CH ₂ -CH ₂ -CH ₂ -CH ₂ -N(R ¹² ) ₂ , -CH ₂ -CH ₂ -CH ₂ -N(R ¹² ) ₂ , -CH ₂ -CH ₂ -N(R ¹² ) ₂ , or -CH ₂ -N(R ¹² ) ₂ . In some embodiments, each R ¹² is independently H or Ci-C ₄ alkyl.

[00114] In some embodiments, a compound described herein is selected from any one of the compounds from the following table:

Table 1

(trifluoromethyl)phenyl)urea

-

mide

etamide

etamide

IREl -like Family of Proteins

[00115] In some embodiments, a compound disclosed herein selectively binds to a protein of the IREl family of proteins. Exemplary IREl family proteins include IREl or IREla. Other exemplary IREl family proteins include IREl homologues or orthologues in other organisms. Exemplary organisms include human, non-human primate, mouse, rat, chicken, fruit fly, yeast, and others listed in Table 2. In some embodiments, the IREl protein is human IREla. Table 2

[00116] In some embodiments, a compound disclosed herein selectively binds to an IRE1 family protein comprising a kinase domain and/or an RNase domain. In some embodiments, the kinase domain is a trans-autophosphorylation kinase domain. In some embodiments, the IRE1 family protein is IREla. An example arrangement of domains within an IREla protein is depicted in Figure 1. An example alignment of IREl family protein orthologues is depicted in Figure 2

[00117] In some embodiments, a compound disclosed herein selectively binds to a trans- autophosphorylation kinase domain region of IREla. In some embodiments, a compound disclosed herein selectively binds to a trans-autophosphorylation kinase domain region of IREla, for example within amino acid residues 568-833 of SEQ ID NO: 1, or equivalent amino acid residues thereof.

[00118] In some embodiments, a compound disclosed herein selectively binds to an ATP- binding pocket within a trans-autophosphorylation kinase domain region of IREla. In some embodiments, a compound disclosed herein selectively binds to an ATP -binding pocket within a trans-autophosphorylation kinase domain region of IREla, for example, one or more of amino acid resides 577-711, 577-586, 597, 599, 626, 642-643, 645, 648, 688, 692-693, 695, or 711 of SEQ ID NO: 1, or equivalent amino acid residues thereof.

[00119] In some embodiments, a compound disclosed herein selectively binds to an activation loop within a trans-autophosphorylation kinase domain region of IREla. In some embodiments, a compound disclosed herein selectively binds to an activation loop within a trans- autophosphorylation kinase domain region of IREla, for example, one or more of amino acid residues 710-736, 710-725, or 729-736 of SEQ ID NO: 1, or equivalent amino acid residues thereof.

[00120] In some embodiments, a compound disclosed herein selectively binds to an RNase domain region of IREla. In some embodiments, a compound disclosed herein selectively binds to an RNase domain region of IREla, for example within amino acid residues 835-963 of SEQ ID NO: 1, or equivalent amino acid residues thereof.

[00121] In some embodiments, a compound disclosed herein selectively binds to a kinase domain dimer interface amino acid residue. In some embodiments, a compound disclosed herein selectively binds to a kinase domain dimer interface amino acid residue, such as one or more of amino acid residues 569-701, 569, 591, 592, 594, 617, 620 ,627, 628, 631, 674, 678, or 701 of

SEQ ID NO: 1.

[00122] In some embodiments, a compound disclosed herein selectively binds to a first IREla and blocks dimerization between kinase domain dimer interface amino acid residues of the first IREla and a second IREla. In some embodiments, a compound disclosed herein selectively binds to a first IREla, and inhibit dimerization at one or more of amino acid residues 569-701, 569, 591, 592, 594, 617, 620 ,627, 628, 631, 674, 678, or 701 of SEQ ID NO: 1.

[00123] In some embodiments, a compound disclosed herein selectively binds to a kinase- extension nuclease (KEN) domain dimer interface amino acid residue of an IREla. In some embodiments, a compound disclosed herein selectively binds to a KEN domain dimer interface amino acid residue, such as one or more of amino acid residues 840-925, 840, 844, 851, 908, 912, or 925 of SEQ ID NO: 1.

[00124] In some embodiments, a compound disclosed herein selectively binds to amino acid residues of a nuclease active site. In some embodiments, a compound disclosed herein selectively binds to amino acid residues of a nuclease active site, such as one or more of amino acid residues 847-910, 847, 850, 886, 888, 889, 890, 892, 902, 905, 906, or 910 of SEQ ID NO: 1.

[00125] In some embodiments, a compound disclosed herein selectively binds to an RNase domain and a trans-autophosphorylation kinase domain region of IREla. In some embodiments, a compound disclosed herein selectively binds to an RNase domain and an ATP -binding pocket within a trans-autophosphorylation kinase domain region of IREla. In some embodiments, a compound disclosed herein selectively binds to an RNase domain and an activation loop within a trans autophosphorylation kinase domain region of IREla.

[00126] In some embodiments, a compound disclosed herein selectively binds to IREla at two sites located in an RNase domain, trans-autophosphorylation kinase domain region, ATP- binding pocket, activation loop, or any combination thereof. In some embodiments, a compound disclosed herein selectively binds to IREla at two or more sites. In some embodiments, a compound disclosed herein selectively binds to IREla at two or more sites located in an RNase domain, trans-autophosphorylation kinase domain region, ATP -binding pocket, activation loop, or any combination thereof. In some embodiments, a compound disclosed herein selectively binds to IREla at three sites located in an RNase domain, trans-autophosphorylation kinase domain region, ATP -binding pocket, activation loop, or any combination thereof.

[00127] In some embodiments, a compound disclosed herein selectively binds to IREla at a first site located in an RNase domain, trans-autophosphorylation kinase domain region, ATP- binding pocket, or activation loop. In some embodiments, a first site comprises one or more of any amino acid residue within amino acid residues 465-977 of SEQ ID NO: 1. In some embodiments, a compound disclosed herein selectively binds to IREla at a second site located in an RNase domain, trans-autophosphorylation kinase domain region, ATP -binding pocket, or activation loop. In some examples, the first site is located within the same domain or region as the second site. In some examples, the first site is located within a different domain or region as the second site.

[00128] In some embodiments, a compound disclosed herein selectively binds to first

IREla, thereby blocking dimerization of the first IREla to a second IREla. In some

embodiments, a compound disclosed herein selectively binds to first IREla, thereby blocking auto-transphosphorylation of the first IREla or a second IREla to which the first IREla is dimerized. In some embodiments, a compound disclosed herein selectively binds to a first IREl a, thereby blocking activation of the first IREla or a second IREla to which the first IREla is dimerized. In some embodiments, a compound disclosed herein selectively binds to a first IREl a, thereby blocking kinase activity of the first IREla or a second IREla to which the first IREla is dimerized. In some embodiments, a compound disclosed herein selectively binds to a first IREl a, thereby blocking RNase activity of the first IREla or a second IREla to which the first IREla is dimerized.

[00129] In some embodiments, a compound disclosed herein selectively binds to IREla when in a homo-dimerized conformation. In some embodiments, a compound disclosed herein selectively binds to IREla when in an oligomerized conformation. In some embodiments, a compound disclosed herein selectively binds to IREla when in a non-oligomerized or non- dimerized conformation. In some embodiments, a compound disclosed herein selectively binds to IREla when in an ATP -bound state. In some embodiments, a compound disclosed herein selectively binds to a IREl family protein when in a non-ATP -bound state. In some

embodiments, the compound is a pharmaceutically acceptable salt, or solvate thereof.

IREl Signaling Pathway

[00130] In some embodiments, a compound disclosed herein selectively binds to an IREl family protein and alters a downstream signaling pathway. In some embodiments, a compound disclosed herein selectively binds to an IREl family protein and alters signaling of

immunoglobulin heavy-chain binding protein (BIP), protein kinase R (PKR)-like endoplasmic reticulum kinase (PERK), glucose regulate protein 78 (Grp78), eukaryotic translation initiation factor 2a (eIF2a), X-box binding protein 1 (XBP1), activating transcription factor 6a (ATF6a), C/EBP homologous protein (CHOP), growth arrest and DNA damage-inducible protein 34 (GADD34), tumor necrosis factor receptor-associated factor 2 (TRAF2), JUN N-terminal kinase (JNK), regulated IRE 1 -dependent decay (RIDD), transcriptionally active XBP1 (XBPls), or unspliced XBP1 (XBPlu). In some embodiments, a compound disclosed herein selectively binds to an IREl family protein and alters a downstream cellular process. In some embodiments, an IRE1 family protein is IREl, IREl a, or ERN1.

[00131] In some embodiments, a compound disclosed herein selectively binds to an IREl family protein and decreases or blocks a downstream signaling pathway. In some embodiments, a compound disclosed herein selectively binds to an IREl family protein and decreases or blocks activity or signaling of TXNIP, Caspase 1, Interleukin 1-beta, JNK, Bim, cytochrome C, Caspase 3, Caspase 8, mRNA degradation, miRNA degradation, apoptotosis-inducing proteins, or inflammation -inducing proteins. In some embodiments, a compound disclosed herein selectively binds to an IREl family protein and decreases XBP1 mRNA levels. In some embodiments, a compound disclosed herein selectively binds to an IREl family protein and decreases

transcriptionally active XBP1 (XBPls) mRNA levels. In some embodiments, a compound disclosed herein selectively binds to an IREl family protein and decreases spliced XBP1 mRNA levels. In some embodiments, an IREl family protein is IREl, IREla, or ERN1.

[00132] In some embodiments, a compound disclosed herein selectively binds to an IREl family protein and increases, activates, or removes a block of a downstream signaling pathway. In some embodiments, a compound disclosed herein selectively binds to an IREl family protein and increases, activates, or removes a block of activity or signaling of Bcl2, Bel -XL, Mcl-1, Bax, Bak, other anti-apoptotic proteins, or an mRNA translocon proteins. In some embodiments, an IREl family protein is IREl, IREla, or ERN1.

[00133] In some embodiments, a compound disclosed herein selectively binds to an IRElfamily protein and disrupts binding with an effector protein. In some cases, the effector protein binds to the IREl family protein when in a dimerized or oligomerized state. In some cases, the effector protein binds to the IREl family protein when in a non-dimerized or non- oligomerized state. In some cases, the effector protein is immunoglobulin heavy-chain binding protein (BIP), protein kinase R (PKR)-like endoplasmic reticulum kinase (PERK), glucose regulate protein 78 (Grp78), tumor necrosis factor receptor-associated factor 2 (TRAF2), JUN N- terminal kinase (JNK), transcriptionally active XBP1 (XBPls), unspliced XBP1 (XBPlu), regulated IREl -dependent decay (RIDD), Heat shock protein 90 kDa alpha (HSP 90-alpha), or misfolded protein. In some embodiments, an IREl family protein is IREl, IREla, or ERN1.

[00134] In some embodiments, a compound disclosed herein selectively binds to an IREl family protein and alters activity of a cellular process or cellular function, such as regulated IREl -dependent decay (RIDD), RNA decay, translation, autophagy, cell survival, ER protein folding, ERAD, reactive oxygen species generation, transport, ER-associated protein degradation (ERAD), protein synthesis, or apoptosis. In some embodiments, where an altered or lack of a cellular process or cellular function is associate with a disease state, selective binding of a compound disclosed herein results in inhibiting or alleviating the disease state, or inhibiting a deleterious activity associated with the disease state. In some embodiments, an IRE1 family protein is IRE1, IREla, or ERN1.

Diseases Associated with Altered IRE1 Pathway Signaling

[00135] In some cases, a compound disclosed herein is used to treat or ameliorate a disease associated with altered IREla pathway signaling when administered to a subject in need thereof. In some cases, a compound disclosed herein is used to treat or ameliorate the effects of a disease associated with altered IREla pathway signaling when administered to a subject in need thereof. Exemplary disease associated with altered IREla signaling include cancer. In some cases, a compound disclosed herein is used to treat or ameliorate a cancer when administered to a subject in need thereof. Exemplary cancers include tumors, solid and hematologic cancers. In some cases, a compound disclosed herein is used to treat or ameliorate a cell proliferative disorder when administered to a subject in need thereof. In some cases, the cell proliferative disorder is a cancer. In some cases, the cancer is ovarian cancer, lung cancer, bladder cancer, breast cancer, triple negative breast cancer (T BC).

[00136] An IREla pathway can be involved in a variety of pathological conditions, including neurodegenerative diseases, inflammation, metabolic disorders, liver dysfunction, brain ischemia, heart ischemia, autoimmune diseases, and cancer. In some cases, modulation of this pathway provides therapeutic methods useful for treatment of such diseases.

[00137] In some instances, a compound disclosed herein is used to reinforce anti-tumor mechanisms. In some cases, an anti-tumor mechanism comprises direct inhibition of tumor growth. In some cases, an anti-tumor mechanism comprises induction of anti-tumor immunity. In some cases, anti-tumor mechanisms comprise direct inhibition of tumor growth and simultaneous induction of anti-tumor immunity. In some cases, a compound disclosed herein can prevent lipid accumulation in myeloid cells exposed to ovarian cancer-derived ascites supernatants. In some cases, a compound disclosed herein can block myeloid cell

immunosuppression mediated by tumor-associated factors. In some cases, a compound disclosed herein can be employed as therapeutic compound that enhances dendritic cell and T cell antitumor activity in mammals. For example, the compounds disclosed herein can be used to treat murine and human ovarian cancers. Methods of Dosing and Treatment Regimens

[00138] In one embodiment, the compounds described herein, or a pharmaceutically acceptable salt thereof, are used in the preparation of medicaments for the treatment of diseases or conditions in a mammal that would benefit from administration of any one of the compounds disclosed. Methods for treating any of the diseases or conditions described herein in a mammal in need of such treatment, involves administration of pharmaceutical compositions that include at least one compound described herein or a pharmaceutically acceptable salt, active metabolite, prodrug, or pharmaceutically acceptable solvate thereof, in therapeutically effective amounts to said mammal.

[00139] In certain embodiments, the compositions containing the compound(s) described herein are administered for prophylactic and/or therapeutic treatments. In certain therapeutic applications, the compositions are administered to a patient already suffering from a disease or condition, in an amount sufficient to cure or at least partially arrest at least one of the symptoms of the disease or condition. Amounts effective for this use depend on the severity and course of the disease or condition, previous therapy, the patient's health status, weight, and response to the drugs, and the judgment of the treating physician. Therapeutically effective amounts are optionally determined by methods including, but not limited to, a dose escalation and/or dose ranging clinical trial.

[00140] In prophylactic applications, compositions containing the compounds described herein are administered to a patient susceptible to or otherwise at risk of a particular disease, disorder or condition. Such an amount is defined to be a "prophylactically effective amount or dose." In this use, the precise amounts also depend on the patient's state of health, weight, and the like. When used in patients, effective amounts for this use will depend on the severity and course of the disease, disorder or condition, previous therapy, the patient's health status and response to the drugs, and the judgment of the treating physician. In one aspect, prophylactic treatments include administering to a mammal, who previously experienced at least one symptom of the disease being treated and is currently in remission, a pharmaceutical composition comprising a compound described herein, or a pharmaceutically acceptable salt thereof, in order to prevent a return of the symptoms of the disease or condition.

[00141] In certain embodiments wherein the patient's condition does not improve, upon the doctor's discretion the administration of the compounds are administered chronically, that is, for an extended period of time, including throughout the duration of the patient's life in order to ameliorate or otherwise control or limit the symptoms of the patient's disease or condition.

[00142] In certain embodiments wherein a patient's status does improve, the dose of drug being administered is temporarily reduced or temporarily suspended for a certain length of time (e.g., a "drug holiday"). In specific embodiments, the length of the drug holiday is between 2 days and 1 year, including by way of example only, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 10 days, 12 days, 15 days, 20 days, 28 days, or more than 28 days. The dose reduction during a drug holiday is, by way of example only, by 10%-100%, including by way of example only 10%, 15%, 20%, 25%), 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, and 100%.

[00143] Once improvement of the patient's conditions has occurred, a maintenance dose is administered if necessary. Subsequently, in specific embodiments, the dosage or the frequency of administration, or both, is reduced, as a function of the symptoms, to a level at which the improved disease, disorder or condition is retained. In certain embodiments, however, the patient requires intermittent treatment on a long-term basis upon any recurrence of symptoms.

[00144] The amount of a given agent that corresponds to such an amount varies depending upon factors such as the particular compound, disease condition and its severity, the identity (e.g., weight, sex) of the subject or host in need of treatment, but nevertheless is determined according to the particular circumstances surrounding the case, including, e.g., the specific agent being administered, the route of administration, the condition being treated, and the subject or host being treated.

[00145] In general, however, doses employed for adult human treatment are typically in the range of 0.01 mg to 5000 mg per day. In one aspect, doses employed for adult human treatment are from about 1 mg to about 1000 mg per day. In one embodiment, the desired dose is conveniently presented in a single dose or in divided doses administered simultaneously or at appropriate intervals, for example as two, three, four or more sub-doses per day.

[00146] In one embodiment, the daily dosages appropriate for the compound described herein, or a pharmaceutically acceptable salt thereof, are from about 0.01 mg/kg to about 50 mg/kg per body weight. In some embodiments, the daily dosage or the amount of active in the dosage form are lower or higher than the ranges indicated herein, based on a number of variables in regard to an individual treatment regime. In various embodiments, the daily and unit dosages are altered depending on a number of variables including, but not limited to, the activity of the compound used, the disease or condition to be treated, the mode of administration, the requirements of the individual subject, the severity of the disease or condition being treated, and the judgment of the practitioner.

[00147] Toxicity and therapeutic efficacy of such therapeutic regimens are determined by standard pharmaceutical procedures in cell cultures or experimental animals, including, but not limited to, the determination of the LD50 and the ED50. The dose ratio between the toxic and therapeutic effects is the therapeutic index and it is expressed as the ratio between LD50 and ED50. In certain embodiments, the data obtained from cell culture assays and animal studies are used in formulating the therapeutically effective daily dosage range and/or the therapeutically effective unit dosage amount for use in mammals, including humans. In some embodiments, the daily dosage amount of the compounds described herein lies within a range of circulating concentrations that include the ED50 with minimal toxicity. In certain embodiments, the daily dosage range and/or the unit dosage amount varies within this range depending upon the dosage form employed and the route of administration utilized.

[00148] In any of the aforementioned aspects are further embodiments in which the effective amount of the compound described herein, or a pharmaceutically acceptable salt thereof, is: (a) systemically administered to the mammal; and/or (b) administered orally to the mammal; and/or (c) intravenously administered to the mammal; and/or (d) administered by injection to the mammal; and/or (e) administered topically to the mammal; and/or (f)

administered non-systemically or locally to the mammal.

[00149] In any of the aforementioned aspects are further embodiments comprising single administrations of the effective amount of the compound, including further embodiments in which (i) the compound is administered once a day; or (ii) the compound is administered to the mammal multiple times over the span of one day, e.g., two, three, four or more times daily.

[00150] In any of the aforementioned aspects are further embodiments comprising multiple administrations of the effective amount of the compound, including further

embodiments in which (i) the compound is administered continuously or intermittently: as in a single dose; (ii) the time between multiple administrations is every 6 hours; (iii) the compound is administered to the mammal every 8 hours; (iv) the compound is administered to the mammal every 12 hours; (v) the compound is administered to the mammal every 24 hours. In further or alternative embodiments, the method comprises a drug holiday, wherein the administration of the compound is temporarily suspended or the dose of the compound being administered is temporarily reduced; at the end of the drug holiday, dosing of the compound is resumed. In one embodiment, the length of the drug holiday varies from 2 days to 1 year.

[00151] In certain instances, it is appropriate to administer at least one compound described herein, or a pharmaceutically acceptable salt thereof, in combination with one or more other therapeutic agents. In one embodiment, the therapeutic effectiveness of one of the compounds described herein is enhanced by administration of an adjuvant {i.e., by itself the adjuvant has minimal therapeutic benefit, but in combination with another therapeutic agent, the overall therapeutic benefit to the patient is enhanced). Or, in some embodiments, the benefit experienced by a patient is increased by administering one of the compounds described herein with another agent (which also includes a therapeutic regimen) that also has therapeutic benefit. [00152] It is understood that the dosage regimen to treat, prevent, or ameliorate the condition(s) for which relief is sought, is modified in accordance with a variety of factors (e.g. the disease, disorder or condition from which the subject suffers; the age, weight, sex, diet, and medical condition of the subject). Thus, in some instances, the dosage regimen actually employed varies and, in some embodiments, deviates from the dosage regimens set forth herein.

[00153] For combination therapies described herein, dosages of the co-administered compounds vary depending on the type of co-drug employed, on the specific drug employed, on the disease or condition being treated and so forth. In additional embodiments, when coadministered with one or more other therapeutic agents, the compound provided herein is administered either simultaneously with the one or more other therapeutic agents, or sequentially.

[00154] In combination therapies, the multiple therapeutic agents (one of which is one of the compounds described herein) are administered in any order or even simultaneously. If administration is simultaneous, the multiple therapeutic agents are, by way of example only, provided in a single, unified form, or in multiple forms (e.g., as a single pill or as two separate pills).

[00155] The compounds described herein, or a pharmaceutically acceptable salt thereof, as well as combination therapies, are administered before, during or after the occurrence of a disease or condition, and the timing of administering the composition containing a compound varies. Thus, in one embodiment, the compounds described herein are used as a prophylactic and are administered continuously to subjects with a propensity to develop conditions or diseases in order to prevent the occurrence of the disease or condition. In another embodiment, the compounds and compositions are administered to a subject during or as soon as possible after the onset of the symptoms. In specific embodiments, a compound described herein is administered as soon as is practicable after the onset of a disease or condition is detected or suspected, and for a length of time necessary for the treatment of the disease. In some embodiments, the length required for treatment varies, and the treatment length is adjusted to suit the specific needs of each subject. For example, in specific embodiments, a compound described herein or a formulation containing the compound is administered for at least 2 weeks, about 1 month to about 5 years.

EXAMPLES

I. Chemical Synthesis

[00156] In some embodiments, the compounds that modulate IRE1 mediated signaling disclosed herein are synthesized according to the following examples. As used below, and throughout the description of the invention, the following abbreviations, unless otherwise indicated, shall be understood to have the following meanings:

°C degrees Celsius

5H chemical shift in parts per million downfield from tetramethylsilane

ACN acetonitrile

n-Bu normal butyl

t-Bu tert-butyl

Boc tert-butyl oxycarbonyl

Cy cyclohexyl

dba dibenzylideneacetone

dppf bi s(diphenylphosphino)ferrocene

DCM dichloromethane (CH ₂ C1 ₂ )

DIAD diisopropyl azodicarboxylate

DIEA N,N-diisopropylethylamine

DMAP 4-dimethylaminopyridine

DMSO dimethylsulfoxide

EA ethyl acetate

EDCI N-(3-Dimethylaminopropyl)-N'-ethylcarbodiimide

Et ethyl

FA formic acid

g gram(s).

h hour(s).

HPLC high performance liquid chromatography

Hz hertz

J coupling constant (in MR spectrometry)

LDA lithium diisopropylamide

LCMS liquid chromatography mass spectrometry

μ/u micro

m multiplet (spectral); meter(s); milli

M molar

M ⁺ parent molecular ion

Me methyl

MHz megahertz

min minute(s).

mol mole(s); molecular (as in mol wt). mL milliliter

MS mass spectrometry

BS N-bromosuccinimide

NCS N-chlorosuccinimide

nm nanometer(s).

MR nuclear magnetic resonance

pH potential of hydrogen; a measure of the acidity or basicity of an aqueous solution

PE petroleum ether

Py pyridine

RT room temperature

s singlet (spectral),

t triplet (spectral).

T temperature

TEA triethylamine

TFA trifluoroacetic acid

THF tetrahydrofuran

[00157] The following examples are intended to illustrate but not limit the disclosed embodiments.

Example 1: Synthesis of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)quinazolin-6-yl)-l - methyl-lH-pyrazol-3-yl)-2 (3-(trifluoromethyl)phenyl)acetamide (1)

Step 1:

[00158] To a solution of 2-[3-(trifluoromethyl)phenyl]acetic acid (30 mg, 146.9 umol), tert-butyl (6-(3-amino-l-methyl-lH-pyrazol-5-yl)quinazolin-2-yl)((lr,4r )-4-(bis(tert- butoxycarbonyl)amino)cyclohexyl)carbamate (60 mg, 94.0 umol) in pyridine (3.0 mL) was added EDCI (84 mg, 440.8 umol). The mixture was stirred at 45°C for 12 h. The residue was diluted with water (10 mL) and extracted with ethyl acetate (30 mL x 3). The combined organic layers were washed with brine (20 mL ^χ 3), dried over Na ₂ S04, filtered and concentrated under reduced pressure obtained tert-butyl ((lr,4r)-4-(bis(tert-butoxycarbonyl)amino)cyclohexyl)(6-(l- methyl-3-(2-(3-(trifluoromethyl)phenyl)acetamido)-lH-pyrazol -5-yl)quinazolin-2-yl)carbamate (50 mg, 49.7 umol, 33.8% yield).

Step 2:

[00159] To a solution of tert-butyl ((lr,4r)-4-(bis(tert- butoxycarbonyl)amino)cyclohexyl)(6-(l-methyl-3-(2-(3-(triflu oromethyl)phenyl)acetamido)-lH- pyrazol-5-yl)quinazolin-2-yl)carbamate (50 mg, 60.6 umol) in DCM (3.0 mL) was added TFA (1.0 mL), the mixture was stirred at 15°C for 10 min. The reaction mixture was concentrated under reduced pressure. The residue was purified by prep-HPLC (FA condition) to afford N-(5- (2-((( 1 r,4r)-4-aminocyclohexyl)amino)quinazolin-6-yl)- 1 -methyl- 1 H-pyrazol-3 -yl)-2 (3 - (trifluoromethyl)phenyl)acetamide (23.3 mg, 40.9 umol, 67.5% yield, FA). ¹ H MR

(METHANOL-^, 400MHz): δ 9.09 (s, 1 H), 8.53 (br s, 1 H), 7.88 (s, 1 H), 7.80 (br d, J= 8.80 Hz, 1 H), 7.69 (s, 1 H), 7.51 - 7.65 (m, 4 H), 6.67 (s, 1 H), 3.89 - 4.07 (m, 1 H), 3.79 - 3.85 (m, 5 H), 3.11 - 3.21 (m, 1 H), 2.06 - 2.31 (m, 4 H), 1.42 - 1.67 (m, 4 H). LCMS: mlz 524.2 (M+H).

Example 2: Synthesis of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6- yl)-l-methyl-lH-pyrazol-3-yl)-2-(3-(trifluoromethyl)phenyl)a cetamide (2).

Step 1:

[00160] To a solution of 5-bromo-l-methyl-lH-pyrazol-3-amine (129 mg, 734.7 umol), 2-

[3 -(trifluoromethyl)phenyl] acetic acid (150 mg, 734.7 umo) in pyridine (2.0 mL) added EDCI (211 mg, 1.1 mmol). The mixture was stirred at 45°C for 12 h. The reaction mixture was quenched by addition H ₂ 0 (5.0 mL), extracted with dichloromethane 15.0 mL (5.0 mL x 3). The combined organic layers were washed with brine 15.0 mL (5 mL x 3), dried over Na ₂ S0 ₄ , filtered and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 1/1) to aff ord N-(5-bromo-l -methyl -1 H- pyrazol-3-yl)-2-(3-(trifluoromethyl)phenyl)acetamide (150 mg, crude).

Step 2: [00161] A mixture of N-(5-bromo-l-methyl-lH-pyrazol-3-yl)-2-(3-

(trifluoromethyl)phenyl)acetamide (75 mg, 207.1 umol), K ₂ C0 ₃ (85 mg, 621.3 umol), tert-butyl ((lr,4r)-4-((8-ethyl-6-(4,4,5,5-tetramethyl-l,3,2-dioxaborol an-2-yl)quinazolin-2- yl)amino)cyclohexyl)carbamate (102 mg, 207.1 umol), Pd(dppf)C12 (15 mg, 20.7 umol) in dioxane (2.0 mL) and H ₂ 0 (200.0 uL) was degassed and purged with N ₂ for 3 times, and then the mixture was stirred at 90°C for 12 h under N ₂ atmosphere. The reaction mixture was

concentrated under reduced pressure. The residue was purified by prep-TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 0/1) to afford tert-butyl ((lr,4r)-4-((8-ethyl-6-(l-methyl-3-(2-(3- (trifluoromethyl)phenyl)acetamido)-lH-pyrazol-5-yl)quinazoli n-2- yl)amino)cyclohexyl)carbamate (60 mg, crude).

Step 3:

[00162] To a solution of tert-butyl ((lr,4r)-4-((8-ethyl-6-(l-methyl-3-(2-(3-

(trifluoromethyl)phenyl)acetamido)-lH-pyrazol-5-yl)quinaz olin-2- yl)amino)cyclohexyl)carbamate (60 mg, 92.1 umol) in dichloromethane (2.0 mL) was added trifluoroacetic acid (1.0 mL). The mixture was stirred at 25°C for 0.5 h. The reaction mixture was concentrated under reduced pressure, then added dichloromethane (2.0 ml) and H ₃ .H ₂ 0 (50.0 uL, 25%) to pH = 7, concentrated under reduced pressure. The residue was purified by prep-HPLC (neutral condition) to afford N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8- ethylquinazolin-6-yl)-l-methyl-lH-pyrazol-3-yl)-2-(3-(triflu oromethyl)phenyl)acetamide (12.3 mg, 21.2 umol, 23.0% yield) was obtained. 1H NMR (METHANOL-^, 400MHz): δ 9.04 (s, 1H), 7.71 (s, 2H), 7.68 - 7.62 (m, 2H), 7.61 - 7.52 (m, 2H), 6.66 (s, 1H), 3.96 (br s, 1H), 3.87 - 3.78 (m, 5H), 3.15 - 3.04 (m, 2H), 2.85 (br s, 1H), 2.23 (br s, 2H), 2.04 (br s, 2H), 1.55 - 1.30 (m, 7H). LCMS: mlz 552.2 (M+H).

Example 3: Synthesis of (S)-N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinaz olin- 6-yl)-l-methyl-lH-pyrazol-3-yl)-2-hydroxy-2-phenylacetamide (15)

[00163] The title compound was synthesized according to the synthetic procedure reported for the preparation of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6-yl)-l- methyl-lH-pyrazol-3-yl)-2-(3-(trifluoromethyl)phenyl)acetami de. (S)-N-(5-(2-(((lr,4r)-4- aminocyclohexyl)amino)-8-ethylquinazolin-6-yl)-l -methyl- lH-pyrazol-3 -yl)-2-hydroxy-2- phenylacetamide (4.4 mg, 8.0 umol, 12.0% yield, FA). 1H MR (METHANOL-^, 400MHz): δ 9.05 (s, 1 H), 8.43 (br s, 2 H), 7.72 (d, J= 1.98 Hz, 1 H), 7.64 (d, J= 1.76 Hz, 1 H), 7.54 (d, J = 7.42 Hz, 2 H), 7.29 - 7.42 (m, 3 H), 6.68 (s, 1 H), 5.20 (s, 1 H), 3.94 - 4.03 (m, 1 H), 3.84 (s, 3 H), 3.05 - 3.21 (m, 3 H), 2.32 (br d, J= 11.25 Hz, 2 H), 2.15 (br d, J= 11.91 Hz, 2 H), 1.44 - 1.66 (m, 4 H), 1.34 (t, J= 7.50 Hz, 3 H). LCMS: mlz 500.2 (M+H).

Example 4: Synthesis of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6- yl)-l-methyl-lH-pyrazol-3- l)-2-phenylbutanamide (16)

[00164] The title compound was synthesized according to the synthetic procedure reported for the preparation of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6-yl)-l- methyl-lH-pyrazol-3-yl)-2-(3-(trifluoromethyl)phenyl)acetami de. (5.9 mg, 10.7 umol, 16.4% yield, FA) was obtained. 1H MR (METHANOL-^, 400MHz): δ 9.05 - 9.14 (m, 1 H), 7.74 (br s, 1 H), 7.66 (s, 1 H), 7.38 - 7.47 (m, 2 H), 7.21 - 7.34 (m, 3 H), 6.61 - 6.66 (m, 1 H), 4.01 (br s, 1 H), 3.74 - 3.81 (m, 3 H), 3.55 - 3.61 (m, 1 H), 3.08 (q, J= 7.57 Hz, 2 H), 2.78 (br s, 1 H), 2.23 - 2.37 (m, 2 H), 2.09 - 2.19 (m, 3 H), 1.76 - 1.87 (m, 1 H), 1.45 - 1.63 (m, 4 H), 1.28 - 1.36 (m, 3 H), 0.95 (t, J= 7.28 Hz, 3 H). LCMS: mlz 512.2 (M+H).

Example 5: Synthesis of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6- yl)-l-methyl-lH-pyrazol-3-yl)-2-(3-fluoro-4-(trifluoromethyl )phenyl)acetamide (7)

[00165] The title compound was synthesized according to the synthetic procedure reported for the preparation of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6-yl)-l- methyl-lH-pyrazol-3-yl)-2-(3-(trifluoromethyl)phenyl)acetami de. (9.6 mg, 15.3 umol, 51.3% yield, FA) was obtained. 1H MR (DMSO-^6, 400MHz): δ 10.81 (s, 1H), 9.14 (br s, 1H), 7.91 - 7.72 (m, 5H), 7.67 (s, 1H), 7.58 - 7.44 (m, 2H), 7.38 (d, J= 8.1 Hz, 1H), 6.66 (s, 1H), 3.89 - 3.74 (m, 6H), 3.01 (q, J= 7.4 Hz, 3H), 2.19 - 2.07 (m, 2H), 2.02 (br d, J= 11.1 Hz, 2H), 1.55 - 1.34 (m, 4H), 1.30 (br t, J= 7.4 Hz, 3H). LCMS: mlz 570.2 (M+H). Example 6: Synthesis of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6- yl)-l-methyl-lH-pyrazol-3-yl)-2-(4-(trifluoromethyl)phenyl)a cetamide (6)

[00166] The title compound was synthesized according to the synthetic procedure reported for the preparation of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6-yl)-l- methyl-lH-pyrazol-3-yl)-2-(3-(trifluoromethyl)phenyl)acetami de. (7.9 mg, 12.6 umol, 41.1% yield, FA) was obtained. 1H MR (DMSO-i¾, 400MHz): δ 10.79 (s, 1H), 9.14 (br s, 1H), 7.80 (br s, 4H), 7.70 (d, J= 8.2 Hz, 2H), 7.66 (d, J= 1.7 Hz, 1H), 7.59 - 7.48 (m, 3H), 6.65 (s, 1H), 3.84 - 3.73 (m, 6H), 3.01 (q, J= 7.5 Hz, 3H), 2.18 - 2.06 (m, 2H), 2.01 (br d, J= 10.6 Hz, 2H), 1.55 - 1.33 (m, 4H), 1.29 (br t, J= 7.5 Hz, 3H) LCMS: mlz 552.2 (M+H).

Example 7: Synthesis of N-(5-(8-ethyl-2-(((lr,4r)-4-hydroxycyclohexyl)amino)quinazol in-6- yl)-l-methyl-lH-pyrazol-3-yl)-2-(3-(trifluoromethyl)phenyl)a cetamide (3).

[00167] To a solution of N-(5-bromo-l-methyl-lH-pyrazol-3-yl)-2-(3-

(trifluoromethyl)phenyl)acetamide (91 mg, 251.6 umol), (lr,4r)-4-((8-ethyl-6-(4,4,5,5- tetramethyl-l,3,2-dioxaborolan-2-yl)quinazolin-2-yl)amino)cy clohexan-l-ol (100 mg, 251.6 umol) in dioxane (3 mL) and H ₂ 0 (0.3 mL) was added K ₂ C0 ₃ (104 mg, 755.0 umol) and Pd(dppf)Cl ₂ (36 mg, 50.3 umol). The mixture was stirred at 90°C for 12 h under N ₂ . The reaction mixture was concentrated under reduced pressure. The residue was purified by prep- TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 0/1), then the residue was purified by prep-HPLC (FA condition) to afford N-(5-(8-ethyl-2-(((lr,4r)-4-hydroxycyclohexyl)amino)quinazol in-6-yl)- l-methyl-lH-pyrazol-3-yl)-2-(3-(trifluoromethyl)phenyl)aceta mide (5.4 mg, 8.9 umol, 3.5% yield, FA). 1H MR (METHANOL-^, 400MHz): δ 9.02 (s, 1 H), 7.70 (s, 2 H), 7.60 - 7.66 (m, 2 H), 7.51 - 7.60 (m, 2 H), 6.64 (s, 1 H), 3.94 (br s, 1 H), 3.78 - 3.85 (m, 5 H), 3.62 (br s, 1 H), 3.08 (q, J= 7.45 Hz, 2 H), 2.20 (br s, 2 H), 2.03 (br d, J= 7.02 Hz, 2 H), 1.30 - 1.52 (m, 7 H). LCMS: mlz 553.2 (M+H). Example 8: Synthesis of l-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6-yl)- l-methyl-lH-pyrazol-3-yl)-3-(4-((l-methylpiperidin-4-yl)oxy) -3- (trifluoromethyl)phenyl)urea (4).

step 1 step 2 step 3

MeOH

step 4 step 5 step 6

Step 1:

[00168] To a solution of tert-butyl 4-hydroxypiperidine-l-carboxylate (1.5 g, 7.4 mmol) in

THF (20.0 mL) was added NaH (298 mg, 7.4 mmol) at 0°C. The mixture was stirred at 0°C for 1 h. Then l-fluoro-4-nitro-2-(trifluoromethyl)benzene (1.2 g, 5.9 mmol, 820.2 uL) was added. The resulting mixture was stirred at 25°C for 1 h. The reaction mixture was poured into Sat H ₄ C1 (20.0 mL) and extracted with ethyl acetate (50 mL x 3). The combined organic layers were washed with brine (50.0 mL ^χ 3), dried over Na ₂ S0 ₄ , filtered and concentrated under reduced pressure to give a residue. The residue was purified by column chromatography (Si0 ₂ , Petroleum ether / Ethyl acetate = 40/1 to 3/1) to afford tert-butyl 4-(4-nitro-2- (trifluoromethyl)phenoxy)piperidine-l-carboxylate (2.3 g, 5.0 mmol, 67.2% yield) was obtained. 1H MR (CHLOROFORM-^, 400MHz): δ 8.53 (d, J= 2.2 Hz, 1H), 8.41 (dd, J= 2.3, 9.2 Hz, 1H), 7.09 (d, J= 9.3 Hz, 1H), 4.83 (br s, 1H), 3.64 (br d, J= 12.3 Hz, 2H), 3.51 (br d, J= 9.0 Hz, 2H), 2.01 - 1.85 (m, 4H), 1.48 (s, 9H).

Step 2:

[00169] A solution of tert-butyl 4-(4-nitro-2-(trifluorom ethyl )phenoxy)piperi dine- 1- carboxylate (1.0 g, 2.5 mmol) in TFA (3.0 mL) and DCM (9.0 mL) was stirred at 15°C for 10 min. The mixture was concentrated to get crude residue and added MeOH (10 mL). The mixture was adjusted pH = 7 with TEA and concentrated to get 4-(4-nitro-2- (trifluoromethyl)phenoxy)piperidine (800 mg, crude).

Step 3: [00170] To a solution of 4-(4-nitro-2-(trifluoromethyl)phenoxy)piperidine (800 mg, 2.7 mmol) in MeOH (10.0 mL) was added AcOH (8 mg, 138.0 umol, 7.9 uL) and paraformaldehyde (745 mg, 8.2 mmol). The mixture was stirred at 30°C for 2 h. Then NaBH ₃ CN (867 mg, 13.8 mmol) was added and stirred at 30°C for 12 h. The mixture was concentrated and diluted with sat NaHC0 ₃ (10.0 mL) and extracted with ethyl acetate (20.0 mL x 3). The combined organic layers were washed with brine (20.0 mL ^χ 3), dried over Na ₂ S0 ₄ , filtered and concentrated under reduced pressure to give a residue. The residue was purified by column chromatography (Si0 ₂ , Petroleum ether / Ethyl acetate = 1/0 to Dichloromethane / Methanol = 10/1) to afford 1-methyl- 4-(4-nitro-2-(trifluoromethyl)phenoxy)piperidine (800 mg, crude).

Step 4:

[00171] A solution of 1 -methyl -4-(4-nitro-2-(trifluoromethyl)phenoxy)piperi dine (800 mg,

2.6 mmol) in MeOH (10.0 mL) was added Pd-C (10%, 0.1 g) under N ₂ . The suspension was degassed under vacuum and purged with H ₂ several times. The mixture was stirred under H ₂ (15 psi) at 15°C for 1 h. The mixture was filtered and concentrated under reduced pressure to afford 4-((l-methylpiperidin-4-yl)oxy)-3-(trifluoromethyl)aniline (700 mg, crude).

Step 5:

[00172] The solution of 4-((l-methylpiperidin-4-yl)oxy)-3-(trifluoromethyl)aniline (77 mg, 437.5 umol) and DIEA (106 mg, 820.3 umol, 143.2 uL) in DCM (3.0 mL) was cooled to - 30°C for 0.5 h. Then triphosgene (53 mg, 180.4 umol) was added. The mixture was stirred at - 30°C for 1 h. Then a solution of 5-bromo-l-methyl-lH-pyrazol-3-amine (150 mg, 546.8 umol) in DCM (1.0 mL) was added. The resulting mixture was stirred at 25°C for 1 h. MeOH (2 drop) was added and concentrated to get crude residue. The residue was purified by prep-TLC (Si0 ₂ , Dichloromethane / Methanol = 10/1) to afford l-(5-bromo-l-methyl-lH-pyrazol-3-yl)-3-(4-((l- methylpiperidin-4-yl)oxy)-3-(trifluoromethyl)phenyl)urea (150 mg, crude).

Step 6:

[00173] To a solution of l-(5-bromo-l-methyl-lH-pyrazol-3-yl)-3-(4-((l-methylpiperidi n-

4-yl)oxy)-3-(trifluoromethyl)phenyl)urea (86 mg, 181.2 umol) and K ₂ C0 ₃ (75 mg, 543.8 umol) in dioxane (2.0 mL) and H ₂ 0 (200.0 uL) were added tert-butyl ((lr,4r)-4-((8-ethyl-6-(4,4,5,5- tetramethyl-l,3,2-dioxaborolan-2-yl)quinazolin-2-yl)amino)cy clohexyl)carbamate (90 mg, 181.2 umol) and Pd(dppf)Cl ₂ (13 mg, 18.1 umol). The mixture was stirred at 90°C for 12 h under N ₂ . The mixture was concentrated to get crude residue. The residue was purified by prep-TLC (Si0 ₂ , Dichloromethane / Methanol = 10/1) to afford tert-butyl ((lr,4r)-4-((8-ethyl-6-(l-methyl-3-(3-(4- ((l-methylpiperidin-4-yl)oxy)-3-(trifluoromethyl)phenyl)urei do)-lH-pyrazol-5-yl)quinazolin-2- yl)amino)cyclohexyl)carbamate (20 mg, crude).

Step 7: [00174] A solution of tert-butyl ((lr,4r)-4-((8-ethyl-6-(l-methyl-3-(3-(4-((l- methylpiperidin-4-yl)oxy)-3-(trifluorom

yl)amino)cyclohexyl)carbamate (130 mg, 120.4 umol, TFA) in DCM (2.0 mL) and TFA (1.0 mL) was stirred at 15 °C for 10 min. The mixture was concentrated to get crude residue and diluted with MeOH (1.0 mL), adjusted pH = 7 with H ₃ H ₂ 0 (25 % solution). The residue was purified by prep-HPLC (FA condition) to affordl-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8- ethylquinazolin-6-yl)-l -methyl- lH-pyrazol-3-yl)-3-(4-((l-methylpiperidin-4-yl)oxy)-3- (trifluoromethyl)phenyl)urea (42.9 mg, 60.3 umol, 50.1% yield, FA). 1H NMR (METHANOL- d , 400MHz): δ 9.06 (s, 1H), 8.50 (s, 1H), 7.84 (d, J= 2.0 Hz, 1H), 7.73 (s, 1H), 7.65 - 7.61 (m, 2H), 7.22 (d, J= 8.8 Hz, 1H), 6.35 (s, 1H), 4.81 (br s, 1H), 4.01 - 3.84 (m, 1H), 3.84 (s, 3H), 3.20 - 3.07 (m, 7H), 2.78 (s, 3H), 2.33 - 2.13 (m, 8H), 1.65 - 1.48 (m, 4H), 1.35 (t, J = 7.6 Hz, 3H). LCMS: mlz 666.3 (M+H).

Example 9: Synthesis of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6- yl)-l-methyl-lH-pyrazol-3-yl)-2-(3,5-bis(trifluoromethyl)phe nyl)acetamide (5).

Step 1:

[00175] To a solution of 2-[3,5-bis(trifluoromethyl)phenyl]acetic acid (200 mg, 734.9 umol) and 5-bromo-l-methyl-lH-pyrazol-3-amine (129 mg, 734.9 umol) in pyridine (2.0 mL) was added EDCI (211 mg, 1.1 mmol). The mixture was stirred at 45°C for 12 h. The reaction mixture was quenched by addition water (5.0 mL), extracted with dichloromethane (5 mL x 3). The combined organic layers were washed with brine (5 mL ^χ 3), dried over Na ₂ S0 ₄ , filtered and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 1/1) to afford 2-(3,5-bis(trifluoromethyl)phenyl)-N-(5- bromo-l-methyl-lH-pyrazol-3-yl)acetamide (150 mg, crude).

Step 2:

[00176] A mixture of 2-(3,5-bis(trifluoromethyl)phenyl)-N-(5-bromo-l-methyl-lH- pyrazol-3-yl)acetamide (75 mg, 174.3 umol), tert-butyl ((lr,4r)-4-((8-ethyl-6-(4,4,5,5- tetramethyl-l,3,2-dioxaborolan-2-yl)quinazolin-2-yl)amino)cy clohexyl)carbamate (86 mg, 174.3 umol), K ₂ C0 ₃ (72 mg, 523.1 umol), and Pd(dppf)Cl ₂ (12 mg, 17.4 umol) in dioxane (2.0 mL) and H ₂ 0 (200.0 uL) was degassed and purged with N ₂ for 3 times, and then the mixture was stirred at 90°C for 12 h under N ₂ atmosphere. The reaction mixture was concentrated under reduced pressure. The residue was purified by prep-TLC (Si0 ₂ , Petroleum ether / Ethyl acetate= 0/1) to afford tert-butyl ((lr,4r)-4-((6-(3-(2-(3,5-bis(trifluoromethyl)phenyl)acetami do)-l-methyl- lH-pyrazol-5-yl)-8-ethylquinazolin-2-yl)amino)cyclohexyl)car bamate (60 mg, crude).

Step 3:

[00177] To a solution of tert-butyl ((lr,4r)-4-((6-(3-(2-(3,5- bis(trifluoromethyl)phenyl)acetamido)-l -methyl- lH-pyrazol-5-yl)-8-ethylquinazolin-2- yl)amino)cyclohexyl)carbamate (60 mg, 83.3 umol) in DCM (2.0 mL) was added TFA (1.0 mL). The mixture was stirred at 25°C for 0.5 h. The reaction mixture was concentrated under reduced pressure, then added H ₃ .H ₂ 0 (50.00 uL, 25%) to pH = 7, concentrated under reduced pressure again. The residue was purified by prep-HPLC (FA condition) to afford N-(5-(2-(((lr,4r)-4- aminocyclohexyl)amino)-8-ethylquinazolin-6-yl)-l -methyl- lH-pyrazol-3-yl)-2-(3, 5- bis(trifluoromethyl)phenyl)acetamide (16.7 mg, 21.7 umol, 26.1% yield, FA). 1H MR

(METHANOL-^, 400MHz): δ 8.96 (br s, 1H), 7.89 (s, 2H), 7.79 (s, 1H), 7.63 (br s, 1H), 7.55 (s, 1H), 6.56 (s, 1H), 3.90 (br t, J= 11.0 Hz, 1H), 3.83 (s, 2H), 3.73 (s, 3H), 3.13 - 3.03 (m, 1H), 2.98 (q, J= 7.3 Hz, 2H), 2.21 (br d, J= 11.5 Hz, 2H), 2.05 (br d, J= 11.7 Hz, 2H), 1.58 - 1.35 (m, 4H), 1.28 - 1.19 (m, 3H). LCMS: mlz 620.2 (M+H).

Example 10: Synthesis of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6- -l-methyl-lH-pyrazol-3-yl)-2-(2,5-bis(trifluoromethyl)phenyl )acetamide (12)

Step 1:

[00178] To a solution of tert-butyl ((lr,4r)-4-((6-bromo-8-ethylquinazolin-2- yl)amino)cyclohexyl)carbamate (670 mg, 1.4 mmol) in Boc ₂ 0 (45.0 mL) was added TEA (453 mg, 4.5 mmol, 620 uL) and DMAP (364 mg, 2.9 mmol). The mixture was stirred at 100°C for 12 h. The reaction was dissolved in DCM (150.0 mL) and was purified by column

chromatography (Si0 ₂ , Petroleum ether / Ethyl acetate = 20/1 to 3/1) to give tert-butyl ((lr,4r)-4- (bis(tert-butoxycarbonyl)amino)cyclohexyl)(6-bromo-8-ethylqu inazolin-2-yl)carbamate (800 mg, 985.2 umol, 66.1% yield). 1H MR (CHLOROFORM-d, 400MHz): δ 9.22 (s, 1H), 7.90 (d, J = 2.0 Hz, 1H), 7.79 (d, J= 2.0 Hz, 1H), 4.28 (br t, J= 11.7 Hz, 1H), 3.97 - 3.82 (m, 1H), 3.18 (q, J = 7.5 Hz, 2H), 2.09 - 1.95 (m, 4H), 1.91 - 1.76 (m, 4H), 1.48 (s, 18H), 1.44 (s, 9H), 1.37 (t, J = 7.5 Hz, 3H).

Step 2:

[00179] A mixture of tert-butyl ((lr,4r)-4-(bis(tert-butoxycarbonyl)amino)cyclohexyl)(6- bromo-8-ethylquinazolin-2-yl)carbamate (800 mg, 1.2 mmol), AcOK (362 mg, 3.6 mmol), 4,4,4',4',5,5,5',5'-octamethyl-2,2'-bi(l,3,2-dioxaborolane) (344 mg, 1.4 mmol) and Pd(dppf)Cl ₂ (90 mg, 123.0 umol) in dioxane (10.0 mL) was degassed and purged with N ₂ for 3 times, and then the mixture was stirred at 90°C for 12 h under N ₂ atmosphere. The reaction was

concentrated to give a residue. The residue was purified by column chromatography (Si0 ₂ , Petroleum ether / Ethyl acetate = 10/1 to 1/1) to afford tert-butyl ((lr,4r)-4-(bis(tert- butoxycarbonyl)amino)cyclohexyl)(8-ethyl-6-(4,4,5,5-tetramet hyl-l,3,2-dioxaborolan-2- yl)quinazolin-2-yl)carbamate (900 mg, crude).

Step 3:

[00180] A mixture of tert-butyl ((lr,4r)-4-(bis(tert-butoxycarbonyl)amino)cyclohexyl)(8- ethyl-6-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2-yl)quinazo lin-2-yl)carbamate (900 mg, 1.2 mmol), 5-bromo-l-methyl-lH-pyrazol-3-amine (227 mg, 1.2 mmol), K ₂ C0 ₃ (536 mg, 3.9 mmol) and Pd(dppf)Cl ₂ (95 mg, 129.2 umol) in dioxane (4.0 mL) and H ₂ 0 (400 uL) was degassed and purged with N ₂ for 3 times, and then the mixture was stirred at 90°C for 12 h under N ₂ atmosphere. The reaction was concentrated to give a residue. The residue was purified by column chromatography (Si0 ₂ , Petroleum ether / Ethyl acetate = 10/1 to 0/1) to afford tert-butyl (6-(3-amino-l-methyl-lH-pyrazol-5-yl)-8-ethylquinazolin-2-yl )((lr,4r)-4-(bis(tert- butoxycarbonyl)amino)cyclohexyl)carbamate (590 mg, crude).

Step 4:

[00181] To a solution of tert-butyl (6-(3-amino-l-methyl-lH-pyrazol-5-yl)-8- ethylquinazolin-2-yl)((lr,4r)-4-(bis(tert-butoxycarbonyl)ami no)cyclohexyl)carbamate (40 mg, 60.0 umol) in pyridine (2.0 mL) was added EDCI (35 mg, 180.2 umol) and 2-[2,5- bis(trifluoromethyl)phenyl]acetic acid (17 mg, 60.1 umol). The mixture was stirred at 45°C for 12 h. The reaction was concentrated to give a residue. The residue was dissolved in DCM (3.0 mL) and washed with brine (3.0 mL x 3), dried over anhydrous Na ₂ S0 ₄ , filtered and

concentrated to give tert-butyl ((lr,4r)-4-(bis(tert-butoxycarbonyl)amino)cyclohexyl)(6-(3-( 2- (2,5-bis(trifluoromethyl)phenyl)acetamido)-l-methyl-lH-pyraz ol-5-yl)-8-ethylquinazolin-2- yl)carbamate (60 mg, crude).

Step 5:

[00182] To a solution of tert-butyl ((lr,4r)-4-(bis(tert- butoxycarbonyl)amino)cyclohexyl)(6-(3-(2-(2,5-bis(trifluorom ethyl)phenyl)acetamido)-l- methyl-lH-pyrazol-5-yl)-8-ethylquinazolin-2-yl)carbamate (60 mg, 65.2 umol) in DCM (2.0 mL) was added TFA (1.0 mL). The mixture was stirred at 25°C for 0.5 h. The reaction was concentrated to give a residue. The residue was dissolved in MeOH (2.0 mL) and basified pH to 8 with H ₃ .H ₂ 0 (25% solution). The residue was purified by prep-HPLC (FA condition) to afford N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6-yl)-l -methyl- 1H- pyrazol-3-yl)-2-(2,5-bis(trifluoromethyl)phenyl)acetamide (9.8 mg, 13.8 umol, 21.2% yield). 1H MR (METHANOL-^, 400MHz): δ 9.04 (s, 1H), 8.55 (br s, 1H), 7.93 (d, J= 8.2 Hz, 1H), 7.87 (s, 1H), 7.80 (br d, J= 8.2 Hz, 1H), 7.70 (s, 1H), 7.63 (s, 1H), 6.62 (s, 1H), 4.09 (s, 2H), 4.03 - 3.92 (m, 1H), 3.83 (s, 3H), 3.20 - 3.03 (m, 3H), 2.30 (br d, J= 12.3 Hz, 2H), 2.13 (br d, J= 11.9 Hz, 2H), 1.66 - 1.41 (m, 4H), 1.33 (t, J= 7.5 Hz, 3H). LCMS: mlz 620.2 (M+H).

Example 11: Synthesis of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6- yl)-l-methyl-lH-pyrazol-3-yl)-2-(5-fluoro-2-(trifluoromethyl )phenyl)acetamide (13)

[00183] The title compound was synthesized according to the synthetic procedure reported for the preparation of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6-yl)-l- methyl-lH-pyrazol-3-yl)-2-(2,5-bis(trifluoromethyl)phenyl)ac etamide. (21.6 mg, 35.7 umol, 51.8% yield) was obtained. 1H MR (METHANOL-^, 400MHz): δ 9.03 (br s, 1H), 8.54 (br s, 1H), 7.80 - 7.66 (m, 2H), 7.63 (br s, 1H), 7.30 (br d, J= 9.5 Hz, 1H), 7.20 (br t, J= 8.5 Hz, 1H), 6.63 (s, 1H), 4.04 - 3.91 (m, 3H), 3.82 (s, 3H), 3.22 - 3.01 (m, 3H), 2.30 (br d, J= 11.2 Hz, 2H), 2.14 (br d, J=11.7 Hz, 2H), 1.68 - 1.41 (m, 4H), 1.33 (br t, J= 7.4 Hz, 3H). LCMS: mlz 570.2 (M+H). Example 12: Synthesis of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6- yl)-l-methyl-lH-pyrazol-3- -2-(3-cyanophenyl)acetamide (17)

[00184] The title compound was synthesized according to the synthetic procedure reported for the preparation of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6-yl)-l- methyl-lH-pyrazol-3-yl)-2-(2,5-bis(trifluoromethyl)phenyl)ac etamide. (17.3 mg, 30.8 umol, 41.6% yield, FA). 1H NMR (METHANOL-^, 400MHz): δ 9.06 (s, 1H), 8.57 (br s, 1H), 7.76 (s, 1H), 7.72 - 7.60 (m, 4H), 7.58 - 7.49 (m, 1H), 6.67 (s, 1H), 4.07 - 3.94 (m, 1H), 3.84 (s, 3H), 3.81 (s, 2H), 3.19 (tt, J = 3.8, 11.4 Hz, 1H), 3.10 (q, J = 7.5 Hz, 2H), 2.33 (br d, J= 11.7 Hz, 2H), 2.16 (br d, J= 11.5 Hz, 2H), 1.70 - 1.44 (m, 4H), 1.35 (t, J= 7.5 Hz, 3H). LCMS: mlz 509.2 (M+H).

Example 13: Synthesis of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6- yl)-l-methyl-lH-pyrazol-3-yl)-2-(3-fluoro-5-(trifluoromethyl )phenyl)acetamide (20)

[00185] The title compound was synthesized according to the synthetic procedure reported for the preparation of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6-yl)-l- methyl-lH-pyrazol-3-yl)-2-(2,5-bis(trifluoromethyl)phenyl)ac etamide. (16.9 mg, 26.6 umol, 33.0% yield, FA). 1H MR (METHANOL-^, 400MHz): δ 9.06 (s, 1H), 8.57 (s, 1H), 7.72 (s, 1H), 7.65 (s, 1H), 7.55 (s, 1H), 7.45 (br d, J= 9.2 Hz, 1H), 7.38 (br d, J= 8.6 Hz, 1H), 6.67 (s, 1H), 4.00 (br t, J= 11.2 Hz, 1H), 3.84 (s, 5H), 3.26 - 3.15 (m, 1H), 3.10 (q, J = 7.4 Hz, 2H), 2.32 (br d, J= 11.2 Hz, 2H), 2.17 (br d, J= 5.4 Hz, 2H), 1.70 - 1.43 (m, 4H), 1.40 - 1.22 (m, 3H). LCMS: mlz 570.2 (M+H).

Example 14: Synthesis of (R)-2-amino-N-(5-(2-(((lr,4r)-4-aminocyclohexyl)

ethylquinazolin-6-yl)-l-methyl-lH-pyrazol-3-yl)-2-phenyla cetamide (22)

[00186] The title compound was synthesized according to the synthetic procedure reported for the preparation of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6-yl)-l- methyl-lH-pyrazol-3-yl)-2-(2,5-bis(trifluoromethyl)phenyl)ac etamide. (10.5 mg, 18.3 umol, 25.6% yiel, FA) was obtained. 1H MR (DMSO-^6, 400MHz): δ 11.22 (s, 1H), 9.12 (br s, 1H), 8.79 (br s, 3H), 7.89 (br s, 3H), 7.79 (s, 1H), 7.64 (d, J= 2.2 Hz, 1H), 7.58 (d, J= 7.0 Hz, 2H), 7.51 - 7.39 (m, 3H), 6.66 (s, 1H), 5.06 (br s, 1H), 3.77 (s, 4H), 2.99 (q, J= 7.5 Hz, 3H), 2.16 - 1.89 (m, 4H), 1.52 - 1.32 (m, 4H), 1.27 (br t, J= 7.5 Hz, 3H). LCMS: mlz 499.3 (M+H).

Example 15: Synthesis of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6- yl)-l-methyl-lH-pyrazol-3-yl)-2-(4-chloro-3-(trifluoromethyl )phenyl)acetamide (18)

[00187] The title compound was synthesized according to the synthetic procedure reported for the preparation of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6-yl)-l- methyl-lH-pyrazol-3-yl)-2-(2,5-bis(trifluoromethyl)phenyl)ac etamide. (13.8 mg, 21.6 umol, 47.9% yield, FA). 1H NMR (METHANOL-^, 400MHz): δ 9.05 (s, 1 H), 8.49 (br s, 1 H), 7.79 (s, 1 H), 7.71 (d, J= 1.98 Hz, 1 H), 7.56 - 7.64 (m, 3 H), 6.64 (s, 1 H), 3.94 - 4.02 (m, 1 H), 3.78 - 3.84 (m, 5 H), 3.04 - 3.21 (m, 3 H), 2.25 - 2.35 (m, 2 H), 2.09 - 2.18 (m, 2 H), 1.44 - 1.65 (m, 4 H), 1.29 - 1.37 (m, 3 H). LCMS: mlz 586.2 (M+H).

Example 16: Synthesis of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6- yl)-l-methyl-lH-pyrazol- -yl)-2-(3-(trifluoromethoxy)phenyl)acetamide (11)

[00188] The title compound was synthesized according to the synthetic procedure reported for the preparation of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6-yl)-l- methyl-lH-pyrazol-3-yl)-2-(2,5-bis(trifluoromethyl)phenyl)ac etamide. (15.9 mg, 24.7 umol, 53.6% yield, FA). 1H NMR (METHANOL-^, 400MHz): δ 9.05 (s, 1 H), 7.72 (s, 1 H), 7.64 (s, 1 H), 7.34 - 7.46 (m, 2 H), 7.30 (s, 1 H), 7.18 (br d, J= 8.16 Hz, 1 H), 6.65 (s, 1 H), 3.92 - 4.02 (m,

1 H), 3.82 (s, 3 H), 3.75 (s, 2 H), 3.13 - 3.21 (m, 1 H), 3.08 (q, J= 7.50 Hz, 2 H), 2.26 - 2.36 (m,

2 H), 2.14 (br d, J= 11.91 Hz, 2 H), 1.44 - 1.63 (m, 4 H), 1.34 (t, J= 7.50 Hz, 3 H). LCMS: mlz 568.2 (M+H).

Example 17: Synthesis of (S)-2-amino-N-(5-(2-(((lr,4r)-4-aminocyclohexyl)

ethylquinazolin-6-yl)-l-methyl-lH-pyrazol-3-yl)-2-phenyla cetamide (24)

[00189] The title compound was synthesized according to the synthetic procedure reported for the preparation of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6-yl)-l- methyl-lH-pyrazol-3-yl)-2-(2,5-bis(trifluoromethyl)phenyl)ac etamide. (16.8 mg, 30.2 umol, 30.2% yield, FA) was obtained. 1H NMR (METHANOL-^, 400MHz): δ 9.05 (s, 1 H), 8.50 (br s, 2 H), 7.68 - 7.75 (m, 1 H), 7.64 (s, 1 H), 7.53 - 7.60 (m, 2 H), 7.36 - 7.52 (m, 3 H), 6.70 (s, 1 H), 4.94 - 5.05 (m, 1 H), 3.99 (br s, 1 H), 3.80 (s, 3 H), 3.18 (br s, 1 H), 3.09 (q, J= 7.28 Hz, 2 H), 2.31 (br d, J= 11.03 Hz, 2 H), 2.15 (br d, J= 12.13 Hz, 2 H), 1.44 - 1.67 (m, 4 H), 1.35 (t, J = 7.50 Hz, 3 H). LCMS: mlz 499.3 (M+H).

Example 18: Synthesis of l-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6- yl)-l-methyl-lH-pyrazol-3-yl)-3-(3-(trifluoromethyl)phenyl)u rea (19)

Step 1: [00190] To a solution of tert-butyl (6-(3-amino-l-methyl-lH-pyrazol-5-yl)-8- ethylquinazolin-2-yl)((lr,4r)-4-(bis(tert-butoxycarbonyl)ami no)cyclohexyl)carbamate (40 mg, 60.1 umol) in DCM (2.0 mL) was added TEA (12 mg, 120.1 umol, 16.6 uL) and l-isocyanato-3- (trifluoromethyl)benzene (13 mg, 72.1 umol). The mixture was stirred at 25°C for 24 h. The reaction mixture was concentrated under reduced pressure. The residue was purified by prep- TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 1/1) to afford tert-butyl ((lr,4r)-4-(bis(tert- butoxycarbonyl)amino)cyclohexyl)(8-ethyl-6-(l-methyl-3-(3-(3 -(trifluoromethyl)phenyl)ureido)- lH-pyrazol-5-yl)quinazolin-2-yl)carbamate (55 mg, crude).

Step 2:

[00191] To a solution of tert-butyl ((lr,4r)-4-(bis(tert- butoxycarbonyl)amino)cyclohexyl)(8-ethyl-6-(l-methyl-3-(3-(3 -(trifluoromethyl)phenyl)ureido)- lH-pyrazol-5-yl)quinazolin-2-yl)carbamate (55 mg, 64.4 umol) in DCM (2.0 mL) was added TFA (1.0 mL). The mixture was stirred at 25°C for 1 h. The reaction mixture was concentrated under reduced pressure. The residue was added dichloromethane (2.0 mL) and H ₃ .H ₂ 0 (0.1 ml, 25% solution) to pH = 7, concentrated under reduced pressure again. The residue was purified by prep-HPLC (FA condition) to give l-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8- ethylquinazolin-6-yl)-l-methyl-lH-pyrazol-3-yl)-3-(3-(triflu oromethyl)phenyl)urea (17.0 mg, 28.1 umol, 43.5% yield, FA). 1H MR (METHANOL-^, 400MHz): δ 9.08 (s, 1H), 8.56 (br s, 1H), 8.00 (s, 1H), 7.75 (s, 1H), 7.69 - 7.58 (m, 2H), 7.50 (t, J= 7.9 Hz, 1H), 7.33 (br d, J= 7.6 Hz, 1H), 6.42 (s, 1H), 4.07 - 3.94 (m, 1H), 3.87 (s, 3H), 3.24 - 3.03 (m, 3H), 2.34 (br d, J= 11.0 Hz, 2H), 2.17 (br d, J= 10.9 Hz, 2H), 1.72 - 1.45 (m, 4H), 1.37 (t, J= 7.5 Hz, 3H). LCMS: mlz 553.2 (M+H).

Example 19: Synthesis of l-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6- yl)-l-methyl-lH-pyrazol-3-yl)-3-(3,5-bis(trifluoromethyl)phe nyl)urea (21).

Step 1:

[00192] To a solution of tert-butyl (6-(3-amino-l-methyl-lH-pyrazol-5-yl)-8- ethylquinazolin-2-yl)((lr,4r)-4-(bis(tert-butoxycarbonyl)ami no)cyclohexyl)carbamate (40 mg, 60.0 umol) in DCM (2.0 mL) was added TEA (12, 120.1 umol, 16.6 uL) and l-isocyanato-3,5- bis(trifluoromethyl)benzene (23 mg, 90.1 umol, 15.5 uL). The mixture was stirred at 25°C for 12 h. The reaction mixture was concentrated under reduced pressure. The residue was purified by prep-TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 1/1) to afford tert-butyl ((lr,4r)-4-(bis(tert- butoxycarbonyl)amino)cyclohexyl)(6-(3-(3-(3,5-bis(trifluorom ethyl)phenyl)ureido)-l-methyl- lH-pyrazol-5-yl)-8-ethylquinazolin-2-yl)carbamate (50 mg, crude).

Step 2:

[00193] To a solution of tert-butyl ((lr,4r)-4-(bis(tert- butoxycarbonyl)amino)cyclohexyl)(6-(3-(3-(3,5-bis(trifluorom ethyl)phenyl)ureido)-l-methyl- lH-pyrazol-5-yl)-8-ethylquinazolin-2-yl)carbamate (50 mg, 54.2 umol) in DCM (2.0 mL) was added TFA (1.0 mL). The mixture was stirred at 25°C for 0.5 h. The reaction mixture was concentrated under reduced pressure. The residue was added dichl orom ethane (2.0 mL) and H ₃ .H ₂ 0 (0.1 ml, 25% solution) to pH = 7, concentrated under reduced pressure again. The residue was purified by prep-HPLC (FA condition) to give l-(5-(2-(((lr,4r)-4- aminocyclohexyl)amino)-8-ethylquinazolin-6-yl)-l -methyl- lH-pyrazol-3-yl)-3 -(3,5- bis(trifluoromethyl)phenyl)urea (16.5 mg, 22.0 umol, 40.5% yield, FA). 1H NMR (DMSO-i¾, 400MHz): δ 10.85 (br s, 1H), 10.30 (br s, 1H), 9.12 (br s, 1H), 8.50 (br s, 1H), 8.22 (s, 2H), 7.81 (d, J= 1.8 Hz, 1H), 7.68 (d, J= 1.8 Hz, 1H), 7.56 (s, 1H), 7.49 (br s, 1H), 6.58 (s, 1H), 3.80 (s, 4H), 3.00 (q, J= 7.3 Hz, 3H), 2.17 - 1.91 (m, 4H), 1.53 - 1.33 (m, 4H), 1.29 (t, J= 7.5 Hz, 3H). LCMS: mlz 621.2 (M+H).

Example 20: Synthesis of 2-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6- -l-methyl-lH-pyrazol-3-yl)-N-(3-(trifluoromethyl)phenyl)acet amide (23)

Step 1:

[00194] To a mixture of methyl 2-(l-methyl-5-(((trifluoromethyl)sulfonyl)oxy)-lH- pyrazol-3-yl)acetate (60 mg, 201.43 umol) tert-butyl ((lr,4r)-4-((8-ethyl-6-(4,4,5,5-tetramethyl- l,3,2-dioxaborolan-2-yl)quinazolin-2-yl)amino)cyclohexyl)car bamate (100 mg, 201.4 umol) in dioxane (3.0 mL) and H ₂ 0 (300.0 uL) was added K ₂ C0 ₃ (83 mg, 604.2 umol) and Pd(dppf)Cl ₂ (29 mg, 40.2 umol). The mixture was stirred at 90°C for 12 h under N ₂ atmosphere. The reaction mixture was concentrated under reduced pressure. The residue was purified by prep- TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 0/1) to afford methyl 2-(5-(2-(((lr,4r)-4-((tert- butoxycarbonyl)amino)cyclohexyl)amino)-8-ethylquinazolin-6-y l)-l -methyl- lH-pyrazol-3- yl)acetate (40 mg, 76.5 umol, 38.0% yield).

Step 2:

[00195] To a solution of methyl 2-(5-(2-(((lr,4r)-4-((tert- butoxycarbonyl)amino)cyclohexyl)amino)-8-ethylquinazolin-6-y l)-l -methyl- lH-pyrazol-3- yl)acetate (40 mg, 76.5 umol) in THF (3.0 mL) and H ₂ 0 (1.0 mL) was added LiOH.H ₂ 0 (16 mg, 382.6 umol). The mixture was stirred at 30°C for 12 h. The reaction mixture was concentrated under reduced pressure. The residue was diluted with water (1.0 mL) then added HC1 (1M) to make pH = 4-5 and extracted with ethyl acetate (5 mL χ 3). The combined organic layers were washed with brine (5 mL), dried over Na ₂ S0 ₄ , filtered and concentrated under reduced pressure to give 2-(5-(2-(((lr,4r)-4-((tert-butoxycarbonyl)amino)cyclohexyl)a mino)-8-ethylquinazolin-6- yl)-l-methyl-lH-pyrazol-3-yl)acetic acid (28 mg, crude).

Step 3:

[00196] A mixture of 2-(5-(2-(((lr,4r)-4-((tert-butoxycarbonyl)amino)cyclohexyl)a mino)-

8-ethylquinazolin-6-yl)-l -methyl- lH-pyrazol-3-yl)acetic acid (23 mg, 46.5 umol), 3- (trifluoromethyl)aniline (7 mg, 46.5 umol, 5.81 uL), EDCI (13 mg, 69.7 umol) in pyridine (3.0 mL) was degassed and purged with N ₂ for 3 times, and then the mixture was stirred at 45°C for 12 h under N ₂ atmosphere. The reaction mixture was concentrated under reduced pressure. The residue was diluted with water (5 mL) and extracted with DCM (5 mL χ 3). The combined organic layers were washed with brine (lOmL χ 3), dried over Na ₂ S0 ₄ , filtered and concentrated under reduced pressure to afford tert-butyl ((lr,4r)-4-((8-ethyl-6-(l-methyl-3-(2-oxo-2-((3- (trifluoromethyl)phenyl)amino)ethyl)-lH-pyrazol-5-yl)quinazo lin-2- yl)amino)cyclohexyl)carbamate (25 mg, crude). Step 4:

[00197] To a solution of tert-butyl ((lr,4r)-4-((8-ethyl-6-(l-methyl-3-(2-oxo-2-((3-

(trifluoromethyl)phenyl)amino)ethyl)-lH-pyrazol-5-yl)quin azolin-2- yl)amino)cyclohexyl)carbamate (25 mg, 38.3 umol) in DCM (2.0 mL) was added TFA (1.0 mL). The mixture was stirred at 15°C for 5 min. The reaction mixture was concentrated under reduced pressure. The residue was dissolved in MeOH (2.0 mL) and basified pH to 8 with H ₃ .H ₂ 0 (25% solution). The residue was purified by prep-HPLC (FA condition) to afford 2-(5-(2- (((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin-6-yl)-l -methyl- lH-pyrazol-3-yl)-N-(3- (trifluoromethyl)phenyl)acetamide (4.5 mg, 7.0 umol, 18.4% yield, FA). ¹ H MR

(METHANOL-^, 400MHz): δ 9.10 (br s, 1 H), 8.07 (s, 1 H), 7.74 - 7.80 (m, 2 H), 7.70 (s, 1 H), 7.51 (t, J= 8.07 Hz, 1 H), 7.39 (d, J= 7.83 Hz, 1 H), 6.43 (s, 1 H), 4.02 (br s, 1 H), 3.83 - 3.93 (m, 3 H), 3.74 - 3.81 (m, 2 H), 3.15 - 3.22 (m, 1 H), 3.09 (q, J= 7.34 Hz, 2 H), 2.32 (br d, J = 11.25 Hz, 2 H), 2.15 (br d, J= 11.74 Hz, 2 H), 1.46 - 1.67 (m, 4 H), 1.27 - 1.40 (m, 3 H). LCMS: mlz 552.3 (M+H).

Example 21: Synthesis of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6- yl)-l-methyl-lH-pyrazol-3-yl)-2-(3-(trifluoromethyl)phenyl)p ropanamide (25)

Step 1:

[00198] A solution of 2-[3-(trifluoromethyl)phenyl]acetic acid (300 mg, 1.4 mmol) in THF

(2.0 mL) was added to a solution of LDA (2 M, 2.9 mL) in THF (5.0 mL) at -78°C. After 1 h

Mel (1.6 g, 11.7 mmol, 731.8 uL) was added. The mixture was stirred at -78°C for 1 h. The reaction mixture was quenched by addition HC1 (2 M) adjusted pH = 4 and extracted with ethyl acetate (10.0 mL ^χ 3). The combined organic layers were washed with brine (10.0 mL ^χ 3), dried over Na ₂ S0 ₄ , filtered and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 1/1) to afford 2-(3- (trifluoromethyl)phenyl)propanoic acid (200 mg, crude). 1H MR (METHANOL-^, 400MHz): δ 7.65 - 7.45 (m, 4H), 3.82 (br d, J= 7.1 Hz, 1H), 1.48 (d, J= 7.3 Hz, 3H).

Step 2:

[00199] To a mixture of 2-(3-(trifluoromethyl)phenyl)propanoic acid (13 mg, 60.0 umol) and EDCI (17 mg, 90.1 umol) in Pyridine (2.0 mL) was added tert-butyl (6-(3 -amino- 1-m ethyl- lH-pyrazol-5-yl)-8-ethylquinazolin-2-yl)((lr,4r)-4-(bis(tert - butoxycarbonyl)amino)cyclohexyl)carbamate (40 mg, 60.0 umol). The mixture was stirred at 45°C for 12 h. The mixture was concentrated to get crude residue and added DCM (5.0 mL), washed with brine (5 mL χ 3), dried over Na ₂ S0 ₄ , filtered and concentrated under reduced pressure to give tert-butyl ((lr,4r)-4-(bis(tert-butoxycarbonyl)amino)cyclohexyl)(8-ethy l-6-(l- methyl-3-(2-(3-(trifluoromethyl)phenyl)propanamido)-lH-pyraz ol-5-yl)quinazolin-2- yl)carbamate (55 mg, crude).

Step 3:

[00200] A solution of tert-butyl ((lr,4r)-4-(bis(tert-butoxycarbonyl)amino)cyclohexyl)(8- ethyl-6-(l-methyl-3-(2-(3-(trifluoromethyl)phenyl)propanamid o)-lH-pyrazol-5-yl)quinazolin-2- yl)carbamate (55 mg, 63.5 umol) in DCM (2.0 mL) and TFA (1.0 mL) was stirred at 15°C for 10 min. The mixture was concentrated to get crude residue. The residue was dissolved in MeOH (2.0 mL) and basified pH to 8 with H ₃ .H ₂ 0 (25% solution). The residue was purified by prep- HPLC (FA condition) to afford N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin - 6-yl)-l-methyl-lH-pyrazol-3-yl)-2-(3-(trifluoromethyl)phenyl )propanamide (9.7 mg, 15.8 umol, 24.9% yield, FA). 1H NMR (METHANOL-^, 400MHz): δ 9.04 (s, 1H), 8.54 (s, 1H), 7.76 - 7.66 (m, 3H), 7.63 (d, J= 2.0 Hz, 1H), 7.59 - 7.48 (m, 2H), 6.65 (s, 1H), 4.04 - 3.91 (m, 2H), 3.80 (s, 3H), 3.21 - 3.02 (m, 3H), 2.30 (br d, J= 11.7 Hz, 2H), 2.13 (br d, J= 11.2 Hz, 2H), 1.67 - 1.42 (m, 7H), 1.33 (t, J= 7.5 Hz, 3H). LCMS: mlz 566.5 (M+H).

Example 22: Synthesis of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6- y -l-methyl-lH-pyrazol-3-yl)-2-(3-fluoro-5-methylphenyl)acetam ide (27)

Step 1:

[00201] To a solution of 2-(3-fluoro-5-methyl-phenyl)acetonitrile (100 mg, 670.4 umol) in

H ₂ 0 (1.0 mL) was added HCl (1.0 mL, 36%) and H ₂ S0 ₄ (1.0 mL, 98%). The mixture was stirred at 70°C for 1 h. The reaction was extracted with ethyl acetate (3.0 mL ^χ 3), dried over anhydrous Na ₂ S0 ₄ , filtered and concentrated to give 2-(3-fluoro-5-methylphenyl)acetic acid (80 mg, crude).

Step 2:

[00202] To a solution of tert-butyl (6-(3-amino-l-methyl-lH-pyrazol-5-yl)-8- ethylquinazolin-2-yl)((lr,4r)-4-(bis(tert-butoxycarbonyl)ami no)cyclohexyl)carbamate (40 mg, 60.0 umol) in pyridine (2.0 mL) was added 2-(3-fluoro-5-methylphenyl)acetic acid (12 mg, 66.0 umol) and EDCI (35 mg, 180.2 umol). The mixture was stirred at 45°C for 12 h. The reaction was concentrated to give a residue. The residue was dissolved in DCM (3.0 mL) and washed with brine (3 mL x 3), dried over anhydrous Na ₂ S0 ₄ , filtered and concentrated to afford tert- butyl ((lr,4r)-4-(bis(tert-butoxycarbonyl)amino)cyclohexyl)(8-ethy l-6-(3-(2-(3-fluoro-5- methylphenyl)acetamido)-l-methyl-lH-pyrazol-5-yl)quinazolin- 2-yl)carbamate (40 mg, crude). Step 3:

[00203] To a solution of tert-butyl ((lr,4r)-4-(bis(tert- butoxycarbonyl)amino)cyclohexyl)(8-ethyl-6-(3-(2-(3-fluoro-5 -methylphenyl)acetamido)-l- methyl-lH-pyrazol-5-yl)quinazolin-2-yl)carbamate (40 mg, 49.0 umol) in DCM (2.0 mL) was added TFA (1.0 mL). The mixture was stirred at 15°C for 15 min. The reaction was

concentrated to give a residue. The residue was dissolved in MeOH (1.0 mL) and basified pH to 7 with H ₃ .H ₂ 0 (25% solution). The residue was purified by prep-HPLC (FA condition) to afford N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6-yl)-l -methyl- 1H- pyrazol-3-yl)-2-(3-fluoro-5-methylphenyl)acetamide (27.8 mg, 48.3 umol, 98.6% yield, FA). 1H MR (DMSO-i¾, 400MHz): δ 10.72 (s, 1H), 9.11 (br s, 1H), 7.95 (br s, 3H), 7.78 (br s, 1H), 7.64 (s, 1H), 7.53 (br s, 1H), 6.99 - 6.79 (m, 3H), 6.64 (s, 1H), 3.79 (s, 4H), 3.59 (s, 2H), 2.98 (q, J= 7.4 Hz, 3H), 2.28 (s, 3H), 2.18 - 1.89 (m, 4H), 1.56 - 1.15 (m, 7H). LCMS: mlz 516.2 (M+H).

Example 23: Synthesis of l-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6- yl)-l-methyl-lH-pyrazol-3-yl)-3-(4-(3-(methylamino)propoxy)- 3- (trifluoromethyl)phenyl)urea (29)

Step 1:

[00204] To a solution of tert-butyl N-(3-hydroxypropyl)-N-methyl-carbamate (200 mg, 1.0 mmol) in THF (4.0 mL) was added NaH (46 mg, 1.1 mmol, 60%) at 0°C, the mixture was stirred at 15°C for 1 h, and then added l-fluoro-4-nitro-2-(trifluoromethyl)benzene (177 mg, 848.0 umol, 116.6 uL). The mixture was stirred at 30°C for 12 h. The reaction mixture was quenched by addition H ₄ C1 (5.0 mL), and then extracted with ethyl acetate (5.0 mL x 3). The combined organic layers were washed with brine (5.0 mL ^χ 3), dried over Na ₂ S0 ₄ , filtered and

concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 3/1) to afford tert-butyl methyl(3-(4-nitro-2- (trifluoromethyl)phenoxy)propyl)carbamate (203 mg, crude).

Step 2:

[00205] A mixture of tert-butyl methyl(3-(4-nitro-2-

(trifluoromethyl)phenoxy)propyl)carbamate (200 mg, 528.6 umol), Pd/C (200 mg, 528.6 umol, 10% Pd) in MeOH (10.0 mL) was degassed and purged with H ₂ , and then the mixture was stirred at 25°C for 12 h under H ₂ atmosphere with 15 psi. The reaction mixture was filtered and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 3/1) to afford tert-butyl (3-(4-amino-2- (trifluoromethyl)phenoxy)propyl)(methyl)carbamate (60 mg, crude). M+H ⁺ = 349.0 (LCMS). Step 3:

[00206] To a solution of tert-butyl (3-(4-amino-2-

(trifluoromethyl)phenoxy)propyl)(methyl)carbamate (30 mg, 86.1 umol) in DCM (3.0 ml) was added DIEA (11 mg, 90.1 umol, 15.7 uL). The mixture was cooled to -20°C for 0.5 h and then added bis(trichloromethyl) carbonate (6 mg, 19.8 umol) quickly avoiding water. The mixture was stirred at -20°C for 1 h, then added tert-butyl (6-(3-amino-l-methyl-lH-pyrazol-5-yl)-8- ethylquinazolin-2-yl)((lr,4r)-4-(bis(tert-butoxycarbonyl)ami no)cyclohexyl)carbamate (40 mg, 60.0 umol) in DCM (1.0 ml) by injector and then stirred at 15°C for 12 h. The reaction mixture was concentrated under reduced pressure. The residue was purified prep-TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 0/1) to afford tert-butyl ((lr,4r)-4-(bis(tert- butoxycarbonyl)amino)cyclohexyl)(6-(3-(3-(4-(3-((tert- butoxycarbonyl)(methyl)amino)propoxy)-3-(trifluoromethyl)phe nyl)ureido)-l-methyl-lH- pyrazol-5-yl)-8-ethylquinazolin-2-yl)carbamate (20 mg, crude).

Step 4:

[00207] To a solution of tert-butyl ((lr,4r)-4-(bis(tert- butoxycarbonyl)amino)cyclohexyl)(6-(3-(3-(4-(3-((tert- butoxycarbonyl)(methyl)amino)propoxy)-3-(trifluoromethyl)phe nyl)ureido)-l-methyl-lH- pyrazol-5-yl)-8-ethylquinazolin-2-yl)carbamate (45 mg, 43.2 umol) in DCM (2.0 mL) was added TFA (1.0 mL). The mixture was stirred at 25°C for 0.5 h. The reaction mixture was

concentrated under reduced pressure. The residue was added dichl orom ethane (2.0 mL) and H ₃ .H ₂ O (25% solution) to pH = 7, concentrated under reduced pressure again. The residue was purified by prep-HPLC (FA condition) to give l-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8- ethylquinazolin-6-yl)- 1 -methyl- 1 H-pyrazol-3 -yl)-3 -(4-(3 -(m ethyl amino)propoxy)-3 - (trifluoromethyl)phenyl)urea (5.6 mg, 7.5 umol, 17.4% yield, FA). M+H ⁺ = 640.4 (LCMS); 1H MR (METHANOL-^, 400MHz): δ 9.06 (s, 1H), 8.49 (br s, 2H), 7.83 (d, J= 2.0 Hz, 1H), 7.73 (s, 1H), 7.67 - 7.56 (m, 2H), 7.17 (br d, J= 9.0 Hz, 1H), 6.36 (s, 1H), 4.21 (br t, J= 5.4 Hz, 2H), 3.99 (br t, J= 11.0 Hz, 1H), 3.84 (s, 3H), 3.26 - 3.03 (m, 5H), 2.74 (s, 3H), 2.31 (br d, J= 10.8 Hz, 2H), 2.25 - 2.10 (m, 4H), 1.69 - 1.43 (m, 4H), 1.35 (t, J= 7.4 Hz, 3H).

Example 24: Synthesis of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6- yl)-l-methyl-lH-pyrazol-3-yl)-2-(4-(3-(methylamino)propoxy)- 3- (trifluoromethyl)phenyl)acetamide (30)

Step 1:

[00208] To a solution of methyl 2-(4-hydroxy-3-(trifluoromethyl)phenyl)acetate (50 mg,

213.5 umol) and PPh ₃ (84 mg, 320.2 umol) in THF (2.0 mL) were added tert-butyl N-(3- hydroxypropyl)-N-methyl-carbamate (60 mg, 320.2 umol) and DIAD (64 mg, 320.2 umol, 62.2 uL). The mixture was stirred at 25°C for 12 h under N ₂ . The mixture was concentrated to get crude residue. The residue was purified by prep-TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 3/1) to afford methyl 2-(4-(3-((tert-butoxycarbonyl)(methyl)amino)propoxy)-3- (trifluoromethyl)phenyl)acetate (100 mg, crude). M+H ⁺ -56 = 350.0 (LCMS).

Step 2:

[00209] To a solution of methyl 2-(4-(3-((tert-butoxycarbonyl)(methyl)amino)propoxy)-3-

(trifluoromethyl)phenyl)acetate (100 mg, 246.6 umo) in THF (3.0 mL) and H ₂ 0 (1.0 mL) was added LiOH.H ₂ 0 (51 mg, 1.2 mmol). The mixture was stirred at 25°C for 12 h. The mixture was adjusted pH=4 with HC1 (1 M) and extracted with ethyl acetate (5.0 mL ^χ 3). The combined organic layers were washed with brine(3.0 mL ^χ 2), dried over Na ₂ S0 ₄ , filtered and concentrated under reduced pressure to afford 2-(4-(3-((tert-butoxycarbonyl)(methyl)amino)propoxy)-3- (trifluoromethyl)phenyl) acetic acid (90 mg, crude).

Step 3:

[00210] To a solution of tert-butyl (6-(3-amino-l-methyl-lH-pyrazol-5-yl)-8- ethylquinazolin-2-yl)((lr,4r)-4-(bis(tert-butoxycarbonyl)ami no)cyclohexyl)carbamate (40 mg, 60.0 umol) in pyridine (2.0 mL) were added 2-(4-(3-((tert- butoxycarbonyl)(methyl)amino)propoxy)-3-(trifluoromethyl)phe nyl)acetic acid (23 mg, 60.0 umol) and EDCI (17 mg, 90.1 umol). The mixture was stirred at 45°C for 12 h. The mixture was concentrated to get crude residue and added DCM (5.0 mL) washed with brine (5.0 mL ^χ 3), dried over Na ₂ S0 ₄ , filtered and concentrated under reduced pressure to afford 2-(4-(3-((tert- butoxycarbonyl)(methyl)amino)propoxy)-3-(trifluoromethyl)phe nyl).

acetic acid (50 mg, crude).

Step 4:

[00211] A solution of 2-(4-(3-((tert-butoxycarbonyl)(methyl)amino)propoxy)-3-

(trifluoromethyl)phenyl) acetic acid (50 mg, 48.1 umol) in DCM (2.0 mL) and TFA (1.0 mL) was stirred at 15°C for 10 min. The mixture was concentrated to get crude residue. The residue was dissolved in MeOH (2.0 mL) and basified pH to 8 with H ₃ .H ₂ 0 (25% solution), concentrated to give a residue. The residue was purified by prep-HPLC (FA condition) to afford N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6-yl)-l -methyl- lH-pyrazol-3-yl)- 2-(4-(3-(methylamino)propoxy)-3-(trifluoromethyl)phenyl)acet amide (10.0 mg, 12.7 umol, 26.4% yield, FA). M+H ⁺ = 639.3 (LCMS); 1H MR (METHANOL-^, 400MHz): δ 9.04 (s, 1H), 8.53 (br s, 2H), 7.70 (s, 1H), 7.66 - 7.51 (m, 3H), 7.17 (br d, J= 8.2 Hz, 1H), 6.64 (s, 1H), 4.22 (br s, 2H), 3.98 (br t, J= 10.9 Hz, 1H), 3.82 (s, 3H), 3.71 (s, 2H), 3.25 - 3.01 (m, 6H), 2.72 (s, 3H), 2.35 - 2.08 (m, 6H), 1.69 - 1.42 (m, 4H), 1.33 (br t, J= 7.4 Hz, 3H). Example 25: Synthesis of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)benzo[h]quinazolin -6- -l-methyl-lH-pyrazol-3-yl)-2-(3-(trifluoromethyl)phenyl)acet amide (31)

Step 1:

[00212] To a solution of l-bromo-4-fluoro-naphthalene (1.0 g, 4.4 mmol) in THF (10.0 mL) was added LDA (2 M, 3.3 mL) at -78°C under N ₂ . The mixture was stirred at -78 °C for 1 h. Then DMF (356 mg, 4.8 mmol, 375.7 uL) was added. The mixture was stirred at -78°C for 2 h. The reaction mixture was quenched by addition H ₄ C1 (10.0 mL), extracted with ethyl acetate (10.0 mL x 3). The combined organic layers were washed with brine (10.0 mL x 3), dried over Na ₂ S0 ₄ , filtered and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 10/1) to afford 4-bromo-l-fluoro- 2-naphthaldehyde (1.0 g, 3.36 mmol, 75.6% yield). (DMSO-i¾, 400MHz): δ 10.40 (s, 1H), 8.35 (d, J= 8.3 Hz, 1H), 8.24 (d, J= 8.6 Hz, 1H), 8.08 (d, J= 6.1 Hz, 1H), 8.00 (t, J= 7.7 Hz, 1H), 7.92 - 7.85 (m, 1H).

Step 2:

[00213] To a solution of carbonic acid; guanidine (498 mg, 2.7 mmol) and DIEA (765 mg,

5.9 mmol, 1.03 mL) in DMA (30.0 mL) was warmed to 90°C. Then a solution of 4-bromo-l- fluoro-2-naphthaldehyde (1.0 g, 3.9 mmol) in DMA (9.0 mL) was added dropwise. The mixture was stirred at 90°C for 1 h. Then the mixture was stirred at 160°C for 3 h. The reaction mixture was diluted with H ₂ 0 (40.0 mL) filtered and the cake concentrated to afford 6- bromobenzo[h]quinazolin-2-amine (800 mg, 2.4 mmol, 62.8% yield). 1H NMR (DMSO-i¾, 400MHz): δ 9.06 (s, 1H), 9.00 (br d, J= 8.1 Hz, 1H), 8.22 - 8.06 (m, 2H), 7.90 (br t, J= 7.4 Hz, 1H), 7.83 - 7.73 (m, 1H), 7.17 (br s, 2H).

Step 3:

[00214] To a solution of 6-bromobenzo[h]quinazolin-2-amine (500 mg, 1.8 mmol) and diiodomethane (2.4 g, 9.1 mmol, 734.11 uL) in THF (10.0 mL) was added iodocopper (346 mg, 1.8 mmol) and isopentyl nitrite (639 mg, 5.4 mmol, 735.2 uL). The mixture was stirred at 80°C for 2 h under N ₂ . The reaction mixture was diluted with NH ₃ H ₂ 0 (25 %, 20.0 mL) and extracted with ethyl acetate (20.0 mL x 3). The combined organic layers were washed with brine (20.0 mL x 3), dried over Na ₂ S0 ₄ , filtered and concentrated under reduced pressure to give a residue. The residue was purified by column chromatography (Si0 ₂ , Petroleum ether / Ethyl acetate = 1/0 to 5/1) to afford 6-bromo-2-iodobenzo[h]quinazoline (500 mg, crude). 1H NMR (DMSO-i¾, 400MHz): δ 9.29 (s, 1H), 9.07 (d, J= 7.9 Hz, 1H), 8.44 (s, 1H), 8.31 (d, J= 8.2 Hz, 1H), 8.06 (t, J= 7.6 Hz, 1H), 7.99 - 7.91 (m, 1H).

Step 4:

[00215] To a solution of tert-butyl N-(4-aminocyclohexyl)carbamate (222 mg, 1.0 mmol) and DIEA (100 mg, 779.2 umol, 136.09 uL) in n-BuOH (4.0 mL) was added 6-bromo-2- iodobenzo[h]quinazoline (200 mg, 519.4 umol). The mixture was stirred at 100°C for 12 h. The mixture was concentrated to get crude residue. The residue was purified by column

chromatography (Si0 ₂ , Petroleum ether / Ethyl acetate = 1/0 to 3/1) to afford tert-butyl((lr,4r)-4- ((6-bromobenzo[h]quinazolin-2-yl)amino)cyclohexyl)carbamate (150 mg, crude). M+H ⁺ = 471.0 (LCMS).

Step 5:

[00216] To a solution of tert-butyl((lr,4r)-4-((6-bromobenzo[h]quinazolin-2- yl)amino)cyclohexyl)carbamate (150 mg, 318.2 umol) in Boc ₂ 0 (2.8 g, 13.06 mmol, 3.00 mL) were added DMAP (38 mg, 318.2 umol) and TEA (96 mg, 954.6 umol, 132.3 uL). The mixture was stirred at 100°C for 12 h. The residue was purified by column chromatography (Si0 ₂ , Petroleum ether / Ethyl acetate = 1/0 to 4/1) to afford tert-butyl ((lr,4r)-4-(bis(tert- butoxycarbonyl)amino)cyclohexyl)(6-bromobenzo[h] quinazolin-2-yl)carbamate (200 mg, crude). M+H ⁺ = 671.3 (LCMS).

Step 6:

[00217] To a solution of tert-butyl ((lr,4r)-4-(bis(tert- butoxycarbonyl)amino)cyclohexyl)(6-bromobenzo[h] quinazolin-2-yl)carbamate (200 mg, 297.7 umol) and KOAc (87 mg, 893.3 umol) in dioxane (10.0 mL) were added 4,4,4',4',5,5,5',5'- octamethyl-2,2'-bi(l,3,2-dioxaborolane) (90 mg, 357.3 umol) and Pd(dppf)Cl ₂ (21 mg, 29.7 umol). The mixture was stirred at 90°C for 12 h under N _2. The mixture was concentrated to get crude residue. The residue was purified by column chromatography (Si0 ₂ , Petroleum ether / Ethyl acetate = 1/0 to 4/1) to afford tert-butyl ((lr,4r)-4-(bis(tert- butoxycarbonyl)amino)cyclohexyl)(6-(4,4,5,5-tetramethyl-l,3, 2-dioxaborolan-2- yl)benzo[h]quinazolin-2-yl)carbamate (200 mg, crude).

Step 7:

[00218] To a solution of tert-butyl ((lr,4r)-4-(bis(tert- butoxycarbonyl)amino)cyclohexyl)(6-(4,4,5,5-tetramethyl-l,3, 2-dioxaborolan-2- yl)benzo[h]quinazolin-2-yl)carbamate (200 mg, 278.2 umol) and K ₂ C0 ₃ (115 mg, 834.8 umol) in dioxane (10.0 mL) and H ₂ 0 (1.0 mL) were added 5-bromo-l -methyl- lH-pyrazol-3 -amine (48 mg, 278.2 umol) and Pd(dppf)Cl ₂ (10 mg, 13.9 umol). The mixture was stirred at 90°C for 12 h under N _2. The mixture was concentrated to get crude residue. The residue was purified by prep- TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 10/1) to tert-butyl (6-(3 -amino- 1 -methyl -1 H- pyrazol-5-yl)benzo[h]quinazolin-2-yl)((lr,4r)-4-(bis(tert- butoxycarbonyl)amino)cyclohexyl)carbamate (30 mg, crude). M+H ⁺ = 688.2 (LCMS).

Step 8:

[00219] To a solution of 2-[3-(trifluoromethyl)phenyl]acetic acid (8 mg, 43.6 umol) in pyridine (2.0 mL) were added tert-butyl (6-(3-amino-l-methyl-lH-pyrazol-5- yl)benzo[h]quinazolin-2-yl)((lr,4r)-4-(bis(tert-butoxycarbon yl)amino)cyclohexyl)carbamate (30 mg, 43.6 umol) EDCI (12 mg, 65.4 umol). The mixture was stirred at 45°C for 12 h. The mixture was concentrated to get crude residue. The residue was purified by prep-TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 0/1) to afford tert-butyl ((lr,4r)-4-(bis(tert- butoxycarbonyl)amino)cyclohexyl)(6-(l-methyl-3-(2-(3-(triflu oromethyl)phenyl)acetamido)-lH- pyrazol-5-yl)benzo[h]quinazolin-2-yl)carbamate (30 mg, crude).

Step 9:

[00220] A solution of tert-butyl ((lr,4r)-4-(bis(tert-butoxycarbonyl)amino)cyclohexyl)(6-

(l-methyl-3-(2-(3-(trifluoromethyl)phenyl)acetamido)-lH-p yrazol-5-yl)benzo[h]quinazolin-2- yl)carbamate (30 mg, 34.3 umol) in DCM (2.0 mL) and TFA (1.0 mL) was stirred at 15°C for 10 min. The mixture was concentrated to get crude residue. The residue was dissolved in MeOH (2.0 mL) and basified pH to 8 with H ₃ .H ₂ 0 (25% solution), concentrated to give a residue. The residue was purified by prep-HPLC (FA condition) to afford N-(5-(2-(((lr,4r)-4- aminocyclohexyl)amino)benzo[h]quinazolin-6-yl)-l -methyl- lH-pyrazol-3-yl)-2-(3- (trifluoromethyl)phenyl)acetamide (2.6 mg, 3.9 umol, 11.5% yield, FA). M+H ⁺ = 574.2

(LCMS); 1H MR (METHANOL-^, 400MHz): δ 9.11 (br d, J= 7.7 Hz, 1H), 9.00 (s, 1H), 8.55 (br s, 1H), 7.76 - 7.62 (m, 5H), 7.61 - 7.51 (m, 3H), 6.68 (s, 1H), 4.12 (br s, 1H), 3.83 (s, 2H), 3.55 (s, 3H), 3.10 (br s, 1H), 2.33 (br s, 2H), 2.13 (br d, J= 11.2 Hz, 2H), 1.69 - 1.42 (m, 4H).

Example 26: Synthesis of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6- yl)-l-methyl-lH-pyrazol-3-yl)-2-(4-((l-methylpiperidin-4-yl) oxy)-3- (trifluoromethyl)phenyl)acetamide (32)

Step 1:

[00221] To a stirred suspension of 4-methoxy-3-(trifluoromethyl)benzoic acid (200 mg,

908.5 umol) in toluene (8.0 mL) was added SOCl ₂ (205 mg, 1.7 mmol, 125.2 uL) and catalytic amount of DMF (6 mg, 90.8 umol, 7 uL) at 15°C under N ₂ atmosphere. The mixture was stirred at 100°C for 3 h under N ₂ atmosphere. After cooling to 15°C, the reaction mixture was concentrated under reduced pressure. The resulting residue was dissolved in THF (10.0 mL), and then TEA (147 mg, 1.4 mmol, 201.5 uL) and TMSCHN2 (2.0 M, 726.8 uL, in n-hexane) were added at 0°C. The reaction mixture was stirred at 30°C for 12 h. The mixture was poured into sat.NaHC0 ₃ solution (10.0 mL) and extracted with ethyl acetate (5.0 mL ^χ 3). The combined extracts were washed with brine (10.0 mL x 3), dried over anhydrous Na ₂ S0 ₄ , filtered and concentrated to give crude product. The residue was purified by prep-TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 3 : 1) to afford 2-diazo-l-(4-methoxy-3-(trifluorom ethyl )phenyl)ethanone (120 mg, 442.3 umol, 48.7% yield). 1H MR (CHLOROFORM- d, 400MHz) δ 8.00 - 7.93 (m, 2H), 7.10 - 7.02 (m, 1H), 5.88 (s, 1H), 3.98 (s, 3H).

Step 2:

[00222] To a refluxed solution of TEA (149 mg, 1.4 mmol, 204.3 uL) and benzoic acid silver (34 mg, 147.4 umol) in MeOH (2.0 mL) and toluene (2.0 mL) was added dropwise a solution of 2-diazo-l-(4-methoxy-3-(trifluoromethyl)phenyl)ethanone (120 mg, 491.5 umol) in MeOH (4.0 mL) with stirring. The reaction mixture was stirred at 70°C for 1 h. The reaction was filtered and concentrated to give a residue. The residue was purified by prep-TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 3/1) to afford methyl 2-(4-methoxy-3-

(trifluoromethyl)phenyl)acetate (90 mg, 326.3 umol, 66.4% yield). 1H MR (CHLOROFORM- d, 400MHz) δ 7.47 (d, J= 1.8 Hz, 1H), 7.41 (dd, J= 1.9, 8.5 Hz, 1H), 6.97 (d, J= 8.4 Hz, 1H), 3.90 (s, 3H), 3.70 (s, 3H), 3.60 (s, 2H).

Step 3:

[00223] To a solution of methyl 2-(4-methoxy-3-(trifluoromethyl)phenyl)acetate (90 mg,

362.6 umol) in DCM (2.0 mL) was added BBr ₃ (727 mg, 2.9 mmol, 279.5 uL). The mixture was stirred at 20°C for 12 h. The reaction was concentrated to give a residue. The residue was purified by prep-TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 2/1) to afford methyl 2-(4- hydroxy-3-(trifluoromethyl)phenyl)acetate (30 mg, crude). M+H ⁺ = 233.0 (LCMS).

Step 4:

[00224] To a solution of methyl 2-(4-hydroxy-3 -(trifluorom ethyl )phenyl)acetate (100 mg,

427.0 umol), tert-butyl 4-hydroxypiperidine-l-carboxylate (86 mg, 427.0 umol) and PPh ₃ (168 mg, 640.5 umol) in THF (2.0 mL) was added DIAD (130 mg, 640.5 umol, 124.5 uL) at 15°C. The mixture was stirred at 45°C for 12 h. The reaction was concentrated to give a residue. The residue was purified by prep-TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 2: 1) to afford tert- butyl 4-(4-(2-methoxy-2-oxoethyl)-2-(trifluoromethyl)phenoxy)piper idine- 1 -carboxylate (150 mg, crude). M+H ⁺ = 362.0 (LCMS).

Step 5:

[00225] To a solution of tert-butyl 4-(4-(2-methoxy-2-oxoethyl)-2-

(trifluoromethyl)phenoxy)piperidine-l -carboxylate (150 mg, 359.3 umol) in DCM (4.0 mL) was added TFA (2.0 mL). The mixture was stirred at 30°C for 0.5 h. The reaction was concentrated to give methyl 2-(4-(piperidin-4-yloxy)-3-(trifluoromethyl)phenyl)acetate (150 mg, crude, TFA). M+H ⁺ = 318.3 (LCMS).

Step 6:

[00226] To a solution of methyl 2-(4-(piperidin-4-yloxy)-3 -

(trifluoromethyl)phenyl)acetate (150 mg, 472.7 umol) and (HCHO)n (128 mg, 1.4 mmol) in MeOH (4.0 mL) was added TEA (48 mg, 472.7 umol, 65.5 uL) to basify pH to 8 and then AcOH

(28 mg, 472.7 umol, 27.0 uL) was added to adjusted pH to 5. The mixture was stirred at 20°C for 2 h. NaBH ₃ CN (297 mg, 4.7 mmol) was added. The mixture was stirred at 30°C for 12 h. The reaction was filtered and concentrated to give a residue. The residue was dissolved in DCM (5.0 mL) and washed with saturated H ₄ CI (3.0 mL x 3), dried over anhydrous Na ₂ S0 ₄ , filtered and concentrated to give a residue. The residue was purified by prep-TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 0/1) to afford methyl 2-(4-((l-methylpiperidin-4-yl)oxy)-3- (trifluoromethyl)phenyl)acetate (100 mg, crude). 1H MR (CHLOROFORM-d, 400MHz) δ 7.44 (s, 1H), 7.38 (br d, J= 8.4 Hz, 1H), 6.91 (d, J= 8.6 Hz, 1H), 4.80 (br s, 1H), 3.64 (s, 3H), 3.54(s, 2H), 3.20 (br d, J= 10.1 Hz, 2H), 3.14 - 3.07 (m, 2H), 2.70 (s, 3H), 2.35 - 2.21 (m, 2H), 2.20 - 2.09 (m, 2H).

Step 7:

[00227] The mixture of methyl 2-(4-((l-methylpiperidin-4-yl)oxy)-3-

(trifluoromethyl)phenyl)acetate (90 mg, 271.6 umol) in HC1 (3.0 mL) (6M) was stirred at 100°C for 12 h. The reaction was concentrated to give 2-(4-((l-methylpiperidin-4-yl)oxy)-3- (trifluoromethyl)phenyl)acetic acid (100 mg, crude, HC1).

Step 8:

[00228] To a solution of tert-butyl (6-(3-amino-l-methyl-lH-pyrazol-5-yl)-8- ethylquinazolin-2-yl)((lr,4r)-4-(bis(tert-butoxycarbonyl)ami no)cyclohexyl)carbamate (50 mg, 75.1 umol) in pyridine (2.0 mL) was added 2-(4-((l-methylpiperidin-4-yl)oxy)-3- (trifluoromethyl)phenyl)acetic acid (24 mg, 75.1 umol) and EDCI (43 mg, 225.3 umol). The mixture was stirred at 45°C for 12 h. The reaction was concentrated to give a residue. The residue was dissolved in ethyl acetate (3.0 mL) and washed with brine (3.0 mL ^χ 3), dried over anhydrous Na ₂ S0 ₄ , filtered and concentrated to give tert-butyl ((lr,4r)-4-(bis(tert- butoxycarbonyl)amino)cyclohexyl)(8-ethyl-6-(l-methyl-3-(2-(4 -((l-methylpiperidin-4-yl)oxy)-3- (trifluoromethyl)phenyl)acetamido)-lH-pyrazol-5-yl)quinazoli n-2-yl)carbamate (70 mg, crude). Step 9:

[00229] To a solution of tert-butyl ((lr,4r)-4-(bis(tert- butoxycarbonyl)amino)cyclohexyl)(8-ethyl-6-(l-methyl-3-(2-(4 -((l-methylpiperidin-4-yl)oxy)-3- (trifluoromethyl)phenyl)acetamido)-lH-pyrazol-5-yl)quinazoli n-2-yl)carbamate (70 mg, 72.5 umol) in DCM (3.0 mL) was added TFA (1.5 mL). The mixture was stirred at 15°C for 15 min. The reaction was concentrated to give a residue. The residue was dissolved in MeOH (2.0 mL) and basified pH to 8 with NH ₃ .H ₂ 0 (25 % solution). The residue was purified by prep-HPLC (FA condition) to afford N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6-yl)-l- methyl-lH-pyrazol-3-yl)-2-(4-((l-methylpiperidin-4-yl)oxy)-3 - (trifluoromethyl)phenyl)acetamide (23.9 mg, 31.2 umol, 43.0% yield, FA). M+H ⁺ = 665.3 (LCMS). 1H MR (METHANOL-d ₄ , 400MHz) δ 9.00 (br s, 1H), 8.53 (br s, 2H), 7.69 - 7.47 (m, 4H), 7.21 (br d, J= 8.4 Hz, 1H), 6.63 (s, 1H), 4.86 (br s, 2H), 3.96 (br s, 1H), 3.87 - 3.75 (m, 3H), 3.73 - 3.63 (m, 2H), 3.23 (br d, J= 19.6 Hz, 4H), 3.05 (q, J= 7.1 Hz, 2H), 2.80 (s, 3H), 2.36 - 2.04 (m, 8H), 1.69 - 1.39 (m, 4H), 1.31 (br t, J= 7.3 Hz, 3H).

Example 27: Synthesis of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6- yl -l-methyl-lH-pyrazol-3-yl)-2-(2-methyl-5-(trifluoromethyl)ph enyl)acetamide (34)

Step 1:

[00230] To a solution of 2-(brom om ethyl)- l-methyl-4-(trifluorom ethyl )benzene (300 mg,

1.1 mmol) in DMF (5.0 mL) was added NaCN (116 mg, 2.3 mmol). The mixture was stirred at 15°C for 12 h. The reaction mixture was diluted with H ₂ 0 (20 mL) and extracted with EtOAc(10 mL x 3). The combined organic layers were washed with brine (10 mL ^χ 3), dried over Na ₂ S0 ₄ , filtered and concentrated under reduced pressure to afford 2-(2-methyl-5- (trifluoromethyl)phenyl)acetonitrile (180 mg, 768.1 umol, 64.5% yield). ¹ H MR

(CHLOROFORM-^, 400MHz): δ 7.62 (s, 1H), 7.53 (br d, J= 7.9 Hz, 1H), 7.36 (d, J= 7.8 Hz, 1H), 3.73 (s, 2H), 2.43 (s, 3H).

Step 2:

[00231] A solution of 2-(2-methyl-5-(trifluoromethyl)phenyl)acetonitrile (70 mg, 351.4 umol) in H ₂ 0 (1.0 mL) and HC1 (1.0 mL, 36%) H ₂ S0 ₄ (1.0 mL, 98 %) was added NaN0 ₂ (41 mg, 597.4 umol, 32.46 uL). The mixture was stirred at 70°C for 2 h. The reaction mixture was diluted with H ₂ 0 (10 mL) and extracted with DCM (5 mL x 3). The combined organic layers were washed with brine (5 mL ^χ 3), dried over Na ₂ S0 ₄ , filtered and concentrated to afford 2-(2- methyl-5-(trifluoromethyl)phenyl)acetic acid (60 mg, crude).

Step 3:

[00232] To a solution of tert-butyl (6-(3-amino-l-methyl-lH-pyrazol-5-yl)-8- ethylquinazolin-2-yl)((lr,4r)-4-(bis(tert-butoxycarbonyl)ami no)cyclohexyl)carbamate (50 mg, 75.1 umol) in Pyridine (2.0 mL) were added 2-(2-methyl-5-(trifluoromethyl)phenyl)acetic acid (24 mg, 112.6 umol), EDCI (21 mg, 112.6 umol). The mixture was stirred at 45°C for 12 h. The mixture was concentrated to get crude residue and washed with brine (10 mL ^χ 3), dried over Na ₂ S0 ₄ , filtered and concentrated to afford tert-butyl ((lr,4r)-4-(bis(tert- butoxycarbonyl)amino)cyclohexyl)(8-ethyl-6-(l-methyl-3-(2-(2 -methyl-5- (trifluoromethyl)phenyl)acetamido)-lH-pyrazol-5-yl)quinazoli n-2-yl)carbamate (40 mg, crude). Step 4:

[00233] A solution of tert-butyl ((lr,4r)-4-(bis(tert-butoxycarbonyl)amino)cyclohexyl)(8- ethyl-6-(l-methyl-3-(2-(2-methyl-5-(trifluoromethyl)phenyl)a cetamido)-lH-pyrazol-5- yl)quinazolin-2-yl)carbamate (40 mg, 46.1 umol) in DCM (1.0 mL) and TFA (2.0 mL) was stirred at 15 °C for 10 min. The mixture was concentrated to get crude residue. The residue was dissolved in MeOH (2.0 mL) and basified pH to 8 with ¾.Η ₂ 0 (25% solution), concentrated to give a residue. The residue was purified by prep-HPLC (FA condition) to afford N-(5-(2- (((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin-6-yl)-l -methyl- lH-pyrazol-3-yl)-2-(2- methyl-5-(trifluoromethyl)phenyl)acetamide (15.0 mg, 23.9 umol, 51.7% yield, FA). M+H ⁺ = 566.4 (LCMS); 1H MR (METHANOL-^, 400MHz): δ 9.05 (s, 1H), 8.57 (br s, 1H), 7.72 (s, 1H), 7.65 (s, 1H), 7.59 (s, 1H), 7.52 - 7.45 (m, 1H), 7.44 - 7.35 (m, 1H), 6.67 (s, 1H), 4.00 (br t, J = 10.9 Hz, 1H), 3.92 - 3.81 (m, 5H), 3.25 - 3.02 (m, 3H), 2.45 (s, 3H), 2.32 (br d, J= 11.6 Hz, 2H), 2.16 (br d, J= 10.9 Hz, 2H), 1.73 - 1.44 (m, 4H), 1.35 (t, J= 7.4 Hz, 3H).

Example 28: Synthesis of l-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6- yl)-l-methyl-lH-pyrazol-3-yl)-3-(2,5-bis(trifluoromethyl)phe nyl)urea (35)

Step 1:

[00234] To a solution of 2,5-bis(trifluoromethyl)aniline (90 mg, 392.8 umol, 60.8 uL) and

DIEA (76 mg, 589.2 umol, 102.9 uL) in DCM (2.0 mL) was added triphosgene (38 mg, 129.6 umol). The mixture was stirred at 45°C for 3 h. The solution (2-isocyanato-l,4- bis(trifluoromethyl)benzene in DCM 2 mL) was used to next step. Step 2:

[00235] To a solution of 2-isocyanato-l,4-bis(trifluoromethyl)benzene (34 mg, 133.2 umol, DCM 2.0 mL) in DCM(2 mL) was added tert-butyl (6-(3-amino-l-methyl-lH-pyrazol-5- yl)-8-ethylquinazolin-2-yl)((lr,4r)-4-(bis(tert-butoxycarbon yl)amino)cyclohexyl)carbamate (35 mg, 53.31 umol). The mixture was stirred at 25°C for 1 h. The mixture was concentrated to get crude residue. The residue was purified by prep-TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 1/1) to afford tert-butyl ((lr,4r)-4-(bis(tert-butoxycarbonyl)amino)cyclohexyl)(6-(3-( 3-(2,5- bis(trifluoromethyl)phenyl)ureido)-l-methyl-lH-pyrazol-5-yl) -8-ethylquinazolin-2-yl)carbamate (30 mg, crude).

Step 3:

[00236] A solution of tert-butyl ((lr,4r)-4-(bis(tert-butoxycarbonyl)amino)cyclohexyl)(6-

(3-(3-(2,5-bis(trifluoromethyl)phenyl)ureido)-l-methyl-lH -pyrazol-5-yl)-8-ethylquinazolin-2- yl)carbamate (30 mg, 32.5 umol) in TFA (1.0 mL) and DCM (2.0 mL) was stirred at 15°C for 10 min. The mixture was concentrated to get crude residue. The residue was dissolved in MeOH (2.0 mL) and basified pH to 8 with H ₃ .H ₂ 0 (25% solution), concentrated to give a residue. The residue was purified by prep-HPLC (FA condition) to afford l-(5-(2-(((lr,4r)-4- aminocyclohexyl)amino)-8-ethylquinazolin-6-yl)-l -methyl- lH-pyrazol-3-yl)-3 -(2,5- bis(trifluoromethyl)phenyl)urea (11.8 mg, 17.1 umol, 52.6% yield, FA). M+H ⁺ = 621.2 (LCMS); 1H MR (METHANOL-^, 400MHz): δ 9.09 (s, 1H), 8.69 - 8.39 (m, 2H), 7.91 (d, J= 8.2 Hz, 1H), 7.77 (d, J= 2.0 Hz, 1H), 7.68 (d, J= 1.8 Hz, 1H), 7.57 (d, J= 8.1 Hz, 1H), 6.25 (br s, 1H), 4.08 - 3.96 (m, 1H), 3.87 (s, 3H), 3.25 - 3.06 (m, 3H), 2.34 (br d, J= 10.6 Hz, 2H), 2.17 (br d, J = 12.2 Hz, 2H), 1.70 - 1.47 (m, 4H), 1.38 (t, J= 7.5 Hz, 3H).

Example 29: Synthesis 2-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6-yl)- l-methyl-lH-pyrazol-3-yl)-N-(4-(3-(methylamino)propoxy)-3- (trifluoromethyl)phenyl)acetamide (37)

Step 1:

[00237] A mixture of K ₂ C0 ₃ (66 mg, 483.4 umol), methyl 2-(l-methyl-5-

(((trifluoromethyl)sulfonyl)oxy)-lH-pyrazol-3-yl)acetate (80 mg, 161.1 umol), Pd(dppf)Cl ₂ (11 mg, 16.1 umol), and tert-butyl ((lr,4r)-4-((8-ethyl-6-(4,4,5,5-tetramethyl-l,3,2-dioxaborol an-2- yl)quinazolin-2-yl)amino)cyclohexyl)carbamate (48 mg, 161.1 umol) in dioxane (4.0 mL) and H ₂ 0 (400.0 uL) was degassed and purged with N ₂ for 3 times, and then the mixture was stirred at 90°C for 12 h under N ₂ atmosphere. The reaction mixture was concentrated under reduced pressure. The residue was purified by prep-TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 0/1) to give methyl 2-(5-(2-(((lr,4r)-4-((tert-butoxycarbonyl)amino)cyclohexyl)a mino)-8- ethylquinazolin-6-yl)-l-methyl-lH-pyrazol-3-yl)acetate (45 mg, crude).

Step 2:

[00238] To a solution of methyl 2-(5-(2-(((lr,4r)-4-((tert- butoxycarbonyl)amino)cyclohexyl)amino)-8-ethylquinazolin-6-y l)-l -methyl- lH-pyrazol-3- yl)acetate (45 mg, 86.1 umol) in THF (3.0 mL) and H ₂ 0 (1.0 mL) was added LiOH.H ₂ 0 (18 mg, 430.5 umol). The mixture was stirred at 15°C for 12 h. The reaction mixture was quenched by addition water 4.0 mL, and then extracted with ethyl acetate (3.0 mL x 3). The combined organic layers were washed with brine (3.0 mL ^χ 3), dried over Na ₂ S0 ₄ , filtered and

concentrated under reduced pressure to give 2-(5-(2-(((lr,4r)-4-((tert- butoxycarbonyl)amino)cyclohexyl)amino)-8-ethylquinazolin-6-y l)-l -methyl- lH-pyrazol-3- yl)acetic acid (34 mg, crude).

Step 3:

[00239] To a solution of 2-(5-(2-(((lr,4r)-4-((tert- butoxycarbonyl)amino)cyclohexyl)amino)-8-ethylquinazolin-6-y l)-l -methyl- lH-pyrazol-3- yl)acetic acid (34 mg, 66.8 umol) tert-butyl (3-(4-amino-2-

(trifluoromethyl)phenoxy)propyl)(methyl)carbamate (27 mg, 80.2 umol) in pyridine (2.0 mL) was added EDCI (25 mg, 133.7 umol). The mixture was stirred at 45°C for 12 h. The reaction mixture was quenched by addition water 3.0 mL, and then extracted with ethyl acetate (3.0 mL x 3). The combined organic layers were washed with brine (3.0 mL x 3), dried over Na ₂ S0 ₄ , filtered and concentrated under reduced pressure to give tert-butyl (3-(4-(2-(5-(2-(((lr,4r)-4- ((tert-butoxycarbonyl)amino)cyclohexyl)amino)-8-ethylquinazo lin-6-yl)-l-methyl-lH-pyrazol-3- yl)acetamido)-2-(trifluoromethyl)phenoxy)propyl)(methyl)carb amate (35 mg, crude). M+H ⁺ = 839.7 (LCMS).

Step 4:

[00240] To a solution of tert-butyl (3-(4-(2-(5-(2-(((lr,4r)-4-((tert- butoxycarbonyl)amino)cyclohexyl)amino)-8-ethylquinazolin-6-y l)-l -methyl- lH-pyrazol-3- yl)acetamido)-2-(trifluoromethyl)phenoxy)propyl)(methyl)carb amate (35 mg, 41.7 umol) in DCM (2.0 mL) was added TFA (1.0 mL). The mixture was stirred at 25°C for 0.5 h. The reaction mixture was concentrated under reduced pressure. The residue was added

dichloromethane (2.0 mL) and H ₃ .H ₂ 0 (25% solution) to pH 7, concentrated under reduced pressure again. The residue was purified by prep-HPLC (FA condition) to give 2-(5-(2-(((lr,4r)- 4-aminocyclohexyl)amino)-8-ethylquinazolin-6-yl)-l-methyl-lH -pyrazol-3-yl)-N-(4-(3- (methylamino)propoxy)-3-(trifluoromethyl)phenyl)acetamide (6.8 mg, 8.9 umol, 21.5% yield, FA). M+H ⁺ = 639.3 (LCMS); 1H MR (METHANOL-^, 400MHz): δ 9.07 (s, 1H), 8.52 (br s, 2H), 7.95 (d, J = 2.2 Hz, 1H), 7.80 (dd, J = 2.0, 8.9 Hz, 1H), 7.74 (s, 1H), 7.68 (s, 1H), 7.20 (d, J = 9.0 Hz, 1H), 6.43 (s, 1H), 4.23 (t, J = 5.6 Hz, 2H), 4.09 - 3.97 (m, 1H), 3.91 (s, 3H), 3.76 (s, 2H), 3.28 - 3.04 (m, 5H), 2.75 (s, 3H), 2.33 (br d, J = 11.9 Hz, 2H), 2.29 - 2.12 (m, 4H), 1.74 - 1.44 (m, 4H), 1.37 (t, J = 7.5 Hz, 3H).

Example 30: Synthesis N-(5-(2-(((lr,4r)-4-(dimethylamino)cyclohexyl)amino)-8- eth lquinazolin-6-yl)-l-methyl-lH-pyrazol-3-yl)-2-(3-(trifluorom ethyl)phenyl)acetamide

Step 1:

[00241] To a solution of paraformaldehyde (1.2 g, 14.0 mmol) and tert-butyl N-(4- aminocyclohexyl)carbamate (1.0 g, 4.6 mmol) in MeOH (10.0 mL) was added CH ₃ COOH (50.0 uL) and NaBH ₃ CN (1.1 g, 18.0 mmol). The mixture was stirred at 45°C for 24 h. The reaction mixture was concentrated under reduced pressure. The reaction mixture was extracted with dichloromethane (10.0 mL x 3). The combined organic layers were washed with brine (10.0 mL x 3), dried over Na ₂ S0 ₄ , filtered and concentrated under reduced pressure to afford tert-butyl ((lr,4r)-4-(dimethylamino)cyclohexyl)carbamate (1.0 g, crude). 1H MR (400MHz,

CHLOROF ORM-<f) δ 4.36 (br d, J= 1.8 Hz, 1H), 3.37 (br d, J= 4.8 Hz, 1H), 2.27 (s, 6H), 2.21 - 2.09 (m, 1H), 2.05 (br d, J= 12.3 Hz, 2H), 1.90 (br d, J= 12.3 Hz, 2H), 1.43 (s, 9H), 1.37 - 1.23 (m, 2H), 1.18 - 1.02 (m, 2H).

Step 2:

[00242] To a solution of tert-butyl ((lr,4r)-4-(dimethylamino)cyclohexyl)carbamate (1.0 g,

4.1 mmol) in DCM (20.0 mL) was added TFA (5.0 mL). The mixture was stirred at 25°C for 0.5 h. The reaction mixture was concentrated under reduced pressure to afford (lr,4r)-Nl,Nl- dimethylcyclohexane-l,4-diamine (1.0 g, crude, TFA).

Step 3:

[00243] To a solution of 6-bromo-8-ethyl-2-iodoquinazoline (0.5 g, 1.4 mmol,) in n-butyl alcohol (20.0 mL) was added DIEA (534 mg, 4.1 mmol, 721.7 uL) and (lr,4r)-Nl,Nl- dimethylcyclohexane-l,4-diamine (705 mg, 2.7 mmol, TFA) with DIEA to pH 7. The mixture was stirred at 100°C for 24 h. The reaction mixture was concentrated under reduced pressure. The residue was purified by column chromatography (Si0 ₂ , Petroleum ether / Ethyl acetate (1/1) to DCM / MeOH (10/1)) to afford (lr,4r)-Nl-(6-bromo-8-ethylquinazolin-2-yl)-N4,N4- dimethylcyclohexane-l,4-diamine (500 mg, crude).

Step 4:

[00244] A mixture of (lr,4r)-Nl -(6-bromo-8-ethylquinazolin-2-yl)-N4,N4- dimethylcyclohexane-l,4-diamine (500 mg, 1.3 mmol), 4,4,5,5-tetramethyl-2-(4,4,5,5- tetramethyl-l,3,2-dioxaborolan-2-yl)-l,3,2-dioxaborolane (370 mg, 1.5 mmol), Pd(dppf)Cl ₂ (96 mg, 132.5 umol), KOAc (390 mg, 3.9 mmol) in dioxane (20.0 mL) was degassed and purged with N ₂ for 3 times, and then the mixture was stirred at 90°C for 12 h under N ₂ atmosphere. The reaction mixture was concentrated under reduced pressure. The residue was purified by column chromatography (Si0 ₂ , DCM: MeOH = 1/0 to 20/1) to afford (lr,4r)-Nl-(8-ethyl-6-(4,4,5,5- tetramethyl-l,3,2-dioxaborolan-2-yl)quinazolin-2-yl)-N4,N4-d imethylcyclohexane-l,4-diamine (220 mg, crude).

Step 5:

[00245] A mixture of (lr,4r)-Nl-(8-ethyl-6-(4,4,5,5-tetramethyl-l,3,2-dioxaborola n-2- yl)quinazolin-2-yl)-N4,N4-dimethylcyclohexane-l,4-diamine (50 mg, 117.8 umol), N-(5-bromo- l-methyl-lH-pyrazol-3-yl)-2-(3-(trifluoromethyl)phenyl)aceta mide (42 mg, 117.8 umol), K ₂ C0 ₃ (48 mg, 353.4 umol), Pd(dppf)Cl ₂ (8 mg, 11.7 umol) in H ₂ 0 (0.2 mL) and dioxane (2.0 mL) was degassed and purged with N ₂ for 3 times, and then the mixture was stirred at 90°C for 12 h under N ₂ atmosphere. The reaction mixture was concentrated under reduced pressure, then added MeOH (2.0 ml) and 3-mercaptopropyltrimethoxysilane modified silica gel (50 mg), stirred for 12 h. The mixture filtered and concentrated under reduced pressure to give a residue. The residue was purified by prep-HPLC (FA condition) to give N-(5-(2-(((lr,4r)-4- (dimethylamino)cyclohexyl)amino)-8-ethylquinazolin-6-yl)-l -methyl- lH-pyrazol-3 -yl)-2-(3- (trifluoromethyl)phenyl)acetamide (3.1 mg, 4.6 umol, 3.9% yield, FA). M+H ⁺ = 580.3 (LCMS); 1HNMR (400MHz, METHANOL-^) δ 9.04 (s, 1H), 8.54 (br s, 1H), 7.70 (br d, J= 6.6 Hz, 2H), 7.64 (br s, 2H), 7.55 (quin, J= 7.5 Hz, 2H), 6.65 (s, 1H), 3.98 (br s, 1H), 3.87 - 3.76 (m, 5H), 3.18 (br s, 1H), 3.08 (q, J= 7.3 Hz, 2H), 2.83 (s, 6H), 2.38 (br d, J= 9.6 Hz, 2H), 2.17 (br d, J = 10.5 Hz, 2H), 1.80 - 1.63 (m, 2H), 1.49 (q, J= 11.8 Hz, 2H), 1.33 (br t, J= 7.5 Hz, 3H).

Example 31: Synthesis N-(5-(8-ethyl-2-(((lr,4r)-4-((2- methoxyethyl)amino)cyclohexyl)amino)quinazolin-6-yl)-l-methy l-lH-pyrazol-3-yl)-2-(3- (trifluoromethyl)phenyl)acetamide (40)

step 1 step 2 step 3

step 4 step 5

Step 1:

[00246] To a solution of isoindoline-l,3-dione (10.0 g, 67.9 mmol) and TEA (8.9 g, 88.3 mmol, 12.2 mL,) in DMF (60.0 mL) was added ethyl carbonochloridate (8.8 g, 81.5 mmol, 7.7 mL). The mixture was stirred at 15°C for 12 h. The mixture was added H ₂ 0 (200.0 mL) and filtered and the cake was dried under reduced pressure to give ethyl l,3-dioxoisoindoline-2- carboxylate (9.0 g, 41.0 mmol, 60.4% yield). ¹ HNMR (400MHz, CHLOROF ORM-<f) δ 1.97 (dd, J = 3.1, 5.1 Hz, 2H), 7.83 (dd, J = 3.1, 5.1 Hz, 2H), 4.49 (q, J= 7.1 Hz, 2H), 1.45 (t, J= 7.1 Hz, 3H).

Step 2:

[00247] To a solution of tert-butyl ((lr,4r)-4-aminocyclohexyl)carbamate (500 mg, 2.3 mmol) and Na ₂ C0 ₃ (271 mg, 2.5 mmol) in H ₂ 0 (10.0 mL) was added ethyl 1,3-dioxoisoindoline- 2-carboxylate (561 mg, 2.5 mmol). The mixture was stirred at 15°C for 12 h. The mixture was added H ₂ 0 (20.0 mL) and extracted with EtOAc (10.0 mL ^χ 3). The combined organic layers were washed with brine (10.0 mL ^χ 3), dried over Na2S04, filtered and concentrated under reduced pressure to give a residue afford tert-butyl ((lr,4r)-4-(l,3-dioxoisoindolin-2- yl)cyclohexyl)carbamate (600 mg, crude). 1H MR (400MHz, CHLOROF ORM-i ) δ 7.81 (br d, J= 3.4 Hz, 2H), 7.71 (br d, J= 2.9 Hz, 2H), 4.39 (br s, 1H), 4.12 (br t, J= 12.2 Hz, 1H), 3.57 (br s, 1H), 2.50 - 2.29 (m, 2H), 2.15 (br d, J= 11.7 Hz, 2H), 1.77 (br d, J= 12.2 Hz, 2H), 1.51 - 1.41 (m, 9H), 1.32 - 1.17 (m, 2H).

Step 3:

[00248] To a solution of tert-butyl ((lr,4r)-4-(l,3-dioxoisoindolin-2- yl)cyclohexyl)carbamate (500 mg, 1.4 mmol) in DCM (2.0 mL) was added TFA (1.0 mL). The mixture was stirred at 25 °C for 0.5 h. The reaction mixture was concentrated under reduced pressure to afford 2-((lr,4r)-4-aminocyclohexyl)isoindoline-l,3-dione (500 mg, crude, TFA). Step 4:

[00249] A solution of 1,1,2-trimethoxyethane (838 mg, 6.9 mmol, 901.3 uL) in water (22.0 mL) and HCl (0.3 mL, 2M) was stirred at 60°C for 2h, then extracted with dichloromethane (10.0 mL x 3). The combined organic layers were washed with brine (30.0 mL x 3), dried over Na ₂ S0 ₄ , filtered to give a filtrate. To the filtrate was added the solution of 2-((lr,4r)-4- aminocyclohexyl)isoindoline-l,3-dione (500 mg, 1.4 mmol, TFA) with TEA to pH 7 in MeOH (30.0 mL) and CH ₃ COOH (125 mg, 2.0 mmol, 119.7 uL). And then NaBH ₃ CN (175 mg, 2.7 mmol) was added to above reaction mixture and CH ₃ COOH was added to adjusted pH to 5. The mixture was stirred at 60°C for 12 h. The reaction mixture was extracted with dichloromethane (30.0 mL x 3). The combined organic layers were washed with brine (30 mL x 3), dried over Na ₂ S0 ₄ , filtered and concentrated under reduced pressure to give 2-((lr,4r)-4-((2- methoxyethyl)amino)cyclohexyl)isoindoline-l,3-dione (410 mg, crude).

Step 5:

[00250] To a solution of 2-((lr,4r)-4-((2-methoxyethyl)amino)cyclohexyl)isoindoline-l ,3- dione (410 mg, 1.3 mmol) in DCM (20.0 mL) was added TEA (411 mg, 4.0 mmol, 566.2 uL) and tert-butoxycarbonyl tert-butyl carbonate (887 mg, 4.0 mmol, 934.5 uL). The mixture was stirred at 25°C for 12 h. The reaction mixture was concentrated under reduced pressure. The residue was purified by prep-TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 3/1) to afford : tert-butyl ((lr,4r)-4-(l,3-dioxoisoindolin-2-yl)cyclohexyl)(2-methoxyet hyl)carbamate (130 mg, crude). M+H ⁺ -56 = 347.0 (LCMS).

Step 6:

[00251] To a solution of : tert-butyl ((lr,4r)-4-(l,3-dioxoisoindolin-2-yl)cyclohexyl)(2- methoxyethyl)carbamate (130 mg, 323.0 umol) in EtOH (4.0 mL) was added H ₂ H ₂ .H ₂ 0 (164 mg, 3.2 mmol, 160.1 uL). The mixture was stirred at 80°C for 12 h. The reaction mixture was quenched by addition H ₂ 0 (3.0 mL), and then extracted with ethyl acetate (3.0 mL x 3). The combined organic layers were washed with brine (3.0 mL ^χ 3), dried over Na ₂ S0 ₄ , filtered and concentrated under reduced pressure to afford tert-butyl ((lr,4r)-4-aminocyclohexyl)(2- methoxyethyl)carbamate (45 mg, crude).

Step 7:

[00252] To a solution of tert-butyl ((lr,4r)-4-aminocyclohexyl)(2-methoxyethyl)carbamate

(45 mg, 165.2 umol) in n-butyl alcohol (2.0 mL) was added DIEA (64 mg, 495.6 umol, 86.3 uL) and 6-bromo-8-ethyl-2-iodoquinazoline (59 mg, 165.2 umol). The mixture was stirred at 100°C for 24 h. The reaction mixture was concentrated under reduced pressure. The residue was purified by column chromatography (Si0 ₂ , Petroleum ether / Ethyl acetate = 1/0 to 10/1) to afford tert-butyl ((lr,4r)-4-((6-bromo-8-ethylquinazolin-2-yl)amino)cyclohexyl )(2- methoxyethyl)carbamate (40 mg, crude). M+H ⁺ = 509.0 (LCMS).

Step 8 :

[00253] To a solution of tert-butyl ((lr,4r)-4-((6-bromo-8-ethylquinazolin-2- yl)amino)cyclohexyl)(2-methoxyethyl)carbamate (40 mg, 78.8 umol) in dioxane (2.0 mL) were added 4,4,4',4',5,5,5',5'-octamethyl-2,2'-bi(l,3,2-dioxaborolane) (24 mg, 94.5 umol) Pd(dppf)Cl ₂ (6 mg, 7.8 umol) and KOAc (23 mg, 236.4 umol). The mixture was stirred at 90°C for 12 h under N ₂ . The reaction mixture was concentrated under reduced pressure. The residue was purified by prep-TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 1/1) to afford tert-butyl ((lr,4r)-4- ((8-ethyl-6-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2-yl)qui nazolin-2-yl)amino)cyclohexyl)(2- methoxyethyl)carbamate (40 mg, crude). Step 9 :

[00254] A mixture of N-(5-bromo-l-methyl-lH-pyrazol-3-yl)-2-(3-

(trifluoromethyl)phenyl)acetamide (25 mg, 69.0 umol), tert-butyl ((lr,4r)-4-((8-ethyl-6-(4,4,5,5- tetramethyl-l,3,2-dioxaborolan-2-yl)quinazolin-2-yl)amino)cy clohexyl)(2- methoxyethyl)carbamate (38 mg, 69.0 umol), K ₂ C0 ₃ (28 mg, 207.1 umol), Pd(dppf)Cl ₂ (5 mg, 6.9 umol) in dioxane (2.0 mL) and H ₂ 0 (0.2 mL) was degassed and purged with N ₂ for 3 times, and then the mixture was stirred at 90°C for 12 h under N ₂ atmosphere. The reaction mixture was concentrated under reduced pressure. The residue was purified by prep-TLC (Si0 ₂ ,

Petroleum ether / Ethyl acetate = 1/1) to afford tert-butyl ((lr,4r)-4-((8-ethyl-6-(l-methyl-3-(2- (3-(trifluoromethyl)phenyl)acetamido)-lH-pyrazol-5-yl)quinaz olin-2-yl)amino)cyclohexyl)(2- methoxyethyl)carbamate (25 mg, crude).

Step 10:

[00255] To a solution of tert-butyl ((lr,4r)-4-((8-ethyl-6-(l-methyl-3-(2-(3-

(trifluoromethyl)phenyl)acetamido)-lH-pyrazol-5-yl)quinaz olin-2-yl)amino)cyclohexyl)(2- methoxyethyl)carbamate (25 mg, 35.2 umol) in DCM (2.0 mL) was added TFA (1.0 mL). The mixture was stirred at 25°C for 0.5 h. The reaction mixture was concentrated under reduced pressure. The residue was added dichloromethane (2.0 mL) and H ₃ .H ₂ 0 (25% solution) to pH 7, concentrated under reduced pressure again. The residue was purified by prep-HPLC (FA condition) to give N-(5-(8-ethyl-2-(((lr,4r)-4-((2- methoxyethyl)amino)cyclohexyl)amino)quinazolin-6-yl)-l -methyl- lH-pyrazol-3 -yl)-2-(3- (trifluoromethyl)phenyl)acetamide (7.1 mg, 10.3 umol, 29.4% yield, FA). M+H ⁺ = 610.3

(LCMS); 1H MR (400MHz, METHANOL-^) δ 9.03 (s, 1H), 8.47 (br s, 1H), 7.69 (s, 2H), 7.62 (s, 2H), 7.60 - 7.49 (m, 2H), 6.65 (s, 1H), 3.97 (br t, J= 11.4 Hz, 1H), 3.84 - 3.78 (m, 5H), 3.65 (br d, J= 4.8 Hz, 2H), 3.42 (s, 3H), 3.28 - 3.23 (m, 2H), 3.17 (br t, J= 11.8 Hz, 1H), 3.07 (q, J = 7.5 Hz, 2H), 2.33 (br d, J= 10.1 Hz, 2H), 2.24 (br d, J= 11.8 Hz, 2H), 1.68 - 1.54 (m, 2H), 1.53 - 1.39 (m, 2H), 1.32 (t, J= 7.5 Hz, 3H).

Example 32: Synthesis of N-(5-(2-(((lr,4r)-4-acetamidocyclohexyl)

ethylquinazolin-6-yl)-l-methyl-lH-pyrazol-3-yl)-2-(2,5- bis trifluoromethyl)phenyl)acetamide (41)

Step 1:

[00256] To a solution of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6- yl)-l-methyl-lH-pyrazol-3-yl)-2-(2,5-bis(trifluoromethyl)phe nyl)acetamide (60 mg, 96.84 umol, TFA salt) in DCM (2 mL) was added TEA (29.4 mg, 290.5 umol) and acetyl chloride (9.1 mg, 116.2 umol) at 0°C. The mixture was stirred at 0°C for 15 min. The reaction mixture was concentrated to give a residue. The residue was purified by prep-HPLC (FA condition) to afford N-(5-(2-(((lr,4r)-4-acetamidocyclohexyl)amino)-8-ethylquinaz olin-6-yl)-l-methyl-lH-pyrazol- 3-yl)-2-(2,5-bis(trifluoromethyl)phenyl)acetamide (7.6 mg, 10.3 umol, 10.7% yield). M+H ⁺ = 662.2 (LCMS); 1H MR (METHANOL-^4, 400 MHz): δ ppm 9.02 (s, 1 H) 7.93 (d, 1 H) 7.87 (s, 1 H) 7.80 (br d, 1 H) 7.69 (d, 1 H) 7.61 (d, 1 H) 6.61 (s, 1 H) 4.09 (s, 2 H) 3.90 - 3.98 (m, 1 H) 3.83 (s, 3 H) 3.70 (br s, 1 H) 3.07 (q, 2 H) 2.21 (br d, 2 H) 1.99 (br d, 2 H) 1.93 (s, 3 H) 1.38 - 1.49 (m, 4 H) 1.33 (t, 3 H).

Example 33: Synthesis of 2-(2,5-bis(trifluoromethyl)phenyl)-N-(5-(8-ethyl-2-(((lr,4r) -4-(2- methoxyacetamido)cyclohexyl)amino)quinazolin-6-yl)-l-methyl- lH-pyrazol-3-yl)acetamide 42)

[00257] To a solution of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6- yl)-l-methyl-lH-pyrazol-3-yl)-2-(2,5-bis(trifluoromethyl)phe nyl)acetamide (60 mg, 44.9 umol) in DCM (3 mL) was added TEA (13 mg, 134.9 umol, 18.7 uL), 2-methoxyacetyl chloride (5 mg, 53.9 umol, 4.9 uL). The mixture was stirred at 15°C for 5 min. The reaction mixture was concentrated under reduced pressure. The residue was purified by prep-HPLC (FA condition) to afford 2-(2,5-bis(trifluoromethyl)phenyl)-N-(5-(8-ethyl-2-(((lr,4r) -4-(2- methoxyacetamido)cyclohexyl)amino)quinazolin-6-yl)-l-methyl- lH-pyrazol-3-yl)acetamide (13.2 mg, 18.7 umol, 41.6% yield). M+H ⁺ = 692.3 (LCMS); 1H MR (METHANOL-^, 400MHz): δ 9.02 (s, 1 H), 7.86 - 7.96 (m, 2 H), 7.81 (br d, J = 8.16 Hz, 1 H), 7.70 (d, J = 1.98 Hz, 1 H), 7.62 (s, 1 H), 6.62 (s, 1 H), 4.09 (s, 2 H), 3.93 - 4.01 (m, 1 H), 3.88 (s, 2 H), 3.78 - 3.85 (m, 4 H), 3.42 (s, 3 H), 3.08 (q, J = 7.42 Hz, 2 H), 2.23 (br d, J = 9.48 Hz, 2 H), 1.92 - 2.03 (m, 2 H), 1.43 - 1.58 (m, 4 H), 1.34 (t, J = 7.50 Hz, 3 H). Example 34: Synthesis of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6- yl)-l-methyl-lH-pyrazol-3-yl)-2-(2-methoxy-5-(trifluoromethy l)phenyl)acetamide (43)

Step 1:

[00258] To a stirred suspension of 2-methoxy-5-(trifluoromethyl)benzoic acid (1 g, 4.5 mmol) in DCM (20 mL) was added (COCl) ₂ (691 mg, 5.4 mmol, 477 uL) and catalytic amount of DMF (33 mg, 454.2 umol, 34 uL) at 15°C under N ₂ atmosphere. The mixture was stirred at 15°C for 3 h under N ₂ atmosphere. The reaction mixture was concentrated under reduced pressure. The resulting residue was dissolved in THF (20 mL) and then TEA (735 mg, 7.2 mmol, 1 mL) and TMSCHN ₂ (2 M, 3 mL in n-hexane) were added at 0°C. The reaction mixture was stirred at 30°C for 12 h. The mixture was poured into NaHC0 ₃ (50 mL) and extracted with ethyl acetate (30 mL x 3). The combined organic layers were washed with brine (20 mL x 3), dried over Na ₂ S0 ₄ , filtered and concentrated under reduced pressure to give a residue. The residue was purified by column chromatography (Si0 ₂ , Petroleum ether / Ethyl acetate = 1/0 to 5/1) to afford 2-diazo-l-(2-methoxy-5-(trifluoromethyl)phenyl)ethanone (0.5 g, 1.6 mmol, 36.0% yield). 1H MR (CHLOROFORM-d, 400MHz): δ 8.23 (br s, 1H), 7.71 (br d, J = 8.7 Hz, 1H), 7.05 (d, J = 8.7 Hz, 1H), 6.32 (br s, 1H), 3.98 (s, 3H).

Step 2:

[00259] To a refluxed solution of TEA (621 mg, 6.1 mmol, 855 uL) and benzoic acid silver (141 mg, 614.3 umol) in MeOH (8 mL) and toluene (8 mL) was added dropwise a solution of 2-diazo-l-(2-methoxy-5-(trifluoromethyl)phenyl)ethanone (0.5 g, 2.0 mmol) in MeOH (16 mL) with stirring. The mixture was stirred at 70°C for 1 h. The mixture was filtered and concentrated under reduced pressure to give a residue. The residue was purified by column chromatography (Si0 ₂ , Petroleum ether / Ethyl acetate = 1/0 to 20/1) to afford methyl 2-(2- methoxy-5-(trifluoromethyl)phenyl)acetate (370 mg, 1.2 mmol, 61.8% yield,). 1H NMR

(CHLOROFORM-^, 400MHz): δ 7.54 (br d, J = 8.6 Hz, 1H), 7.45 (s, 1H), 6.94 (d, J = 8.6 Hz, 1H), 3.88 (s, 3H), 3.71 (s, 3H), 3.67 (s, 2H).

Step 3:

[00260] To a solution of methyl 2-(2-methoxy-5-(trifluoromethyl)phenyl)acetate (360 mg,

1.4 mmol) in THF (3 mL), H ₂ 0 (1 mL) was added LiOH.H ₂ 0 (304 mg, 7.2 mmol). The mixture was stirred at 15°C for 12 h. The pH was adjusted to 3 by progressively adding IN HCl, and extracted with Ethyl acetate (10 mL x 3). The combined organic layers were washed with brine 20 mL, dried over Na ₂ S0 ₄ , filtered and concentrated under reduced pressure to afford 2-(2- methoxy-5-(trifluoromethyl)phenyl)acetic acid (200 mg, 59% yield). M-H ⁺ = 233.0 (LCMS). Step 4:

[00261] To a solution of 2-(2-methoxy-5-(trifluoromethyl)phenyl)acetic acid (21 mg, 90.1 umol), tert-butyl (6-(3-amino-l-methyl-lH-pyrazol-5-yl)-8-ethylquinazolin-2-yl )((lr,4r)-4- (bis(tert-butoxycarbonyl)amino)cyclohexyl)carbamate (60 mg, 90.1 umol) in pyridine (3 mL) was added EDCI (51 mg, 270.3 umol). The mixture was stirred at 45°C for 12 h. The reaction mixture was concentrated under reduced pressure. The residue was diluted with water (3 mL) and extracted with DCM (5 mL), The combined organic layers were washed with brine (10 mL), dried over Na ₂ S0 ₄ , filtered and concentrated under reduced pressure to afford : tert-butyl ((lr,4r)-4-(bis(tert-butoxycarbonyl)amino)cyclohexyl)(8-ethy l-6-(3-(2-(2-methoxy-5- (trifluoromethyl)phenyl)acetamido)-l-methyl-lH-pyrazol-5-yl) quinazolin-2-yl)carbamate (50 mg, crude).

Step 5:

[00262] To a solution of : tert-butyl ((lr,4r)-4-(bis(tert- butoxycarbonyl)amino)cyclohexyl)(8-ethyl-6-(3-(2-(2-methoxy- 5-

(trifluoromethyl)phenyl)acetamido)-l-methyl-lH-pyrazol-5- yl)quinazolin-2-yl)carbamate (50 mg, 56.6 umol) in DCM (2 mL) was added TFA (1 mL). The mixture was stirred at 20°C for 30 min. The reaction mixture was concentrated under reduced pressure, the residue was dissolved in MeOH (2.0 mL) and basified pH to 8 with NH ₃ .H ₂ 0 (25% solution). The residue was purified by prep-HPLC (FA condition) to afford N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8- ethylquinazolin-6-yl)-l -methyl- lH-pyrazol-3-yl)-2-(2-methoxy-5-

(trifluoromethyl)phenyl)acetamide (13.5 mg, 20.7 umol, 36.5% yield, FA). M+H ⁺ = 582.2 (LCMS); 1H NMR (METHANOL-^, 400MHz): δ 9.06 (s, 1 H), 8.42 (br s, 1 H), 7.73 (d, J = 1.96 Hz, 1 H), 7.65 (s, 1 H), 7.55 - 7.62 (m, 2 H), 7.14 (d, J = 8.80 Hz, 1 H), 6.65 (s, 1 H), 3.96 - 4.03 (m, 1 H), 3.93 (s, 3 H), 3.83 (s, 3 H), 3.78 (s, 2 H), 3.04 - 3.22 (m, 3 H), 2.32 (br d, J = 13.20 Hz, 2 H), 2.15 (br d, J = 11.25 Hz, 2 H), 1.44 - 1.67 (m, 4 H), 1.34 (t, J = 7.34 Hz, 3 H). Example 35: Synthesis of 2-amino-N-((lr,4r)-4-((6-(3-(2-(2,5- bis(trifluoromethyl)phenyl)acetamido)-l-methyl-lH-pyrazol-5- yl)-8-ethylquinazolin-2- yl)amino)cyclohexyl)acetamide (44)

Step 1:

[00263] To a solution of tert-butyl (6-(3-amino-l-methyl-lH-pyrazol-5-yl)-8- ethylquinazolin-2-yl)((lr,4r)-4-(bis(tert-butoxycarbonyl)ami no)cyclohexyl)carbamate (150 mg, 225.2 umol) in Pyridine (4.0 mL) were added 2-[2,5-bis(trifluoromethyl)phenyl]acetic acid (61 mg, 225.2 umol) and EDCI (64 mg, 337.9 umol). The mixture was stirred at 45°C for 12 h. The mixture was concentrated to get crude residue. The residue was purified by prep-TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 0/1) to afford tert-butyl ((lr,4r)-4-(bis(tert- butoxycarbonyl)amino)cyclohexyl)(6-(3-(2-(2,5-bis(trifluorom ethyl)phenyl)acetamido)-l- methyl-lH-pyrazol-5-yl)-8-ethylquinazolin-2-yl)carbamate (150 mg, 138.5 umol, crude). M+H ⁺ = 920.1 (LCMS).

Step 2:

[00264] A solution of tert-butyl ((lr,4r)-4-(bis(tert-butoxycarbonyl)amino)cyclohexyl)(6-

(3-(2-(2,5-bis(trifluoromethyl)phenyl)acetamido)-l-methyl -lH-pyrazol-5-yl)-8-ethylquinazolin- 2-yl)carbamate (150 mg, 163.05 umol) in DCM (6.0 mL) and TFA (3.0 mL) was stirred at 15°C for 10 min. The mixture was concentrated to afford N-(5-(2-(((lr,4r)-4- aminocyclohexyl)amino)-8-ethylquinazolin-6-yl)-l -methyl- lH-pyrazol-3-yl)-2-(2, 5- bis(trifluoromethyl)phenyl)acetamide (210 mg, crude, TFA).

Step 3:

[00265] To a solution of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-8-ethylquinazolin -6- yl)-l-methyl-lH-pyrazol-3-yl)-2-(2,5-bis(trifluoromethyl)phe nyl)acetamide (80 mg, 59.9 umol, TFA) in DMF (2.0 mL) were added TEA (18 mg, 179.9 umol, 25.0 uL) and HATU (34 mg, 89.9 umol) and 2-(tert-butoxycarbonylamino)acetic acid (10 mg, 59.9 umol). The mixture was stirred at 28°C for 12 h. The mixture was concentrated to get crude residue. The residue was purified by prep-TLC (Si0 ₂ , Dichloromethane / Methanol = 10/1) to afford tert-butyl (2-(((lr,4r)-4-((6- (3-(2-(2,5-bis(trifluoromethyl)phenyl)acetamido)-l-methyl-lH -pyrazol-5-yl)-8-ethylquinazolin- 2-yl)amino)cyclohexyl)amino)-2-oxoethyl)carbamate (40 mg, crude).

Step 4:

[00266] A solution of tert-butyl (2-(((lr,4r)-4-((6-(3-(2-(2,5- bis(trifluoromethyl)phenyl)acetamido)-l -methyl- lH-pyrazol-5-yl)-8-ethylquinazolin-2- yl)amino)cyclohexyl)amino)-2-oxoethyl)carbamate (40 mg, 51.5 umol) in DCM (2.0 mL) and TFA (1.0 mL) was stirred at 15°C for 10 min. The mixture was concentrated to get crude residue. The residue was dissolved in MeOH (2.0 mL) and basified pH to 8 with H ₃ .H ₂ 0 (25% solution), concentrated to give a residue. The residue was purified by prep-HPLC (FA condition) 2-amino-N-((lr,4r)-4-((6-(3-(2-(2,5-bis(trifluoromethyl)phen yl)acetamido)-l-methyl-lH- pyrazol-5-yl)-8-ethylquinazolin-2-yl)amino)cyclohexyl)acetam ide (4.6 mg, 6.2 umol, 12.0% yield, FA). M+H ⁺ = 677.3 (LCMS); 1H MR (METHANOL-^, 400MHz): δ 9.05 (s, 1H), 8.57 (br s, 1H), 7.95 (br d, J= 8.4 Hz, 1H), 7.90 (s, 1H), 7.82 (br d, J= 8.2 Hz, 1H), 7.72 (s, 1H), 7.65 (s, 1H), 6.64 (s, 1H), 4.11 (s, 2H), 3.98 (br s, 1H), 3.85 (s, 4H), 3.53 (br s, 2H), 3.10 (q, J= 7.5 Hz, 2H), 2.24 (br s, 2H), 2.07 (br s, 2H), 1.59 - 1.41 (m, 4H), 1.36 (br t, J= 7.4 Hz, 3H).

Example 36: Synthesis of N-(5-(2-(((lr,4r)-4-aminocyclohexyl)amino)-5-methylquinazoli n- -yl)-l-methyl-lH-pyrazol-3-yl)-2-(2,5-bis(trifluoromethyl)ph enyl)acetamide (45)

Step 1:

[00267] To a 0°C solution of 2-fluoro-6-methylbenzoic acid (5.0 g, 32.4 mmol) in H ₂ S0 ₄

(135.0 mL, 98%) was added BS (6.0 g, 34.0 mmol). The mixture was stirred at 0°C for 2 h. The reaction mixture was poured into ice water (200.0 mL), and extracted with ether (200 mL x 2). The organic layers were combined, dried over sodium sulfate, and concentrated under vacuum to afford 3-bromo-6-fluoro-2-methylbenzoic acid (6.0 g, 20.8 mmol, 64.1% yield). 1H NMR (CHLOROFORM-d, 400 MHz): δ 7.64 (dd, J= 8.82, 5.29 Hz, 1 H), 6.93 (t, J= 8.82 Hz, 1 H), 2.54 (s, 3 H).

Step 2:

[00268] BH3.THF (1 M, 128 mL) was added dropwise into a solution of 3-bromo-6-fluoro-

2-methylbenzoic acid (6.0 g, 25.7 mmol) in THF (50.0 mL) at 0°C under N ₂ . The resulting solution was stirred at 20°C for 12 h. The reaction mixture was quenched by water (10.0 mL) and extracted with ethyl acetate (20.0 mL ^χ 3), the combined organic layers were washed with brine (20.0 mL), dried over Na ₂ S0 ₄ , filtered and concentrated under reduced pressure to afford (3-bromo-6-fluoro-2-methylphenyl)methanol (5.0 g, crude).

Step 3:

[00269] To a solution of (3-bromo-6-fluoro-2-methylphenyl)methanol (4.0 g, 18.2 mmol) in DCE (50.0 mL) was added Mn0 ₂ (39.6 g, 456.5 mmol). The mixture was stirred at 80°C for 12 h. The reaction mixture was filtered and concentrated under reduced pressure. The residue was purified by column chromatography (Si0 ₂ , Petroleum ether / Ethyl acetate = 1/0 to 100/1) to afford 3-bromo-6-fluoro-2-methylbenzaldehyde (3.0 g, 12.4 mmol, 68.1% yield). ¹ H MR (CHLOROFORM-d, 400 MHz): δ 10.47 (s, 1 H), 7.75 (dd, J= 8.82, 5.51 Hz, 1 H), 6.95 (t, J = 9.48 Hz, 1 H), 2.71 (s, 3 H).

Step 4:

[00270] To a solution of guanidine (2.4 g, 13.8 mmol), DIEA (3.1 g, 24.3 mmol, 4.0 mL) in DMA (90.0 mL), then 3-bromo-6-fluoro-2-methylbenzaldehyde (3.0 g, 13.8 mmol) in DMA (60.0 mL) was added dropwise at 90°C. After addition, the mixture was stirred at 90°C for 2 h. Then the mixture was stirred at 160°C for 2 h. The reaction mixture was diluted with water (100.0 mL) and extracted with DCM (100.0 mL x 3). The combined organic layers were washed with brine (200.0 mL), dried over Na ₂ S0 ₄ , filtered and concentrated under reduced pressure. The residue were washed with DCM (50.0 mL ^χ 2), filtered and the residue was concentrated under reduced pressure to afford 6-bromo-5-methylquinazolin-2-amine (1.3 g, 4.3 mmol, 31.6% yield). 1H NMR (DMSO-i¾, 400 MHz,): δ 9.33 (s, 1 H), 7.78 (d, J= 9.04 Hz, 1 H), 7.20 (d, J= 9.04 Hz, 1 H), 6.94 (s, 2 H), 2.67 (s, 3 H).

Step 5: [00271] A mixture of 6-bromo-5-methylquinazolin-2-amine (1.3 g, 5.4 mmol), Cul (1.0 g,

5.4 mmol), isopentyl nitrite (1.9 g, 16.3 mmol, 2.2 mL), diiodomethane (7.3 g, 27.3 mmol, 2.2 mL) in THF (10.0 mL) was degassed and purged with N ₂ for 3 times, and then the mixture was stirred at 80°C for 1 h under N ₂ atmosphere. The residue was diluted with water (500.0 mL) and extracted with ethyl acetate (500.0 mL ^χ 3). The combined organic layers were washed with brine (300.0 mL ^χ 2), dried over Na ₂ S0 ₄ , filtered and concentrated under reduced pressure to give a residue. The residue was purified by column chromatography (Si0 ₂ , Petroleum ether / Ethyl acetate = 1/0 to 10/1) to afford 6-bromo-2-iodo-5-methylquinazoline (1.2 g, 1.9 mmol, 35.9% yield). 1H MR (DMSO-i¾, 400 MHz): δ 9.55 (s, 1 H), 8.17 (d, J= 9.29 Hz, 1 H), 7.72 (d, J= 8.80 Hz, 1 H), 2.79 (s, 3 H).

Step 6:

[00272] To a solution of 6-bromo-2-iodo-5-methylquinazoline (500 mg, 1.4 mmol), tert- butyl ((lr,4r)-4-aminocyclohexyl) carbamate (306 mg, 1.4 mmol) in n-BuOH (10.0 mL) was added DIEA (554 mg, 4.2 mmol, 747.2 uL). The mixture was stirred at 100°C for 12 h. The reaction mixture was concentrated under reduced pressure. The residue was purified by column chromatography (Si0 ₂ , Petroleum ether / Ethyl acetate = 100/1 to 0/1) to afford tert-butyl((lr,4r)- 4-((6-bromo-5-methylquinazolin-2yl)amino)cyclohexyl)carbamat e (340 mg, 624.7 umol, 43.6% yield). 1H MR (CHLOROFORM-d, 400 MHz): δ 9.19 (s, 1 H), 7.75 (d, J= 9.04 Hz, 1 H), 7.30 (br d, J= 9.04 Hz, 1 H), 3.86 - 4.00 (m, 1 H), 3.50 (br s, 1 H), 2.67 - 2.77 (m, 3 H), 2.03 - 2.29 (m, 4 H), 1.46 (s, 9 H), 1.28 - 1.41 (m, 4 H).

Step 7:

[00273] A mixture of tert-butyl((lr,4r)-4-((6-bromo-5-methylquinazolin-

2yl)amino)cyclohexyl)carbamate (340 mg, 780.9 umol), 4,4,5, 5-tetramethyl-2-(4,4,5,5- tetramethyl-l,3,2-dioxaborolan-2-yl)-l,3,2-dioxaborolane (198 mg, 780.9 umol), KOAc (229 mg, 2.3 mmol), Pd(dppf)Cl ₂ (57 mg, 78.1 umol) in dioxane (5.0 mL) was degassed and purged with N ₂ for 3 times, and then the mixture was stirred at 90°C for 12 h under N ₂ atmosphere. The reaction mixture was concentrated under reduced pressure. The residue was purified by prep- TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 1/1) to afford tert-butyl ((lr,4r)-4-((5-methyl-6- (4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2-yl)quinazolin-2-yl )amino)cyclohexyl)carbamate (70 mg, 74.9 umol, 9.6% yield).

Step 8:

[00274] A mixture of tert-butyl ((lr,4r)-4-((5-methyl-6-(4,4,5,5-tetramethyl-l,3,2- dioxaborolan-2-yl)quinazolin-2-yl)amino)cyclohexyl)carbamate (70 mg, 145.1 umol), 2 -(2,5- bis(trifluoromethyl)phenyl)-N-(5-bromo-l-methyl-lH-pyrazol-3 -yl)acetamide (62 mg, 145.1 umol), K ₂ C0 ₃ (60 mg, 435.3 umol), Pd(dppf)Cl ₂ (10 mg, 14.5 umol) in dioxane (3.0 mL), H ₂ 0 (0.3 mL) was degassed and purged with N ₂ for 3 times, and then the mixture was stirred at 90°C for 12 h under N ₂ atmosphere. The reaction mixture was concentrated under reduced pressure. The residue was purified by prep-TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 0/1) to afford tert- butyl ((lr,4r)-4-((6-(3-(2-(2,5-bis(trifluoromethyl)phenyl)acetami do)-l-methyl-lH-pyrazol-5-yl)- 5-methylquinazolin-2-yl)amino)cyclohexyl)carbamate (60 mg, 47.1 umol, 32.5% yield).

Step 9:

[00275] To a solution of tert-butyl ((lr,4r)-4-((6-(3-(2-(2,5- bis(trifluoromethyl)phenyl)acetamido)-l -methyl- lH-pyrazol-5-yl)-5-methylquinazolin-2- yl)amino)cyclohexyl)carbamate (60 mg, 85.0 umol) in DCM (3.0 mL) was added TFA (1.0 mL). The mixture was stirred at 15°C for 5 min. The reaction mixture was concentrated under reduced pressure. The residue was dissolved in MeOH (2.0 mL) and basified pH to 8 with H ₃ .H ₂ 0 (25% solution). The residue was purified by prep-HPLC (FA condition) to give N-(5-(2- (((lr,4r)-4-aminocyclohexyl)amino)-5-methylquinazolin-6-yl)- l-methyl-lH-pyrazol-3-yl)-2-(2,5- bis(trifluoromethyl)phenyl)acetamide (8.4 mg, 12.7 umol, 14.9% yield, FA) . M+H ⁺ = 606.2 (LCMS); 1H MR (METHANOL-^, 400MHz): δ 9.32 (br s, 1 H), 8.56 (br s, 1 H), 7.74 - 7.98 (m, 3 H), 7.38 - 7.60 (m, 2 H), 6.51 (s, 1 H), 4.10 (s, 2 H), 3.97 (br s, 1 H), 3.56 (s, 3 H), 3.07 (br s, 1 H), 2.49 (s, 3 H), 2.22 (br d, J= 10.80 Hz, 2 H), 2.04 - 2.14 (m, 2 H), 1.42 - 1.65 (m, 4 H).

Example 37: Synthesis N-(5-(8-ethyl-2-(((lr,4r)-4-((2- methoxyethyl)(methyl)amino)cyclohexyl)amino)quinazolin-6-yl) -l-methyl-lH-pyrazol-3- y -2-(3-(trifluoromethyl)phenyl)acetamide (46).

Step 1:

To a solution of tert-butyl ((lr,4r)-4-(l,3-dioxoisoindolin-2-yl)cyclohexyl)(2- methoxyethyl)carbamate (500 mg, 1.2 mmol) in DCM (4.0 mL) was added TFA (1.0 mL). The mixture was stirred at 25°C for 0.5 h. The reaction mixture was concentrated under reduced pressure to afford 2-((lr,4r)-4-((2-methoxyethyl)amino)cyclohexyl)isoindoline-l ,3-dione (500 mg, crude, TFA).

Step 2:

[00276] To a solution of 2-((lr,4r)-4-((2-methoxyethyl)amino)cyclohexyl)isoindoline-l ,3- dione (500 mg, 1.2 mmol, TFA) which was added TEA to adjust pH 7 in MeOH (10.0 mL) was added paraformaldehyde (324 mg, 3.6 mmol) and CH ₃ COOH (0.1 mL) to the pH around 5, the mixture was stirred at 25°C for 2 h. The mixture was added NaBH ₃ CN (377 mg, 6.0 mmol). The mixture was stirred at 45°C for 24 h. The reaction mixture was quenched by addition H ₂ 0 (30.0 mL), and then extracted with ethyl acetate (10.0 mL x 3). The combined organic layers were washed with brine (10.0 mL ^χ 3), dried over Na ₂ S0 ₄ , filtered and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (Si0 ₂ , DCM / MeOH = 10/1) to afford 2-((lr,4r)-4-((2-methoxyethyl)(methyl)amino)cyclohexyl)isoin doline-l,3-dione (215 mg, crude). ¹ HNMR (400MHz, CHLOROF ORM-<f) δ 7.71 (br d, J= 2.6 Hz, 2H), 7.65 - 7.57 (m, 2H), 3.65 - 3.44 (m, 3H), 2.95 (br s, 2H), 2.88 (s, 4H), 2.55 (br s, 3H), 2.36 - 2.16 (m, 2H), 2.05 (br d, J= 19.3 Hz, 2H), 1.79 (br d, J= 14.0 Hz, 2H), 1.46 (br d, J= 12.7 Hz, 2H). Step 3:

[00277] To a solution of 2-((lr,4r)-4-((2- methoxyethyl)(methyl)amino)cyclohexyl)isoindoline-l,3-dione (215 mg, 679.5 umol) in EtOH (5.0 mL) was added H ₂ H ₂ .H ₂ 0 (347 mg, 6.8 mmol, 337.0 uL). The mixture was stirred at 80°C for 12 h. The reaction mixture was quenched by addition H ₂ 0 (3.0 mL), and then extracted with ethyl acetate (3.0 mL x 3). The combined organic layers were washed with brine (3.0 mL x 3), dried over Na ₂ S0 ₄ , filtered and concentrated under reduced pressure to give (lr,4r)-Nl-(2- methoxyethyl)-Nl-methylcyclohexane-l,4-diamine (120 mg, crude).

Step 4:

[00278] To a solution of (lr,4r)-Nl-(2-methoxyethyl)-Nl-methylcyclohexane-l,4-diamine

(120 mg, 644.1 umol) in n-butyl alcohol (4.0 mL) was added DIEA (249 mg, 1.9 mmol, 336.5 uL) and 6-bromo-8-ethyl-2-iodoquinazoline (233 mg, 644.1 umol). The mixture was stirred at 100°C for 12 h. The reaction mixture was concentrated under reduced pressure. The residue was purified by prep-TLC (Si0 ₂ , DCM / MeOH = 8/1) to afford (lr,4r)-Nl-(6-bromo-8- ethylquinazolin-2-yl)-N4-(2-methoxyethyl)-N4-m ethyl cyclohexane-l,4-diamine (60 mg, crude). Step 5:

[00279] To a solution of (lr,4r)-Nl-(6-bromo-8-ethylquinazolin-2-yl)-N4-(2- methoxyethyl)-N4-methylcyclohexane-l,4-diamine (60 mg, 142.3 umol) in dioxane (2.0 mL) was added 4,4,4',4',5,5,5',5'-octamethyl-2,2'-bi(l,3,2-dioxaborolane) (43 mg, 170.8 umol) Pd(dppf)Cl ₂ (10 mg, 14.2 umol) and KOAc (41 mg, 427.1 umol). The mixture was stirred at 90°C for 12 h under N ₂ . The reaction mixture was concentrated under reduced pressure. The residue was purified by prep-TLC (Si0 ₂ , DCM / MeOH = 10/1) to afford (lr,4r)-Nl-(8-ethyl-6- (4,4,5, 5-tetramethyl-l,3,2-dioxaborolan-2-yl)quinazolin-2-yl)-N4-(2 -methoxyethyl)-N4- methylcyclohexane-l,4-diamine (20 mg, crude).

Step 6:

[00280] A mixture of (lr,4r)-Nl-(8-ethyl-6-(4,4,5,5-tetramethyl-l,3,2-dioxaborola n-2- yl)quinazolin-2-yl)-N4-(2-methoxyethyl)-N4-methylcyclohexane -l,4-diamine (20 mg, 42.7 umol), N-(5-bromo-l-methyl-lH-pyrazol-3-yl)-2-(3-(trifluoromethyl)p henyl)acetamide (15 mg, 42.7 umol), K ₂ C0 ₃ (8 mg, 64.0 umol) and Pd(dppf)Cl ₂ (3 mg, 4.2 umol) in dioxane (2.0 mL) and H ₂ 0 (0.2 mL) was degassed and purged with N ₂ for 3 times, and then the mixture was stirred at 90°C for 12 h under N ₂ atmosphere. The reaction was concentrated to give a residue. The residue was dissolved in MeOH (2.0 mL) and stirred with 3-mercaptopropyltrimethoxysilane modified silica gel. The residue was purified by prep-HPLC (HCl condition) to give N-(5-(8- ethyl-2-(((lr,4r)-4-((2-methoxyethyl)(methyl)amino)cyclohexy l)amino)quinazolin-6-yl)-l- methyl-lH-pyrazol-3-yl)-2-(3-(trifluoromethyl)phenyl)acetami de (4.1 mg, 5.4 umol, 12.7% yield, HCl). M+H ⁺ = 624.3 (LCMS); ¹ HNMR (400MHz, DMSO-d ⁶ ) δ 10.83 (s, 1H), 9.11 (br s, 1H), 7.79 (d, J= 1.7 Hz, 1H), 7.72 (s, lH), 7.67 - 7.61 (m, 3H), 7.60 - 7.54 (m, 1H), 7.50 - 7.38 (m, 1H), 6.65 (s, 1H), 6.55 (s, 1H), 3.85 - 3.71 (m, 5H), 3.24 (s, 3H),3.00 (q, J= 7.3 Hz, 2H), 2.70 - 2.65 (m, 1H), 2.36 - 2.31 (m, 1H), 2.29 - 2.05 (m, 5H), 1.86 - 1.73 (m, 2H), 1.46 - 1.09 (m, 9H).

Example 38: Synthesis of N-(5-(2-(((lr,4r)-4-amino-4-methylcyclohexyl)amino)-8- ethylquinazolin-6-yl)-l-methyl-lH-pyrazol-3-yl)-2-(2,5- bis(trifluoromethyl)phenyl)acetamide (49) and N-(5-(2-(((ls,4s)-4-amino-4- methylcyclohexyl)amino)-8-ethylquinazolin-6-yl)-l-methyl-lH- pyrazol-3-yl)-2-(2,5- bis(trifluoromethyl)phenyl)acetamide (50)

Step 1:

[00281] To a solution of tert-butyl N-(l-methyl-4-oxo-cyclohexyl)carbamate (500 mg, 2.2 mmol) in DCM (20.0 mL) was added phenylmethanamine (306 mg, 2.8 mmol, 311.7 uL) and the resulting mixture was stirred at 20°C for 10 min. Follow by successive addition of NaBH(OAc) ₃ (932 mg, 4.4 mmol) and AcOH (13 mg, 219.9 umol, 12.5 uL). The mixture was stirred at 30°C for 12 h. Saturated aqueous NaHC0 ₃ (10.0 mL) was added to the mixture and concentrated to remove DCM. The water phase was extracted with ethyl acetate (10.0 mL ^χ 3). The combined organic phase was dried over anhydrous Na ₂ S0 ₄ , filtered and concentrated to give a residue. The residue was purified by column chromatography (Si0 ₂ , Petroleum ether / Ethyl acetate = 20/1 to 3/1) to afford tert-butyl (4-(benzylamino)-l-methylcyclohexyl)carbamate (560 mg, 1.6 mmol, 72.0% yield). 1H MR (METHANOL-^, 400 MHz) δ 7.42 - 7.20 (m, 5H), 3.78 (d, J= 1.8 Hz, 2H), 2.60 - 2.43 (m, 1H), 2.19 (br d, J= 12.7 Hz, 1H), 1.90 - 1.73 (m, 3H), 1.71 - 1.59 (m, 1H), 1.44 (d, J= 4.0 Hz, 9H), 1.40 - 1.16 (m, 6H).

Step 2:

[00282] To a solution of tert-butyl (4-(benzylamino)-l -methyl cyclohexyl)carbamate (500 mg, 1.6 mmol) in ethyl acetate (8.0 mL) was added Pd/C (500 mg, 1.6 mmol, 10% Pd) under N ₂ . The suspension was degassed under vacuum and purged with H ₂ several times. The mixture was stirred under H ₂ (15 psi) at 20°C for 12 h. Pd/C (500 mg, 1.6 mmol, 10% Pd) was added to the reaction mixture and the mixture was stirred under H ₂ (40 psi) at 20°C for 5 h. The reaction was filtered and concentrated to afford tert-butyl (4-amino-l-methylcyclohexyl)carbamate (190 mg, crude).

Step 3:

[00283] To a solution of tert-butyl (4-amino-l -methyl cyclohexyl)carbamate (190 mg,

832.1 umol) in n-BuOH (5.0 mL) was added DIEA (161 mg, 1.2 mmol, 217.4 uL) and 6-bromo-

8-ethyl-2-iodoquinazoline (302 mg, 832.1 umol). The mixture was stirred at 100°C for 12 h.

The reaction was concentrated to give a residue. The residue was purified by column

chromatography (Si0 ₂ , Petroleum ether / Ethyl acetate = 40/1 to 5/1) to afford tert-butyl (4-((6- bromo-8-ethylquinazolin-2-yl)amino)-l-methylcyclohexyl)carba mate (200 mg, 358.2 umol, 43.0% yield). M+H ⁺ = 465.2 (LCMS).

Step 4:

[00284] A mixture of tert-butyl (4-((6-bromo-8-ethylquinazolin-2-yl)amino)-l- methylcyclohexyl)carbamate (180 mg, 388.43 umol), 4,4,4',4',5,5,5',5'-octamethyl-2,2'-bi(l,3,2- dioxaborolane) (109 mg, 427.27 umol), AcOK (57 mg, 582.6 umol) and Pd(dppf)Cl ₂ (29 mg, 38.8 umol) in dioxane (2.0 mL) was degassed and purged with N ₂ for 3 times, and then the mixture was stirred at 90°C for 12 h under N ₂ atmosphere. The reaction was concentrated to give a residue. The residue was purified by prep-TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 5/1) to afford (2-((4-((tert-butoxycarbonyl)amino)-4-methylcyclohexyl)amino )-8-ethylquinazolin-6- yl)boronic acid (110 mg, crude).

Step 5:

[00285] A mixture of (2-((4-((tert-butoxycarbonyl)amino)-4-methylcyclohexyl)amino )-8- ethylquinazolin-6-yl)boronic acid (110 mg, 256.8 umol,), 2-(2,5-bis(trifluoromethyl)phenyl)-N- (5-bromo-l-methyl-lH-pyrazol-3-yl)acetamide (111 mg, 256.8 umol), K ₂ C0 ₃ (53mg, 385.2 umol) and Pd(dppf)Cl ₂ (19 mg, 25.7 umol) in H ₂ 0 (0.3 mL) and dioxane (3.0 mL) was degassed and purged with N ₂ for 3 times, and then the mixture was stirred at 90°C for 12 h under N ₂ atmosphere. The reaction was concentrated to give a residue. The residue was purified by prep- TLC (Si0 ₂ , Petroleum ether / Ethyl acetate = 1/1.5) to give tert-butyl (4-((6-(3-(2-(2,5- bis(trifluoromethyl)phenyl)acetamido)-l -methyl- lH-pyrazol-5-yl)-8-ethyl quinazolin-2- yl)amino)-l-m ethyl cyclohexyl)carbamate (100 mg, 95.4 umol, 37.1% yield). M+H ⁺ = 734.1 (LCMS).

Step 6:

[00286] To a solution of tert-butyl (4-((6-(3-(2-(2,5- bis(trifluoromethyl)phenyl)acetamido)-l -methyl- lH-pyrazol-5-yl)-8-ethyl quinazolin-2- yl)amino)-l-m ethyl cyclohexyl)carbamate (100 mg, 136.3 umol) in DCM (2.0 mL) was added TFA (1.0 mL). The mixture was stirred at 15°C for 0.5 h. The reaction was concentrated to give a residue. The residue was dissolved in MeOH (2.0 mL) and basified pH to 8 with H ₃ .H ₂ 0 (25% solution). The residue was purified by prep-HPLC (FA condition) to afford N-(5-(2- (((lr,4r)-4-amino-4-methylcyclohexyl)amino)-8-ethylquinazoli n-6-yl)-l -methyl- lH-pyrazol-3- yl)-2-(2,5-bis(trifluoromethyl)phenyl)acetamide (6.7 mg, 9.2 umol, 6.7% yield, FA). M+H ⁺ = 634.3 (LCMS); 1H MR (METHANOL-^ _, 400MHz) δ 9.08 (s, 1H), 8.53 (br s, 1H), 7.95 (d, J = 8.3 Hz, 1H), 7.90 (s, 1H), 7.82 (br d, J= 8.3 Hz, 1H), 7.73 (d, J= 1.3 Hz, 1H), 7.65 (s, 1H), 6.64 (s, 1H), 4.12 (s, 2H), 4.08 - 3.98 (m, 1H), 3.85 (s, 3H), 3.09 (q, J= 7.5 Hz, 2H), 2.19 (br d, J = 11.0 Hz, 2H), 1.95 (br d, J= 12.3 Hz, 2H), 1.89 - 1.77 (m, 2H), 1.75 - 1.62 (m, 2H), 1.48 (s, 3H), 1.35 (t, J= 7.5 Hz, 3H). And N-(5-(2-(((ls,4s)-4-amino-4-methylcyclohexyl)amino)-8- ethylquinazolin-6-yl)-l-methyl-lH-pyrazol-3-yl)-2-(2,5-bis(t rifluoromethyl)phenyl)acetami (19.9 mg, 29.0 umol, 21.3% yield, FA). M+H ⁺ = 634.3 (LCMS); 1H NMR (METHANOL-^ _, 400MHz) δ 9.08 (s, 1H), 8.57 (s, 1H), 7.95 (d, J= 8.2 Hz, 1H), 7.90 (s, 1H), 7.82 (d, J= 8.2 Hz, 1H), 7.74 (d, J= 2.0 Hz, 1H), 7.66 (d, J= 1.8 Hz, 1H), 6.65 (s, 1H), 4.15 - 4.04 (m, 3H), 3.85 (s, 3H), 3.10 (q, J= 7.5 Hz, 2H), 2.18 - 2.07 (m, 2H), 1.99 - 1.88 (m, 2H), 1.84 - 1.69 (m, 4H), 1.41 (s, 3H), 1.35 (t, J= 7.5 Hz, 3H).

II. Biological Evaluation

Example 1: In Vitro FRET Assay

[00287] In vitro FRET assay was performed to evaluate the ability of select compounds to inhibit IRE1, the results of which are summarized in Table 3. To perform the in vitro FRET assay, IX complete assay buffer (CAB; 1M DTT, 50 mM sodium citrate pH 7.15, ImM magnesium acetate, 0.02% tween 20) was used to dilute SignalChem IREla protein to a final concentration of 2 nM. Selected compounds were serially diluted with DMSO in a non-binding black 384-well plate for a total of 15 ul in each well. 2 ul of the serially diluted compound or DMSO control were then added to new wells containing 98 ul of IX CAB, for a total volume of 100 ul, 10 ul of which were then transferred to wells of a new plate. 5 ul of the diluted IREla was then added to each well. 5ul of a 400 mM XBPl RNA probe was then added to each well.

Fluorescence was then read over 30 minutes in kinetic mode (485/515 nm).

[00288] Two RNA probes were used, XBPl wildtype (SEQ ID NO: 2) which is able to be spliced by active IREla or XBPl mutant (SEQ ID NO: 3) which is unable to be spliced. Each probe contained a 5' 6-FAM modification and a 3' IOWA Black FQ modification.

[00289] A second FRET assay was performed to assess ATP-mediated inhibition. In this case, compounds and IREla were prepared and combined as discussed above, with the addition of ATP up to 1 mM final concentration. This mixture was incubated at room temperature for 60 minutes and then 5 ul of 400 nM XBPl wildtype or mutant RNA probe was added. Plates were then read over 30 minutes in kinetic mode (485/515 nm).

Table 3.

Compound Ref. No. Mean IC ₅ o

4 A

5; Formic Acid B

6; Formic Acid A

7; Formic Acid A

11; Formic Acid B

12; Formic Acid A

13; Formic Acid B

15; Formic Acid B

16; Formic Acid A

17; Formic Acid B

18; Formic Acid B

19; Formic Acid A

20; Formic Acid B

21; Formic Acid C

22; Formic Acid D

23; Formic Acid D

24; Formic Acid D

25; Formic Acid B

27; Formic Acid B

29; Formic Acid A

30; Formic Acid A

31; Formic Acid D

32; Formic Acid A

34; Formic Acid A

35; Formic Acid A

37; Formic Acid A

39; Formic Acid A

40; Formic Acid A

41 D

42 D

43; Formic Acid A

44; Formic Acid C Compound Ref. No. Mean IC ₅ o

45; Formic Acid D

46; HC1 D

49; Formic Acid C

50; Formic Acid C

Note: Biochemical assay Mean IC ₅₀ data are designated within the following ranges: A: < 5 nM; B: > 5 nM to < 50 nM; C: > 50 nM to < 100 nM; and D: > 100 nM.

Example 2: In Vitro Luciferase Assay

[00290] Compounds disclosed herein were assessed for disruption of IRE1 signaling using a IREla Endoribonuclease Nanoluciferase Assay. Briefly, 2.5 x 10 ⁶ 293T cells were seeded in in a 10 cm ² tissue culture plate. About 24 hours later, the cells were transfected with Effectene. In a 15 mL Tube, the following was added: 2 μg XBP1 luciferase reporter plasmid (PGK-Luc2- P2A-XBPlu-Nanoluciferase-PEST); 300 μΐ EC buffer; and 16 μΐ Enhancer, followed by incubation at room temp for 5 minutes. Next, 60 μΐ Effectene (Qiagen 301427) was added, followed by incubation at room temperature for 10 minutes. 2.6 mL cDMEM media was added. Old media was aspirated from the cells, followed by addition of 7 mL fresh media. Full transfection mixture was added dropwise to cells. Cells were incubated for 6 hours, followed by tripsinization, centrifugation and resuspension in 1 1 mL media. 100 uL of cells were plated per a well in a 96 well plate. A day later, stressors of choice +/- inhibitors were added. To harvest, media was aspirated from cells completely, then 50 uL lx passive lysis buffer (Promega: E1941) was added per well and put on shaker (300rpm) for 30 minutes at room temperature. Cells were centrifuged, and 15 uL sample per well was added to a new, opaque white 384 well plate (Corning 3570). 15 uL OneGlo (nanoluciferase kit, Promega N1630) was added. Plates were spun down, placed on shaker (300rpm) for 10 minutes. Plates were read on luminometer, 1000ms integration time per well. 15 uL Stop and Glo (nanoluciferase kit) was added. Plates were spun down, placed on shaker (300rpm) for 10 minutes. Plates were read on luminometer, 1000 ms second integration time per well. Recordings are provided below in Table 4.

Table 4.

Compound Ref. No. Mean EC ₅ o

4 A

6; Formic Acid D

7; Formic Acid D

11; Formic Acid D

12; Formic Acid A-B

13; Formic Acid D

16; Formic Acid D

18; Formic Acid D

19; Formic Acid B

25; Formic Acid D

27; Formic Acid D

29; Formic Acid A

30; Formic Acid B

31; Formic Acid D

32; Formic Acid A

34; Formic Acid B

35; Formic Acid B

37; Formic Acid B

39; Formic Acid B

40; Formic Acid C

41 D

42 D

43; Formic Acid B

44; Formic Acid C

Note: Biochemical assay Mean EC ₅₀ data are designated within the following ranges: A: < 5 nM; B: > 5 nM to < 50 nM; C: > 50 nM to < 100 nM; and D: > 100 nM.

Example 3: ELISA Assay

[00291] Total human or mouse CD4 T cells are isolated by negative selection with MiltenyiMACS beads. Mouse CD4 T cells are isolated from mouse spleen while human CD4 T cells were isolated from human PBMCs. CD4 T cells are washed and then mixed with

CD3/CD28 activator Dynabeads at 8 pm. After a 36 hour incubation, select IREla inhibitor compounds or IREla inhibitor controls are added and incubated for 2 hours. [00292] After the two hour incubation, mouse or human cell-free malignant ascites supernatants or cRPMI control are added. After a 10 hour incubation, supernatants are isolated and used in an IFN-g ELISA assay. Trizol is added to each ELISA well containing T Cells for isolating RNA. ELISA assay is performed with the eBioscience Ready-Set-Go IFN-g ELISA kit according to the manufacturer's recommended protocol.

Example 4: DC Lipid Accumulation Assay

[00293] Approximately 3xl0 ⁶ bone marrow cells (after RBC lysis) are seeded in 10 mL cRPMI with 20 ng/mL GM-CSF in a petri dish. On culture day 3, 10 mL of cRPMI + 20 ng/mL GM-CSF is added. On culture day 6, non-adherent cells from each plate are collected and resuspended in 20 mL of fresh cRPMI + 20 ng/mL GM-CSF. On culture day 7, suspension cells are harvested, counted, and the resuspended at 500,000 cells per 180 microliters in fresh cRPMI + 20 ng/mL GM-CSF + 110% final concentration of IREla inhibitor compounds or DMSO as a control. 180 microliters of cell suspension are added to each well of a 96 well flat bottom TC- treated plate and incubated for 2 hours. 20 ul of 10X LPS (1 ug/mL) prepared in cRPMI + 20 ng/mL GM-CSF is added to indicated wells and incubated for another 6 hours. Cells are spun down and supernatant was stored in a new 96-well V-bottom plate. 200 microliters of trizol is added to pelleted cells to subsequent RNA analysis.

Example 5: T Cell Metabolism Assay

[00294] Total human or mouse CD4 T cells are isolated by negative selection with Miltenyi MACS beads. Mouse CD4 T cells are isolated from mouse spleen while human CD4 T cells are isolated from human PBMCs. One and a half million CD4 T cells are washed and then mixed with CD3/CD28 activator Dynabeads at a 1 : 1 beadxell ratio and plated in complete RPMI in a 6 well plate. After a 24 hour incubation, select IREla inhibitor compounds or IREla inhibitor control compounds are added and incubated for 2 hours. After the two hour incubation, mouse or human cell -free malignant ascites supernatants or cRPMI control are added. After a 16 hour incubation, the dynabeads are removed by magnetic separation and mitochondrial oxygen consumption rate (OCR) and glycolytic extracellular acidification rate (ECAR) is measured with the Seahorse XFe96 Analyzer (Agilent). Samples are assayed in triplicate with 150,000 viable cells plated in each well of the assay plate. Supernatants are additionally isolated and used in downstream IFN-g ELISA assays. IREla activity is also measured by quantifying XBP1 splicing with quantitative PCR or by intracellular flow cytometric staining with an XBPls-specific monoclonal antibody (clone: Q3-695; BD Pharmingen). Example 6: Xbpl Activation in ID8 Mouse Model

[00295] A syngeneic mouse model for metastatic, orthotopic ovarian cancer is used to analyze the in vivo effects of compounds described herein. In a first analysis, IREla/XBPl activation is assessed in the ID8 mouse model for ovarian cancer.

[00296] Parental ID8 or aggressive ID8-Defb29/Vegf-A intraperitoneal ovarian tumors are generated. About 1-2 x 10 ⁶ tumor cells are injected into wild type female C57BL/6 mice. After 3 weeks, a first group of 3-5 tumor bearing mice (parental ID8 and ID8-Defb29/Vegf-A mice) and tumor-free naive mice are injected intraperitoneally with a compound from Table 1. Additional groups of 3-5 tumor bearing mice and naive mice are injected with vehicle (PBS) as a control. Tumors are resected and ascites drained from the mice 12-24 hours after the injection for analyzing IREla pathway activation in the tumor microenvironment.

[00297] Fluorescently activated cell sorting (FACS) is then performed to purify cells from the tumors and ascites. Tumor dendritic cells (tDCs) (CD45 ⁺ CD1 lc ⁺ CDl lb ⁺ MHC-II ⁺ CD8a ^low ), tumor cells (CD45- SSC ^M ), CD4+ T cells (CD45 ⁺ CD3 ⁺ CD4 ⁺ ) and CD8+ T cells

(CD45 ⁺ CD3 ⁺ CD4 ⁺ ) are isolated from tumors and ascites of parental ID8 mice and ID8- Defb29/Vegf-A mice. Control splenic dendritic cells (sDCs) (CD45 ⁺ CD1 lc ⁺ CDl lb ⁺ MHC- II ⁺ CD8a ^" ) or splenic T cells (CD45 ⁺ CD3 ⁺ CD4 ⁺ or CD45 ⁺ CD3 ⁺ CD8 ⁺ ) are isolated from spleens of naive mice or ID8 mice and ID8-Defb29/Vegf-A mice. During sorting, viable cells are identified using the LIVE/DEAD Fixable Yellow Dead Cell Stain Kit (Life Technologies).

[00298] Total Xbpl mRNA expression and spliced Xbpl (Xbpls) are quantified in sDCs and T cells from naive mice, sDCs and T cells from parental ID8 mice and ID8-Defb29/Vegf-A mice, and tDCs, tumor cells, and tumor-infiltrating T cells from parental ID8 mice and ID8- Defb29/Vegf-A mice administered either vehicle or a compound from Table 1. Briefly, RNA from sorted cells are isolated using the Trizol reagent. 0.1-1 μg of RNA are used to generate cDNA using the High Capacity cDNA Reverse Transcription Kit (Life Technologies). Mouse Xbpl splicing assays are performed using conventional Reverse Transcription PCR (RT-PCR) and primers shown in Table 5. Gene expression analysis is also performed via Reverse

Transcription quantitative PCR (RT-qPCR) using a Stratagene Mx3005 instrument and SYBR green I (Life Technologies). Gene expression is measured of Xbpl target genes including ERdj4, Sec24d, and Sec61al and general ER stress response markers Hspa5 (BiP) and Ddit3 (CHOP). Murine Xbpls transcript expression is analyzed using a primer that spans the splicing junction site. Table 5

Mouse Agpat6 Agpat6-F AGCTTGATTGTCAACCTCCTG RT-qPCR

[00299] Protein analysis of XBP1 S is performed by Western blot or intracellular flow cytometric analysis of sDCs and T cells from naive mice, sDCs and T cells from parental ID8 mice and ID8-Defb29/Vegf-A mice, and tDCs, tumor cells and tumor-infiltrating T cells from parental ID8 mice and ID8-Defb29/Vegf-A mice administered either vehicle or a compound from Table 1. Briefly, for Western blotting 5 x 10 ⁶ sDCs, tumor cells, T cells, or tDCs are washed twice in IX cold PBS and nuclear proteins are purified using the Nuclear Extraction Kit (Life Technologies). Proteins are quantified using the BCA method (Pierce) and 15-20 μg of nuclear proteins are separated via SDS-PAGE and are transferred onto nitrocellulose membranes. Anti- mouse XBPls (GL Biochem) is raised in rabbit using a peptide corresponding to the XBPls C- terminus, and is used at a 1 :500 dilution for immunoblotting. Goat anti -mouse Lamin B (Santa Cruz) is used at 1 :2000. HRP-conjugated secondary antibodies to rabbit and mouse (Santa Cruz) are used at a 1 :2000 dilution. SuperSignal West Femto (Pierce) is used as Chemiluminescent Substrate and blots are imaged using a FluorChemE instrument (ProteinSimple). For

intracellular flow cytometry of XBPls protein, 1-2 million splenocytes or dissociated cells from solid tumors or ascites are washed in cold PBS and stained with the Ghost Dye 510 fixable viability dye diluted 1 : 1000 in PBS for 30 minutes on ice. The staining reaction is quenched with 2 mL of FACS buffer (PBS with 2% fetal bovine serum and 1 mM EDTA), cells pelleted by centrifugation at 300xg for 5 minutes, and then surface stained with antibodies directed at key lineage defining markers such as CD45/CD3/CD4/CD8 (for T cells) or CD45/CD1 lc/MHC-II (for DCs) for 30 minutes in FACS buffer on ice. Cells are washed twice with FACS buffer and then fixed and permeabilized for 30 minutes with the eBioscience FoxP3 nuclear staining kit according to the manufacturer's protocol. Cells are washed twice with lx permeabilization buffer, then Fc receptors are blocked with Truestain FcX anti -mouse CD 16/32 (Biolegend) for 15 minutes at room temperature. Finally, 5 microliters of XBPls antibody (clone Q3-695) or an equivalent amount of isotype control antibody are added directly to cells and stained for 30 minutes at room temperature protected from light. Cells are washed twice with lx

permeabilization buffer and resuspended in FACS buffer, then analyzed on a flow cytometer such as the BD LSR II.

Example 7: Ovarian Cancer Progression

[00300] Tumor progression is measured in parental ID8 and aggressive ID8-Defb29/Vegf-

A mice administered vehicle or a compound from Table 1. Similar to Example 1, parental ID8 or aggressive ID8-Defb29/Vegf-A intraperitoneal ovarian tumors are generated. Briefly, 1-2 x 10 ⁶ tumor cells are injected into wild type C57BL/6 mice. After 2 weeks, a first group of 8-10 tumor bearing mice (parental ID8 and ID8-Defb29/Vegf-A mice) and a separate group of naive mice are injected intraperitoneally once per day with a compound from Table 1. Additional groups of tumor bearing mice and naive mice are injected with PBS as a control. In combination therapy studies, additional groups of mice are injected every other day with 200 μg isotype control antibody or blocking antibodies against CTLA-4 or PD-1. A final group of mice receives a combination therapy consisting of compound from Table 1 and 200 μg checkpoint blocking antibody directed against either CTLA-4 or PD-1.

[00301] Tumor size, tumor volume, number of tumor masses as well as spleen size are then measured from vehicle or compound treated naive mice, parental ID8 mice, and aggressive ID8-Defb29/Vegf-A mice. Naive mice are monitored weekly for signs of morbidity or mortality from compound treatment. Malignant ascites accumulation is measured weekly as the percentage of body weight gain, and animals are euthanized once they reach 40% body weight gain. Survival of mice bearing parental ID8 tumors or aggressive ID8-Defb29/Vegf-A tumors that are treated with vehicle or a compound from Table 1 is calculated as the number of days required to reach 40% weight gain since the tumor cells are originally injected. Compounds listed in Table 1 are assessed for reduction in tumor-associated weight gain compared with vehicle control -treated animals.

Example 8: Lipid Analysis and Transcriptional Profiling

[00302] Lipid peroxidation byproducts are measured in mice described in Examples 1 -2.

Intracellular lipid content is evaluated via flow cytometry using 4,4-Difluorol,3, 5,7,8- Pentamethyl-4-Bora-3a,4a-Diaza-s-Indacene (BODIPY 493/503; Life Technologies). Briefly, 5 x 10 ⁶ splenic cells or dendritic cells from naive mice, parental ID8 mice, and aggressive ID8- Defb29/Vegf-A mice that are administered vehicle or a compound from Table 1 are stained for surface markers using antibodies that do not overlap with BODIPY 493/503, namely CD1 lc- APC, CD45-APC-Cy7, and CD1 lb-Pacific Blue, followed by staining with 500 mL of BODIPY 493/503 at 0.5 mg/mL in PBS for 15 minutes at room temperature in the dark. BODIPY 493/503 staining is then detected in the PE or FITC channel. Lipid analysis is also performed using electron microscopy analysis and mass spectrometry. In addition to lipid content, intracellular reactive oxygen species (ROS) and 4-HNE adducts are measured with 2 7 ¹ -dichlorofluorescm di acetate (DCFDA) and a competitive ELISA assay (Cell Biolabs), respectively.

[00303] Transcriptional profiling is performed in naive mice, parental ID8 mice, and aggressive ID8-Defb29/Vegf-A mice that are treated with vehicle or a compound from Table 1. Gene expression of genes that are involved in unfolded protein response (UPR)/ endoplasmic reticulum (ER) stress and genes involved in lipid metabolism are measured in tDCs purified by FACS. These include but are not limited to Sec24d, Sec61al, P4hb, Fasn, Agpat4, and Agpat6. XBP1 pathway activation and key effector functions are also measured by quantitative PCR in tumor-infiltrating lymphocytes purified by FACS. Compounds listed in Table 1 are assessed for reduction in XBPls target gene expression and BODIPY 493/503 fluorescence in tumor- associated DCs.

Example 9: T Cell Activation

[00304] T cell activation is determined in ovarian cancer bearing mice following administration of compounds described herein. In vivo antigen presentation experiments are performed in wild-type C57BL/6 female mice bearing parental ID8 or ID8-Defb29/Vegf-A ovarian tumors. After three weeks, naive mice, parental ID8 mice, or ID8-Defb29/Vegf-A mice are intraperitoneally injected with 0.6 mg of full length endotoxin-free ovalbumin (OVA) (SIGMA, grade VII). Mice are then injected with vehicle or a compound from Table 1 3 hours later. After 18 hours, mice receive intraperitoneally 2 x 10 ⁶ CFSE-labeled T cells negatively purified from OT-1 transgenic mice. Peritoneal wash samples (10 mL) are collected after 72 hours and analyzed for CFSE dilution via FACS to calculate number of T cell divisions. Data are analyzed using FlowJo version 9 or 10.

[00305] In vitro antigen presentation experiments are performed with isolated tDCs from wild-type C57BL/6 female mice bearing parental ID8 or ID8-Defb29/Vegf-A ovarian tumors. After 3-4 weeks of tumor burden, tDCs are purified by FACS from the peritoneal cavity of naive mice, parental ID8 mice, or ID8-Defb29/Vegf-A, and are pulsed with full-length endotoxin-free ovalbumin protein (Sigma, grade VII) in cRPMI containing 25% cell-free ovarian cancer ascites supernatants overnight at 37°C. Antigen-loaded tDCs are then washed twice with cRPMI and co- cultured with CFSE-labeled OT-I CD8+ T cells immunopurified from OT-1 mice at a 1 : 10 (DC to T cell) ratio. After 3-5 days, cultures analyzed for CFSE dilution via FACS to calculate number of T cell divisions. Data are analyzed using FlowJo version 9 or 10. Isolated tDCs from animals treated with a compound from Table 1 are assessed for enhancement of T cell proliferation relative to tDCs isolated from vehicle-treated controls.

Example 10: Anti-tumor Immunity

[00306] Effects of test compounds in inducing anti-tumor immunity are analyzed. Mice are intraperitoneally injected with ID8-Defb29/Vegf-A ovarian cancer cells and are treated with a compound from Table 1 (n=3-5/group) or vehicle daily starting at day 14 after tumor challenge.

-I l l- After 1-2 weeks of daily treatment, peritoneal lavage samples are analyzed for the number of metastatic cancer cells and tumor ascites accumulation in the peritoneal cavity.

[00307] The capacity for T cells to respond to tumor antigens is also measured. Freshly isolated ascites cells are cultured in 96-well flat bottom plates for 6 hours in the presence of PMA, Ionomycin and Brefeldin A to induce cytokine translation and retention within the secretory pathway. After this stimulation period, the cells are washed twice with FACS buffer (PBS + 2% FBS and 1 mM EDTA) and stained for 30 minutes with Ghost Dye 510 Violet (Tonbo Biosciences) in PBS on ice according to the manufacturer's protocol. Cells are then washed twice more with FACS buffer and then stained with antibodies directed against CD45, CD3, CD4, CD8, and CD44 on ice for 30 minutes. Fc receptors are also blocked at this time with the TrueStain FcX Antibody (anti-CD 16/32, Biolegend). After this staining period, cells are washed twice more with FACS buffer, resuspended in lx Fix/Perm reagent (eBioscience Foxp3/Transcription Factor Staining Buffer Set), mixed well by pipetting 2-3 times and incubated for 30 minutes at room temperature protected from light. Cells are then washed twice with lx permeabilization buffer and stained at room temperature with antibodies directed against murine Fc receptor CD16/32 (Fc Block), IFN-gamma and Granzyme-B for 30 minutes. After this incubation period, cells are washed once with lx permeabilization buffer, once with FACS buffer, and resuspended in FACS buffer for analysis by flow cytometry. Data are analyzed using Flow Jo version 9 or 10.

[00308] Total splenic T cells or Ficoll-enriched leukocytes (2-3 x 10 ⁵ ) from peritoneal wash samples are obtained 4 days after the last treatment (day 27) and are cocultured in 10% FBS RPMI with 2-3 x 10 ⁴ bone marrow-derived DCs that are pulsed overnight with irradiated ID8-Defb29/Vegf-A ovarian cancer cells. Supernatants are collected after 48-72 hours of stimulation. IFN-γ and Granzyme B secretion is determined by ELISA using the Ready-SET-Go Kit (eBioscience). Tumor-resident T cells from animals treated with a compound from Table 1 are assessed for increased IFN-γ and Granzyme B production relative to T cells isolated from vehicle-treated controls.

Example 11: Pharmacokinetic Studies

[00309] Compounds are tested in a pharmacokinetic ("PK") study to determine the half- life (Ti _/2 ) in mice. A compound from Table 1 is dissolved in a vehicle to make a test antibiotic composition. The vehicle might be, for example, a water or a 25% PEG400 in saline solution Administration to each mouse is performed via intravenous (IV) cannulation of the tail vein. Blood is collected over K2-EDTA anticoagulant from the submandibular or saphenous vein at predetermined time points. Following collection, the blood samples are stored at -70°C until analysis by LC-MS and comparison to a standard calibration curve results in the T1/2 for each compound.

[00310] Alternatively, on study day, the animals (fasted) usually receive a compound from Table 1 (typically 10 or 30 mg/kg) by IP injection (typically 10 mL/kg). The IP dose is typically delivered via a bolus into the IP space for mice. All dosages are expressed as target dose in mg free base/acid equivalent/kg; actual doses are calculated for each individual animal and are recorded. The plasma samples are then collected as above and plasma levels determined.

Example 12: Protein Binding - Plasma Protein Binding Assay-HTD Method

[00311] The plasma protein binding is determined according to the following steps. Frozen plasma or freshly prepared plasma from various subjects are used as test matrix. They are purchased from commercial vendors or prepared in house from animals. Warfarin is used as a positive control. Other control compound(s) may be used according to specific requirement. One or more compounds from Table 1 are spiked into blank matrix at the final concentration of 2 μΜ (or other test concentrations based on specific requirement). Final organic solvent concentration is < 1%. If plasma samples are collected from in-life studies, they are used as test matrix without spiking compounds. An appropriate volume of spiked plasma solution is removed before incubation for recovery calculation. An aliquot (e.g., 150 μΤ) of matrix sample is added to one side of the chamber (donor chamber) in a 96-well equilibrium dialyzer plate (HTD dialysis device) and an equal volume of dialysis buffer is added to the other side of the chamber (receiver chamber). Triplicate incubations are performed (or other replicate number according to specific requirement). The dialyzer plate is placed into a humidified incubator with 5% C0 ₂ and incubated at 37°C for 4 to 6 hours. After incubation, samples are taken from the donor chamber as well as the receiver chamber. The plasma sample is matched with an appropriate volume of blank buffer; and buffer samples are matched with an appropriate volume of blank plasma. The matrix-matched samples are quenched with stop solution containing internal standard. Samples are analyzed by LC/MS/MS. Test compound concentrations in donor and receiver samples are expressed as peak area ratios of analyte/internal standard. If a quantitative analysis is needed, a set of calibration curve and quality controls could be included.

Example 13: Inhibition of Triple Negative Breast Cancer

[00312] XBP1 is known to binds directly to HTFla in triple negative breast cancer, and this cooperative binding enhances the upregulation of HIF la-dependent downstream target genes. Compounds in Table 1 are screened for impact on XBP1 protein level, thereby removing a key binding partner for HIF la and reducing expression of HIF la-dependent target genes such as VEGFA, PDK1, GLUT1, and JMJD1 A. Specifically, human triple-negative breast cancer cell lines are treated with vehicle control or a compound shown in Table 1, then cultured under hypoxia (0.1% 0 ₂ ) for 24 hours. Cells are then lysed with RLT buffer, RNA extracted with the RNeasy 96 kit (Qiagen) and complementary DNA generated from the pure RNA. Semiquantitative PCR and quantitative PCR are then used to quantify spliced Xbpl transcripts, total Xbpl transcripts, target genes regulated by XBPls (e.g. SEC61A1, P4HB, EDEM1, AND SEC24D) and target genes regulated by HIFla (e.g. VEGFA, PDK1, GLUT1, and JMJD1A). The splicing ratio of XBP1 is calculated by determining the amount of spliced Xbpl transcripts divided by the total number of spliced and unspliced Xbpl transcripts, an indicator for compounds that inhibit critical intracellular signaling required for TNBC tumor-initiating cell function and metastatic capacity. Compounds shown in Table 1 are assessed for downregulation of XBPls, XBP1 splicing ration, XBPls-dependent target gene expression, and HIFl target gene expression relative to DMSO control -treated samples.

Example 14: Soft agar Colony Formation Assay

[00313] One hundred thousand breast cancer cells are mixed 4: 1 (v/v) with 2.0% agarose in growth medium containing vehicle control or a compound listed in Table 1 for a final concentration of 0.4% agarose. The cell mixture is plated on top of a solidified layer of 0.8% agarose in growth medium. Cells are fed every 6-7 days with growth medium containing 0.4% agarose and vehicle control or a compound from Table 1, matching the initial plating conditions. The number of colonies are counted after 20 days, with the number of colonies visible at the end of the growth period to identify colonies with reduced growth. The number of colonies are counted after 20 days, with the number of colonies visible at the end of the growth period to identify colonies with reduced growth.

Example 15: Inhibition of Metastatic Breast cancer

[00314] Mice with established metastatic breast cancer are separately injected with each of the compounds in Table 1. After 12 hours, the tumors are excised, mechanically separated, and enzymatically digested to single cell suspensions. Flow-assisted cell sorting is then used to purify four populations of cells: tumor cells, dendritic cells (DC), CD4+ T cells, and CD8+ T cells. The cells are sorted directly into RLT buffer for instant cell lysis and RNase deactivation.

Then, cellular RNA is purified with the RNeasy 96 kit (Qiagen), and complementary DNA generated from the pure RNA. Semi -quantitative PCR and quantitative PCR are then used to quantify spliced Xbpl transcripts, total Xbpl transcripts, and target genes regulated by XBPls such as SEC61A1, P4HB, EDEM1, AND SEC24D. The splicing ratio of XBP1 is calculated by determining the amount of spliced Xbpl transcripts divided by the total number of spliced and unspliced Xbpl transcripts, an indicator for compounds that inhibit metastatic breast cancer. Compounds shown in Table 1 are assessed for reduction in XBPls transcripts, XBPl splicing and downstream XBPls target genes relative to vehicle control -treated mice.

Example 16: Inhibition of Lung Cancer

[00315] Mice with established primary or metastatic lung cancer are separately injected with each of the compounds in Table 1. After 12 hours, the tumors are excised, mechanically separated, and enzymatically digested to single cell suspensions. Flow-assisted cell sorting is then used to purify four populations of cells: tumor cells, dendritic cells (DC), CD4+ T cells, and CD8+ T cells. The cells are sorted directly into RLT buffer for instant cell lysis and RNase deactivation. Then, cellular RNA is purified with the RNeasy 96 kit (Qiagen), and

complementary DNA generated from the pure RNA. Semi -quantitative PCR and quantitative PCR are then used to quantify spliced Xbpl transcripts, total Xbpl transcripts, and target genes regulated by XBPls such as SEC61A1, P4HB, EDEM1, AND SEC24D. The splicing ratio of XBPl is calculated by determining the amount of spliced Xbpl transcripts divided by the total number of spliced and unspliced Xbpl transcripts, an indicator for compounds that inhibit primary or metastatic lung cancer. Compounds shown in Table 1 are assessed for reduction in XBPls transcripts relative to vehicle control -treated mice.

Example 17: Inhibition of Bladder Cancer

[00316] Mice with established primary or metastatic bladder cancer are separately injected with each of the compounds in Table 1. After 12 hours, the tumors are excised, mechanically separated, and enzymatically digested to single cell suspensions. Flow-assisted cell sorting is then used to purify four populations of cells: tumor cells, dendritic cells (DC), CD4+ T cells, and CD8+ T cells. The cells are sorted directly into RLT buffer for instant cell lysis and RNase deactivation. Then, cellular RNA is purified with the RNeasy 96 kit (Qiagen), and

complementary DNA generated from the pure RNA. Semi -quantitative PCR and quantitative PCR are then used to quantify spliced Xbpl transcripts, total Xbpl transcripts, and target genes regulated by XBPls such as SEC61A1, P4HB, EDEM1, AND SEC24D. The splicing ratio of XBPl is calculated by determining the amount of spliced Xbpl transcripts divided by the total number of spliced and unspliced Xbpl transcripts, an indicator for compounds from that inhibit primary or metastatic bladder cancer. Compounds shown in Table 1 are assessed for reduction in XBPls transcripts, XBPl splicing and downstream XBPls target genes relative to vehicle control -treated mice. [00317] While preferred embodiments of the present invention have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the invention. It should be understood that various alternatives to the embodiments of the invention described herein may be employed in practicing the invention. It is intended that the following claims define the scope of the invention and that methods and structures within the scope of these claims and their equivalents be covered thereby.

SEQUENCE LISTING

SEQ ID NO: 1

MPARRLLLLLTLLLPGLGIFGSTSTVTLPETLLFVSTLDGSLHAVSKRTGSIKWTLKEDP V

LQVPTHVEEPAFLPDPNDGSLYTLGSKNNEGLTKLPFTIPELVQASPCRSSDGILYM GKK

QDIWYVIDLLTGEKQQTLSSAFADSLCPSTSLLYLGRTEYTITMYDTKTRELRWNAT YFD

YAASLPEDDVDYKMSHFVSNGDGLVVTVDSESGDVLWIQNYASPVVAFYVWQREGLR

KVMHINVAVETLRYLTFMSGEVGRITKWKYPFPKETEAKSKLTPTLYVGKYSTSLYA SP

SMVHEGVAVVPRGSTLPLLEGPQTDGVTIGDKGECVITPSTDVKFDPGLKSKNKLNY LR

N YWLLIGHHETPL S A S TKMLERFPNNLPKHREN VIP AD SEKK SFEE VINL VDQ T SEN APT

TVSRDVEEKPAHAPARPEAPVDSMLKDMATIILSTFLLIGWVAFIITYPLSMHQQQQ LQH

QQFQKELEKIQLLQQQQQQLPFHPPGDTAQDGELLDTSGPYSESSGTSSPSTSPRAS NHSL

CSGSSASKAGSSPSLEQDDGDEETSVVIVGKISFCPKDVLGHGAEGTIVYRGMFDNR DVA

VKRILPECFSFADREVQLLRESDEHPNVIRYFCTEKDRQFQYIAIELCAATLQEYVE QKDF

AHLGLEPITLLQQTTSGLAHLHSLNIVHRDLKPHNILISMPNAHGKIKAMISDFGLC KKLA

VGRHSFSRRSGVPGTEGWIAPEMLSEDCKENPTYTVDIFSAGCVFYYVISEGSHPFG KSL

QRQANILLGACSLDCLHPEKHEDVIARELIEKMIAMDPQKRPSAKHVLKHPFFWSLE KQL

QFFQDVSDRIEKESLDGPrVKQLERGGRAVVKMDWRENITVPLQTDLRKFRTYKGGS VR

DLLRAMRNKKHHYRELPAEVRETLGSLPDDFVCYFTSRFPHLLAHTYRAMELCSHER LF

QPYYFHEPPEPQPPVTPDAL

SEQ ID NO: 2

CAUGUCCGCAGCACAUG

SEQ ID NO: 3

CAUGUCCCCAGCACAUG