Cross-Reference to Related Applications

[0001] This application claims the priority of U.S. Provisional Patent Application No. 62/403,365, filed on October 3, 2016 and further claims priority of U.S. Provisional Patent Application No. 62/413,269, filed on October 26, 2016. The entirety of the aforementioned applications is incorporated herein by reference.

Field of the Invention

[0002] The invention relates to the vaccine field. Particularly, the invention relates to a vaccine against Klebsiella pneumoniae infection comprising a conjugate of oligosaccharide units of capsular polysaccharides of Klebsiella pneumoniae.

Background of the Invention

[0003] Klebsiella pneumoniae is an important pathogen which causes various diseases in human. Recently, community-acquired pyogenic liver abscess (PLA) caused by K pneumoniae has become an emerging disease globally. The mortality rates are 10% among those with K pneumoniae -caused PLA and 30-40% among those with metastatic meningitis. The survivors of metastatic meningitis usually have severe neurological sequelae and metastatic endophthalmitis usually resulting in blindness of the affected eyes. Besides causing PLA, K pneumoniae also has been reported to cause invasive infections leading to abscesses at other sites (such as kidney, spleen, brain, and prostate), necrotizing fasciitis, and severe pneumonia with bacteremia.

[0004] Researchers report that the most common capsular type of the strains causing PLA is Kl, and that the second is K2. In addition to these studies of PLA, recent studies demonstrate that the predominant capsular types of K pneumoniae causing other invasive infections such as necrotizing fasciitis and bacteremic community-acquired pneumonia also are capsular type Kl and K2 {Lin YT et al, BMC infectious diseases 2010, 10:307; and Fang CT etal, Clinical infectious diseases : an official publication of the Infectious Diseases Society of America 2007, 45(3): 284-293).

[0005] Besides, K pneumoniae is also responsible for approximate 10% of nosocomial infections and increasing resistances to antibiotics such as extended-spectrum β-lactams and carbapenem is also a significant problem. Our recent study reported that the capsular types K64 (38%), K62 (13%), K24 (8%), KN2 (7%) and K28 (6%) account for 72% of carbapenem resistant K pneumoniae (CRKP). Clustering of capsular types in CRKP strains was observed.

~i~ [0006] Bacterial capsule-targeted vaccines, such as those for Streptococcus pneumoniae, are usually effective against infections caused by this encapsulated pathogen. A K pneumoniae Kl capsule polysaccharide (CPS) vaccine has been reported in 1985. A 24- valent K. pneumoniae CPS vaccine has been also reported in 1988. Although K. pneumoniae Kl CPS and 24-valent CPS vaccine were reported several years ago, there was no available K pneumoniae vaccine until now. Previous studies have demonstrated that the polysaccharide vaccine could only induce T-cell independent immunity which was lacking immunological memory as well as production of high affinity antibodies. Therefore, a K pneumoniae CPS-protein conjugate vaccine would be more effective against infections caused by this bacterium.

[0007] Kl and K2 CPS composed with several repeat units of sugars were huge molecules (Yang FL etal, The Journal of biological chemistry 2011, 286(24):21041-21051). Depolymerization of CPS will increase the efficiency to conjugate with protein. Chemical reagents, such as trifluoroacetic acid, ammonium hydroxide and acetic acid, can reduce CPS units but result in loss of CPS modification (acetylation or pyruvation) which is important for immune responses. WO2012145676 Al provides isolated bacteriophages which could infect Kl strains and have identified its capsule depolymerase specific to digest Kl CPS. There is a need to develop a vaccine against Klebsiella pneumoniae infection.

Summary of the Invention

[0008] The invention utilizes digested capsular polysaccharides (CPSs) of Klebsiella pneumoniae separately conjugated with a carrier to generate CPS conjugate vaccines. The invention surprisingly found that the CPS conjugate vaccines could both induce CPS antibodies with bactericidal activities. The CPS conjugate vaccine can be applied in prevention of K pneumoniae causing invasive infections.

[0009] The invention provides various immunogens comprising a repeat unit of saccharide of Klebsiella pneumoniae CPS, which has a formula selected from the group consisting of Formulae (I) to (VI) as described herein.

[0010] The invention provides an isolated polypeptide having degradation activity specific to the capsule of Klebsiella pneumoniae capsular type K2 strains, selected from the group consisting of: (a) a polypeptide comprising the amino acid sequence of SEQ ID NO: 2; and (b) a polypeptide which is encoded by a polynucleotide which hybridizes under at least high stringency conditions with (i) the polypeptide coding sequence of SEQ ID NO: 2, or (ii) a full-length complementary strand of (i). [0011] The invention also provides a vaccine comprising one or more immunogens selected from Formula (I) to (VI).

[0012] Certain embodiments include vaccines comprising an immunogen conjugated with a protein carrier. In further embodiments, the vaccine is a Kl and K2 CPS conjugated divalent vaccine comprising immunogens of Formula I and Formula II, or a K64 and K62 CPS conjugated divalent vaccine comprising immunogens of Formula III and Formula IV.

[0013] The present invention provides a method of eliciting an immune response against a Klebsiella pneumoniae, comprising administering an effective amount of the immunogen of the invention or a vaccine of the invention.

[0014] The present invention also provides an antibody produced by administering the conjugate vaccine of the invention.

[0015] The present invention also provides a method of preventing infection of Klebsiella pneumoniae, comprising administering an effective amount of the immunogen of the invention or a vaccine of the invention.

Brief Description of the Drawing

[0016] Figures 1 (A) to (C) show the enzymatic activity of purified K2-OR 16 protein.

(A) The purified K2-OR 16 protein (indicated with the arrow) was separated on SDS-PAGE gel with Coomassie blue staining and the sizes (kilo-daltons) were indicated beside the protein marker. (B) A clear spot surrounding with a translucent halo and a translucent spot are observed when the phage 1611E-K2-1 (left) and its K2-OR 16 (right) protein were spotted on the plate overlaid with top agar containing K pneumoniae 161 IE strain, respectively. (C) The extracted K2 CPS treated with various amounts of K2-ORF16 protein were separated on SDS-PAGE gel with alcian blue staining.

[0017] Figures 2 (A) to (D) show the mass and capillary electrophoresis analysis of Kl CPS digested by K1-ORF34 protein. (A) Mass distribution of Kl CPS cleaved by K1-ORF34 and Biogel P6 separation. (B) Capillary electrophoresis of Kl CPS cleaved by K1-ORE34 protein. (C) MS-MS spectra of Kl CPS fragment (MW 1, 145). (D) ¹ H- MR of Kl- oligosaccharides.

[0018] Figures 3 (A) to (C) show the structure analysis of K2 CPS digested by K2- ORF16 protein. (A) The MALDI-TOF spectra of K2 CPS digested by K2-ORF16 protein.

(B) ESI-MS/MS analysis of m/z at 703 and (C) at 1365.

[0019] Figure 4 shows the structure of major product of K62 capsule depolymerase- digested K62 CPS by Mass-Mass analysis. [0020] Figures 5 (A) to (C) show the safety of Kl CPS conjugated vaccine. (A) The body weights of mice before and one day after each administration of Kl CPS conjugate vaccine were recorded. (B) The rectal temperatures of mice before and one day after each administration of Kl CPS conjugate vaccine were recorded. (C) The liver (ALT) and renal (BUN and creatinine) functions of mice one week after each administration of Kl CPS conjugate vaccine were determined.

[0021] Figure 6 shows the inductions of antibodies against CPS in mice received the Kl or K2 or K62 CPS conjugate vaccine. The different amounts of Kl or K2 (2000 ng to 7.8125 ng, two-fold dilution) or K62 CPS (4000 ng to 500 ng, two-fold dilution) transferred onto membrane were blotted with sera (1 : 1000 dilution) from mice received Kl or K2 or K62 CPS conjugate vaccine.

[0022] Figures 7 A to C show the efficacies of the Kl or K2 or K62 CPS conjugate vaccine in mice. Five mice immunized with Kl or K2 CPS conjugate vaccine were IP inoculated with 1 x 10 ⁴ CFU of K. pneumoniae NTUH-K2044 (A) or NTUH-A4528 (B), respectively. Vaccination with Kl or K2 CPS conjugate vaccine significantly increased the survival of mice infected with K. pneumoniae NTUH-K2044 (.Ρ=0.0144, log-rank test) or NTUH-A4528 ( =0.0023, log-rank test). Five mice inoculated with the K62 CPS conjugated vaccine which were treated with cyclophosphamide to induce neutropenia were then challenged with 5xl0 ⁶ cfu of K62 bacteria (C). K62 CPS conjugated vaccine significantly protect immunocompromised mice from subsequent infection of K62 bacteria (.Ρ=0.0448, log-rank test).

[0023] Figures 8 A and B show the efficacy of the Kl and K2 CPS conjugate divalent vaccine in mice. Five mice immunized with Kl and K2 CPS conjugate divalent vaccine were IP inoculated with 1 x 10 ⁴ CFU of K. pneumoniae NTUH-K2044 (A) or NTUH-A4528 (B), respectively. Vaccination with Kl and K2 CPS conjugate divalent vaccine significantly increased the survival of mice infected with K. pneumoniae NTUH-K2044 (.Ρ=0.0143, log- rank test) or NTUH-A4528 ( =0.0023, log-rank test).

[0024] Figures 9 to 12 show the spectrum of K64 CPS, K24 CPS, K28 CPS and KN2 CPS, respectively.

[0025] Figures 13 A and B show the inductions of antibodies against Kl CPS (A) and serum bactericidal activity (B) in mice received the Kl crude CPS or Kl CPS conjugated vaccine. The different amounts of Kl (2000 ng to 7.8125 ng, two-fold dilution) transferred onto membrane were blotted with sera (1 : 1000 dilution) from five mice received Kl crude CPS or Kl CPS conjugated vaccine.

Detailed Description of the Invention

[0026] Unless otherwise noted, technical terms are used according to conventional usage.

[0027] The singular terms "a," "an," and "the" include plural referents unless context clearly indicates otherwise. Similarly, the word "or" is intended to include "and" unless the context clearly indicates otherwise.

[0028] Abbreviations: GlcAp: glucuronic acid; Fucp: fucose; Glcp: glucose; Manp: mannose; Rhap: rhamnose; Galp: galactose; GlcUAp: GlcAp: glucuronic acid.

[0029] As used herein, the term "conjugate" refers to a composition composed of two heterologous molecules linked together useful for stimulating or eliciting a specific immune response in an animal. In some embodiments, the immune response is protective in that it enables the animal to better resist infection from the organism against which the immunogenic conjugate is directed. One specific example of a type of immunogenic conjugate is a vaccine, such as a conjugate vaccine.

[0030] As used herein, the term "linker" refers to a compound or moiety that acts as a molecular bridge to operably link two different molecules, wherein one portion of the linker is operably linked to a first molecule and wherein another portion of the linker is operably linked to a second molecule. The two different molecules can be linked to the linker in a stepwise manner.

[0031] As used herein, the term "vaccine" refers to a pharmaceutical composition that elicits a prophylactic or therapeutic immune response in a subject. Typically, a vaccine elicits an antigen-specific immune response to an antigen of a pathogen.

[0032] As used herein, the term "oligosaccharide" refers to a compound containing two or more monosaccharide units. Oligosaccharides are considered to have a reducing end and a non-reducing end.

[0033] As used herein, "protein carrier" refers to a protein, peptide or fragment thereof, which is coupled or conjugated to an oligosaccharide to enhance the immunogenicity of the resulting oligosaccharide-protein carrier conjugate to a greater degree than the oligosaccharide alone.

[0034] As used herein, the term "antibody" encompasses polyclonal and monoclonal antibody preparations, as well as preparations including hybrid antibodies, altered antibodies, F(ab').sup.2 fragments, F(ab) molecules, Fv fragments, single chain fragment variable displayed on phage (scFv), single domain antibodies, chimeric antibodies, humanized antibodies, and functional fragments thereof which exhibit immunological binding properties of the parent antibody molecule.

[0035] As used herein, the term "immunogen" refers to a protein or a portion thereof that is capable of inducing an immune response in a mammal, such as a mammal infected or at risk of infection with a pathogen. Administration of an immunogen can lead to protective immunity and/or proactive immunity against a pathogen of interest.

[0036] In one aspect, the invention provides an immunogen comprising a repeat unit of trisaccharide of Klebsiella pneumoniae Kl CPS, which has the following Formula (I): wherein m is 1 to 4.

[0037] In one embodiment, m is 2.

[0038] The invention found that Kl-orf34 polypeptide can degrade Klebsiella pneumoniae Kl CPS. After the degradation, a hexasaccharide of Klebsiella pneumoniae Kl CPS can be obtained. The hexasaccharide degraded from Kl CPS can be used an immunogen against Klebsiella pneumoniae infection. The Kl-orf34 polypeptide has an amino acid sequence as shown in SEQ ID NO: 1.

MALIRLVAPERVFSDLASMVAYPNFQVQDKITLLGSAGGDFTFTTTASVVDNGTVFA

VPGGYLLRKFVGPAYSSWFSNWTGTVTFMSAPNRHLVVDTVLQATSVLNIKSNSTLE

FTDTGRILPDAAVARQVLNITGSAPSVFVPLAADAAAGSKVITVAAGALSAVKGTYL

YLRSNKLCDGGPNTYGVKISQIRKVVGVSTSGGVTSIRLDKALHYNYYLSDAAEVGI

PTMVENVTLVSPYINEFGYDDLNRFFTSGISANFAADLHIQDGVIIGNKRPGASDIE GR

SAIKFNNCVDSTVKGTCFYNIGWYGVEVLGCSEDTEVHDIHAMDVRHAISLNWQST

ADGDKWGEPIEFLGVNCEAYSTTQAGFDTHDIGKRVKFVRCVSYDSADDGFQARTN

GVEYLNCRAYRAAMDGFASNTGVAFPIYRECLAYDNVRSGFNCSYGGGYVYDCEA

HGSQNGVRINGGRVKGGRYTRNS S SHIF VTKD VAET AQTSLEIDGVSMRYDGTGRA

VYFHGTVGIDPTLVSMSNNDMTGHGLFWALLSGYTVQPTPPRMSRNLLDDTGIRGV

ATLVAGEATVNARVRGNFGSVANSFKWVSEVKLTRLTFPSSAGALTVTSVAQNQDV

PTPNPDLNSF VIRS SNAAD VSQ VAWEVYL (SEQ ID NO: l)

[0039] In another aspect, the invention provides an immunogen comprising a repeat unit of tetrasaccharide of Klebsiella pneumoniae K2 CPS, which has the following Formula (II):

wherein n is 1 to 4.

[0040] In one embodiment, the immunogen contains one repeat unit (i.e., n is 1).

[0041] The invention found that K2-ORF16 polypeptide can degrade Klebsiella pneumoniae K2 CPS. After the degradation, a tetrasaccharide of Klebsiella pneumoniae K2 CPS can be obtained. The tetrasaccharide degraded from K2 n _ca n be used an immunogen against Klebsiella pneumoniae infection. Accordingly, the invention provides an isolated polypeptide or a variant thereof, having degradation activity specific to the capsule of Klebsiella pneumoniae capsular type K2 strains, selected from the group consisting of: (a) a polypeptide comprising the amino acid sequence of SEQ ID NO:2; and (b) a polypeptide which is encoded by a polynucleotide which hybridizes under at least high stringency conditions with (i) the polypeptide coding sequence of SEQ ID NO:2, or (ii) a full-length complementary strand of (i). In one embodiment, the K2-ORF16 polypeptide has an amino acid sequence as shown in SEQ ID NO:2.

MTIIKRADLGRPLTWDELDDNFQQVDDLTAAASAAVLSASASATAAAGSATNSLNS

ANSAASSADDAAASATVAINALMNSTFEPADFDFTSGGTLDSTDR KAVY PADNN

WYSWSGILPKIVTAATDPTADSNWKPRTDQLLRQNLASSVIPGTSLVTHSDGIHLDD

YIEIF RRTKFFMPEDFPGTDTEQLQSALSYAKS RVNVVLQAGKTYYVTGSQGLEV

DLGYYSFESPNGIAYIDFTGCTATYCLWVHSSRPYPDGSE HCTSMRGIKFKSSVKGI

GQRLLLTGNNNDSSNGTYNGDCKIENCMFSTADIVLGASNSTWRYKFINCGFMMES

TGGTYAMHFPAGISDSGESVTFQNCKIFDMKGCPILVECASFAIGMPGTSVLNTPIK IT

GSGAMVFMDSAANIE PGASAWYRYGEVTGTGARLILNGCTLVCN PSLQTKPLFY

VGANAFIDVTLVKTPG DYLFQNGDEGLRTFVEGDGYVTASHCIGDILSGVGNIPLH

KSL PTL PGFETGDLSSWSFNNQGSASQTCVVGTAYKKTGTYGARMTSFGSLSCFL

TQKVKVTQHGYYSTTCQF TITAGTGTTAGSLTITFYNRDGNALQAGASS FTNTPS

GWQSVGRFIQGRVPQAAEYCEVSFRCREGAVIDVD FIINFT (SEQ ID NO:2)

[0042] The variant of the polypeptide is artificial, which comprises a substitution, deletion, and/or insertion of one or more amino acids of the polypeptide of SEQ ID NO:2. Preferably, amino acid changes are of a minor nature, that is conservative amino acid substitutions or insertions that do not significantly affect the folding and/or activity of the protein; small deletions, typically of one to about 30 amino acids; small amino- or carboxyl- terminal extensions, such as an amino-terminal methionine residue; a small linker peptide of up to about 20-25 residues; or a small extension that facilitates purification by changing net charge or another function, such as a tract of histidine tag or a tract of poly-histidine tag, an antigenic epitope or a binding domain.

[0043] In another aspect, the invention provides an immunogen comprising a repeat unit of hexasaccharide of Klebsiella pneumoniae K64 CPS, which has the following Formula (III):

wherein n is 1 to 4. In one embodiment, n is 1.

[0044] In another aspect, the invention provides an immunogen comprising a repeat unit of pentasaccharide of Klebsiella pneumoniae K62 CPS, which has the following Formula (IV):

wherein n is 1 to 4. In one embodiment, n is 2.

[0045] In another aspect, the invention provides an immunogen comprising a repeat unit of pentasaccharide of Klebsiella pneumoniae K24 CPS, which has the following Formula (V):

wherein n is 1 to 4. In one embodiment, n is 1.

[0046] In another aspect, the invention provides an immunogen comprising a repeat unit of hexasaccharide of Klebsiella pneumoniae K28 CPS, which has the following Formula (VI):

wherein n is 1 to 4. In one embodiment, n is 1.

[0047] In another aspect, the invention provides an immunogen comprising a repeat unit of hexasaccharide of Klebsiella pneumoniae KN2 CPS, which has four hexoses and one hexuronic acid and about a molecule weight of about 1027.

[0048] The enzymes used for degrading CPS of K24, K28, K62, K64 and KN2 are described in WO2012145676 Al .

[0049] In another aspect, the invention provides a vaccine comprising one or more immunogens selected from Formula (I) to (VI).

[0050] The structural sugar units and the degraded CPS products of Kl, K2, K62, K64, K24 and K28 are as follows: Structural sugar units Degraded CPS products

[0051] In one embodiment, the immunogen is conjugated with a protein carrier.

[0052] In one embodiment, the vaccine is a multi-valent vaccine. In some embodiments, the vaccine is a Kl and K2 CPS conjugated divalent vaccine comprising immunogens of Formula I and Formula II. In a further embodiment, the vaccine is a Kl and K2 CPS conjugated divalent vaccine comprising a mixture of immunogen I-carrier and immunogen II- carrier, wherein the immunogen I having Formula (I) and the immunogen II having Formula (II) are conjugated with a carrier, respectively.

[0053] In one embodiment, the vaccine is a multi-valent vaccine. In some embodiments, the vaccine is a K64 and K62 CPS conjugated divalent vaccine comprising immunogens of Formula III and Formula IV. In a further embodiment, the vaccine is a K64 and K62 CPS conjugated divalent vaccine comprising a mixture of immunogen Ill-carrier and immunogen IV-carrier, wherein the immunogen III having Formula (III) and the immunogen IV having Formula (IV) are conjugated with a carrier, respectively.

[0054] The immunogen of the invention can be conjugated with a carrier to form a conjugate. In one embodiment, the conjugate is a vaccine. In another embodiment, any one of the immunogen ratio in the conjugate vaccine is from 1 : 1.4 to 1 : 10.2. In one embodiment, the vaccine comprises 10% (w/w) to 90% (W/W) of immunogen I or Ill-protein carrier and 10% (w/w) to 90%) (W/W) of immunogen II- or IV-carrier. Preferably, the vaccine comprises equal amount of immunogen I- or Ill-carrier and immunogen II- or IV-carrier.

~io~ [0055] Suitable carriers are known in the art and may include, for example, proteins, peptides, lipids, polymers, dendrimers, virosomes, virus-like particles (VLPs), or combinations thereof. In one embodiment, the carrier is a protein carrier, including but are not limited to, bacterial toxoids, toxins, exotoxins, and nontoxic derivatives thereof, such as keyhole limpet hemocyanine (KLH), hepatitis B virus core protein, thyroglobulin, albumins (such as bovine serum albumin (BSA), human serum albumin (HSA), and ovalbumin), pneumococcal surface protein A (PspA), pneumococcal adhesion protein (PsaA), purified protein derivative of tuberculin (PPD); transferrin binding proteins, polyamino acids, such as poly(lysine:glutamic acid), tetanus toxoid, tetanus toxin Fragment C, diphtheria toxoid, CRM (a nontoxic diphtheria toxin mutant), cholera toxoid, Staphylococcus aureus exotoxins or toxoids, Escherichia coli heat labile enterotoxin, Pseudomonas aeruginosa exotoxin A and bacterial outer membrane proteins (such as Neisseria meningitidis serotype B outer membrane protein complex (OMPC) and outer membrane class 3 porin (rPorB)).

[0056] In one embodiment, the carrier is a protein carrier. In a further embodiment, the protein carrier is CRM197. The amino acid sequence of CRM197 is shown in SEQ ID NO:3. GADDVVDSSKSFVME FSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDDWKEFYST D KYDAAGYSVD E PLSGKAGGVVKVTYPGLTKVLALKVDNAETIKKELGLSLTE PLMEQ VGTEEFIKRFGDGASRVVLSLPF AEGS S S VEYF NWEQ AK ALS VELEINFETR GKRGQDAMYEYMAQACAG RVRRSVGSSLSCINLDWDVIRDKTKTKIESLKEHGPI K KMSESP KTVSEEKAKQYLEEFHQTALEHPELSELKTVTGT PVFAGANYAAWA VNVAQVIDSETADNLEKTTAALSILPGIGSVMGIADGAVHHNTEEIVAQSIALSSLMV AQAIPLVGELVDIGFAAYNFVESIINLFQVVHNSYNRPAYSPGHKTQPFLHDGYAVS WNTVEDSIIRTGFQGESGHDIKITAENTPLPIAGVLLPTIPGKLDVNKSKTHISVNGRKI RMRCR AID GD VTFCRPK SP V Y VGNGVH ANLH V AFURS S SEKIHS EIS SDSIGVLGYQ KTVDHTKVNSKLSLFFEIKS (SEQ ID NO:3)

[0057] Polysaccharides contain hydroxyl groups, and occasionally carboxyl and amino groups, and proteins contain amino and carboxyl groups. Many methods are known in the art for conjugating a protein to a polysaccharide. If the protein carrier is the same for two or more saccharides in the composition, the saccharides could be conjugated to the same molecule of the protein carrier. Alternatively, the saccharides may each be separately conjugated to different molecules of the protein carrier (each molecule of protein carrier only having one type of saccharide conjugated to it). [0058] The amount of vaccine of the invention to be administered a human or animal and the regime of administration can be determined in accordance with standard techniques well known to those of ordinary skill in the pharmaceutical and veterinary arts taking into consideration such factors as the particular antigen, the adjuvant (if present), the age, sex, weight, species and condition of the particular animal or patient, and the route of administration.

[0059] The disclosed conjugate vaccine can be delivered to a subject in a manner consistent with conventional methodologies used in treatment or prevention, for example infection from Klebsiella pneumoniae. In accordance with the disclosure herein, a prophylactically or therapeutically effective amount of the conjugate vaccine and/or other biologically active agent is administered to a subject in need of such treatment for a time and under conditions sufficient to prevent, inhibit, and/or ameliorate a Klebsiella pneumoniae infection. In some embodiments, administration of the conjugate vaccines to a subject elicits an immune response against a Klebsiella pneumoniae antigenic immunogen in the subject. In some embodiments, a subject is selected for treatment that has, or is at risk for developing, a Klebsiella pneumoniae infection, for example because of exposure or the possibility of exposure to a Klebsiella pneumoniae. In an important aspect, the conjugate vaccine provided herein may be used to prevent infection of Klebsiella pneumoniae.

[0060] The conjugate vaccine may be prepared as a solution, suspension, tablet, pill, capsule, sustained release formulation, powder, or the like. The antigens and immunogenic composition may be mixed with physiologically acceptable carriers which are compatible therewith. These may include water, saline, dextrose, glycerol, ethanol, combinations thereof, and the like. The conjugate vaccine may further contain auxiliary substances, such as wetting or emulsifying agents or pH buffering agents, to further enhance the effectiveness. Administration of the conjugate vaccine can include delivery by various routes, such as, for example, oral, intravenous, intramuscular, nasal, subcutaneous, and intraperitoneal administration.

[0061] In a further aspect, the invention provides an antibody produced by administering the conjugate vaccine of the invention.

[0062] The examples that follow are intended to illustrate the invention and not to limit it. All percentages used herein are by weight unless otherwise indicated. All patents, patent applications, and literature references cited herein are hereby incorporated by reference in their entirety. EXAMPLES

Materials and Methods

Phage isolation

[0063] Agar overlay method was used for isolation of a pure phage preparation and titer determination of the phage. The infectivity of the phage was determined using a spot test {Lin TL, Hsieh PF, Huang YT, et al. Isolation of a bacteriophage and its depolymerase specific for Kl capsule of Klebsiella pneumoniae: implication in typing and treatment. The Journal of infectious diseases 2014; 210:1734-44).

Phage genomic DNA preparation and sequencing

[0064] Phage genomic DNA was extracted per Qiagen Lambda kit with modifications as follows {Lin TL, Hsieh PF, Huang YT, et al. Isolation of a bacteriophage and its depolymerase specific for Kl capsule of Klebsiella pneumoniae: implication in typing and treatment. The Journal of infectious diseases 2014; 210: 1734-44). After phages were precipitated and lysed, the DNA was extracted by phenol/chloroform and precipitated with ethanol. The genome sequences of the phage were determined by Illumina GAII sequencing. Protein expression and purification

[0065] The recombinant His-tagged K1-ORF34 protein was expressed and purified according to a recent study {Lin TL, Hsieh PF, Huang YT, et al. Isolation of a bacteriophage and its depolymerase specific for Kl capsule of Klebsiella pneumoniae: implication in typing and treatment. The Journal of infectious diseases 2014; 210:1734-44). The K2-orfl6 was amplified by PCR using primers 1611E-ORF16-F (5'-

C AAACATCACGGTGACGCTAGC ATGACCATTATC AAACG-3 ' ; SEQ ID NO:4) and 1611E-ORF 16-R (5 ' -CTTTTAACATTTAGCACTCGAGTGTAAAATTAATAATG-3 ' ; SEQ ID NO:5) and then digested with Nhel and Xhol. The K2-orfl6 fragment was cloned into the Nhel and Xhol double-digestion site of a pET28c plasmid (Novagen). The K62 capsule depolymerase was amplified by PCR using primers Ref-KlO-1 ORF6-F (5'- ATGAATAAGATGTTT ACCC AG-3 ' ; SEQ ID NO: 6) and Ref-KlO-1 ORF6-R (5'- AATTGGGCGAAGGCGTTC AAAC-3 ' ; SEQ ID NO: 7) and then cloned into the blunted EcoRI site of a pET28c plasmid (Novagen). The resulting plasmids were transformed into E. coli BL21 (DE3). The recombinant His-tagged proteins were expressed by inducing with 0.4 mM IPTG for overnight at 16 °C, and were purified per the manufacturer's protocol (Qiagen). Purification of K. pneumoniae CPS

[0066] The Kl, K2 and K62 CPS were purified from K. pneumoniae NTUH-K2044 AwbbO, NTUH-A4528 AwbbO and K62 reference AwbbO mutant strains (Hsieh PF, Lin TL, Yang FL, et al. Lipopolysaccharide 01 antigen contributes to the virulence in Klebsiella pneumoniae causing pyogenic liver abscess. PloS one 2012; 7:e33155), respectively, in order to eliminate the contamination of O polysaccharide. The bacteria were cultured on Luria agar plate over 12 hours at 37°C. The bacteria lawn was scrapped, collected and put in sterilized water (w/v = 1/10), and heated at 100 °C for 10 minutes. After cooling, the bacterial solution was centrifuged at 15,000xg- for 20 minutes. The supernatant (volume) was mixed with ice- cold acetone (4 x volumes) for polysaccharide precipitation. After centrifugation at 12,000xg- for 20 minutes, the pellet was the crude CPS. The pellet was suspended in sterilized water and lyophilized. The crude CPS powder was digested by ribonuclease (Roche) and deoxyribonuclease I (Roche) for 24 hours at 37°C and then with protease K in 10 mM Tris- HC1, pH 7.4 for further 6-8 hours. After denaturation at 100 °C for 10 minutes, the supernatant was then dialyzed extensively against water using an 8-10 kDa cutoff membrane and lyophilized. The partial purified CPS was further purified on a TSK HW-65F column [1.6 cm (diameter) x 90 cm (height)] by eluting with 0.1% sodium azide in filtered H ₂ 0. Fractions containing carbohydrates were detected by phenol-sulfuric acid method and dialyzed against H ₂ 0 (MW cutoff: 1 kDa), and concentrated by lyophilization.

CPS structure analysis

[0067] The chemical structures of K. pneumoniae NTUH-K2044 (Kl) and A4528 (K2) capsular polysaccharide could be followed by the previous studies {Yang FL et al, The Journal of biological chemistry 2011, 286(24):21041-21051; Corsaro MM et al, Carbohydrate research 2005, 340(13):2212-2217).

Mass spectrometry

[0068] For MALDI MS analysis, 0.5 μL of sample was mixed with 0.5 μL of matrix solution (20 mg/mL 2, 5-dihydroxybenzoic acid (DHB) in 50% ACN and 1% H3PO4), spotted onto stainless steel plates, air-dried, and then analyzed on a 4800 MALDI TOF/TOF Analyzer (Applied Biosystems, Foster City, CA). It was carried out in the positive reflector mode with an acceleration voltage of 20 kV, 16% grid voltage. A typical spectrum was generated by 1,000 laser shots. The raw spectra were processed by baseline subtraction and noise removal using Data-Explorer software (Applied Biosystems) (Tsai CF et al, Neuromethods 2011, 57: 181-196). For mass spectrum analysis, measurements were performed on an Ultraflex II MALDI-TOF/TOF mass spectrometer (Bruker Daltonik GmbH, Germany). Mass spectra were obtained in the range of mass to charge ratio (m/z) from 500 to 4,000 with reflector mode. MS/MS analysis was performed in the LIFT mode. Mass spectrometry analyses were performed by GRC Mass Core Facility of Genomics Research Center, Academia Sinica, Taipei, Taiwan.

NMR spectra

[0069] The NMR spectra of small CPS fragments in D ₂ 0 were recorded; all two- dimensional NMR experiments were carried out with standard pulse sequences provided by Bruker. NMR data were processed using topspin 3.1. NMR experiments and resonance assignments: All NMR experiments are carried out on a Bruker AVANCE 600 or AVANCE 800 NMR spectrometer (Bruker, Karlsruhe, Germany) equipped with a triple (¾, ¹³ C and ¹⁵ N) resonance cryoprobe, including a shielded z-gradient. Two dimensional (2D) ¹ HNMR, TOCSY and NOESY spectra are collected. All heteronuclear NMR experiments for recombinant protein were carried out as required. Sequence-specific assignment of the backbone atoms is achieved by independent connectivity analysis of CBCA(CO)NH, HNCACB, HNCO, HN(CA)CO, and C(CO)NH. The 1H resonances are assigned using 3D HAHB(CO)NH and HCCH-TOCSY.

Enzymatic cleavage

[0070] Kl CPS was degraded by Kl lyase through β-elimination to produce the double bond between C-4 and C-5 of glucuronic acid, which was detected the change of absorption at 232 nm spectrophotomerically. Assay was performed at 25°C in triplicate in 1-ml-volume cuvette in a UV-VIS spectrophotometer (Ultrospec 4000 UV/Visible; Amersham Pharmacia Biotech, Piscataway, NJ, USA). Recommbination Kl lyase (10 μg/ ml) was added into the reaction mixture containing 25 mM Tris pH7.5, 3 mM MgC12 and 40 μg/ ml CPS. The increase of absorption at 232 nm was then followed for 15 minutes. Reference cuvettes contained no Kl lyase.

Quantification of reducing ends with 3,5-dinitrosalicylic acid (DNSA) assay (for K2 hydrolase)

[0071] Hydrolase activity was determined by estimating the concentration of reducing sugars by 3,5-dinitrosalicyclis acid (DNAS)(Sigma-Aldrich) method {Danner M et al, European journal of biochemistry / FEBS 1993, 215(3):653-661; Miller GL et al, Analytical Chemistry 1959, 31(3): 426-428). When sample was mixed with DNSA and heated to catalyze the reaction, the nitro group in 3' position of DNS would be reduced to amine whose absorbance can be measured at 535 nm by apparatus FlexStation 3. Through quantification the concentration of reducing sugar, the optimal condition for each hydrolase could be determined.

Capillary electrophoresis

[0072] Capillary electrophoresis was performed on a Beckman P/ACE MDQ Capillary Electrophoresis system equipped with a UV detector set at 230 nm. Separation and analysis were performed by a electrokinetic chromatography coated a fused-silica capillary tube (77 μπι ID, 65 cm total length, and 50 cm from the injection point to the detector) at 25°C. The operating buffer was consisted of sodium phosphate buffer (50 mM, pH 9.0). The buffer was degassed by vacuum filtration through a 0.2 μπι membrane filter, and shaken in an ultrasonic bath. Before each run, the capillary tube was washed with 0.1 M NaOH for 5 minutes, double-distilled water for 5 minutes, and then conditioned with the operating buffer for 5 minutes. The samples to be analyzed were injected automatically, using the pressure injection mode, in which the sample was pressurized for 15 seconds. Capillary electrophoresis was performed at 20 kV (about 65 mA) using a normal polarity.

Conjugations of digested CPS with DT-CRM197 carrier protein

General procedure for the preparation of glycosyl amines via Kochetkov amination

[0073] To a solution of a reducing sugar (20 mg) in 3.0 mL of DD water was added ammonium carbonate (3.0 g, excess). The resulting suspension was sealed, and stirred at room temperature for 7 days. The reaction mixture was freeze dried until the dry weight of the residue remains constant. These glycosyl amines were obtained as colorless solids, and were used without further purification.

General procedure for the attachment of thiol linker via glycosyl amine

[0074] To a solution of the above glycosyl amines (20 mg) in 3.0 mL of PBS buffer (pH

7.4) was added DTSSP (20 mg, excess). The reaction mixture was maintained at pH 7.4-7.8 by adding 1M NaOH solution, and stirred at room temperature for 16hrs. To the above solution was added DTT (20 mg, excess), and the mixture stirred at 40 °C for l-2hrs. The solvent was removed under reduced pressure, and the residue was purified by chromatography on a column of Sephadex LH-20 eluded with DD water to afford the desired products digested CPS-SH.

The synthesis of CRM197-maleimid

[0075] After the salt of commercial CRM197 (1.0 mg) was removed via alternate dissolving in water and dialyzing (Amicon Ultra-0.5, 10 kDa,), the residue was dissolved in PBS buffer (pH 6.5, 1.0 mL) and transferred into a sample vial. Sulfo-EMCS (1.0 mg, 8.22 ^χ 10 ^"6 mol) was added to the solution, and then the reaction was kept stirring at room temperature for 2 hours. The mixture was purified by Amicon Ultra-0.5 (10 kDa). After using MALDI-TOF to check the molecular weight and BCA assay to calculate the amount of protein, the CRM 197 -maleimid was stored in PBS buffer (pH 7.2, 1.0 mg/mL) for next step. According to the data of MALDI-TOF, the amount of maleimid function groups could be calculated. For example, when the molecular weight of CRM 197 -maleimid was 61841, the numbers of maleimide function groups on CRM197 -maleimid can be determined.

The synthesis of digested CPS-CRM197 Conjugates (1~4)

[0076] The CRM197-maleimids were dissolved in PBS buffer (pH 7.2, the concentration was 1.0 mg/mL) and then different amount of digested CPS-SH (5.0 mg/mL in PBS buffer, pH 7.2) were added into the solution. The mixtures were stirred at room temperature for 2 hours. The digested CPS-CRM197 conjugates were purified by using Amicon Ultra-0.5 (10 kDa) to remove the nonreactive digested CPS-SH and sodium phosphate salt via dialysis. The obtained digested CPS-CRM197 conjugates could be characterized by MALDI-TOF analysis to determine the carbohydrate incorporation rate. The nonreactive digested CPS-SH could be recovered after reacting with DTT and purifying by LH-20 column chromatography. By changing the amount of used digested CPS-SH, we can conjugate different epitope ratios of oligosaccharides to the CRM 197 carrier.

Vaccination

[0077] The CPS conjugated vaccine was diluted to 100 μg/ml in PBS and the glycolipid adjuvant C34 was dissolved to 100 μg/ml in DMSO. Mice were intra-muscular (FM) inoculated with 100 μΐ vaccine mixture composed of CPS conjugated vaccine (2 μg glycan) and 2 μg adjuvant. For Kl and K2 vaccines: Five-week old female BALB/c mice were received vaccine three times with one-week interval. For K62 vaccine: Five-week old female BALB/c mice were received vaccine five times with two-week interval.

Detection of antibody against CPS

[0078] Different amounts of purified CPS were transferred onto membrane by dot blotting. Antibodies against CPS were detected by incubating sera from vaccinated mice (1 : 1000 dilution).

Serum bactericidal assay

[0079] The mice sera after treatment at 56°C for 30 min were two-fold serial diluted (1/2 to 1/256) with normal saline. The 25 μΐ of diluted sera and 12.5 μΐ of bacteria suspension (100 CFU) were incubated at 37 °C for 15 minutes. After incubation, 12.5 μΐ of newborn rabbit complement (Pel-Freez, USA) were added and incubated for 1 hour at 37 °C. Then the reaction mixture was plated on the LB plate. After overnight culture, the numbers of surviving bacteria were counted. Serum bactericidal titers were defined as the reciprocal of the serum dilution that resulted in > 50% killing of the bacteria that achieved with the bacteria-complement-sera from mice with inoculation of adjuvant only controls.

Protection assay

[0080] For Kl and K2 vaccines: Vaccinated or control mice (adjuvant only) were intraperitoneal (IP) inoculated with 1 x 10 ⁴ CFU of NTUH-K2044 or NTUH-A4528 at one week after vaccination (5 mice each group). The mortality of mice was observed for 30 days. Survival was analyzed by Kaplan-Meier analysis with a log-rank test; a P value <0.05 was considered statistically significant. For K62 vaccine: Vaccinated or control mice (adjuvant only) were IP pre-treated with cyclophosphamide twice at a dose of 100 mg/kg, at 2-day intervals. The cell counts of white blood cell and neutrophil were significantly decreased in cyclophosphamide treated mice. These mice were IP inoculated with 5 x 10 ⁶ CFU of K62 reference strain at twp days after cyclophosphamide treatment (5 mice each group). The mortality of mice was observed for 30 days. Survival was analyzed by Kaplan-Meier analysis with a log-rank test; a P value <0.05 was considered statistically significant. Vaccines comprising other immunogen(s) as described herein are assayed according to similar method as mentioned above.

Example 1 Isolation of phage infecting the K. pneumoniae 161 IE strain

(capsular type K2)

[0081] The previous study identified a Kl capsule depolymerase (K1-ORF34) from a Kl specific phage NTUH-K2044-K1-1 (Lin TL et al., The Journal of infectious diseases 2014, 210(11): 1734-1744). In order to isolate K2 capsule degrading enzymes, phage infecting K. pneumoniae 161 IE strain (capsular type K2) were isolated from untreated water. Clear plaques with translucent halos were detected and the phage was designated 1611E-K2-1. The sensitivity for capsular type K2 of 1611E-K2-1 phage was evaluated among another 7 capsular type K2 strains whose capsular type was determined by PCR using wzy primers. This phage could infect all strains with capsular type K2.

Example 2 Identification of the putative capsule depolymerases Identification of the putative K2 capsule depolymerase

[0082] The full genome of phage 1611E-K2-1 was determined as 47,797 bp in length. Annotation of the genome sequences showed that this phage was predicted to contain 17 open reading frames (ORFs) of more than 500 bp. Analysis of the ORFs of phage 1611E-K2-1 revealed that predicted ORF16 exhibited 46% amino acid identity with a tailspike 63D sialidase, suggesting that the protein might correspond to a capsule depolymerase. The K2- orfl6 gene was cloned and expressed in E. coli. The purity of purified recombinant K2- ORF16 protein was shown in Figure 1A. Upon spotting on a plate inoculated with K. pneumoniae 161 IE, the recombinant K2-ORF16 protein generated a translucent spot resembling the plaque halo (Figure IB). The CPS were extracted from 161 IE and then treated with K2-ORF16 protein were separated on the SDS-PAGE and stained with alcian blue (Figure 1C). The results demonstrated that the K2-ORF16 protein could digest the K2 CPS. The sensitivity of this enzyme to capsular type K2 was further confirmed in another 7 capsular type K2 strains. The results suggested that the K2-ORF16 protein is a K2 capsule depolymerase.

Identification of the putative K62 capsule depolymerase

[0083] A phage infecting strains with capsular types K10 and K62 was isolated from untreated water, denoted as phage Ref-KlO-1. Two putative capsule depolymerases (ORF5 and ORF6) were identified from analysis of phage genome sequencing. After expression of these two proteins, ORF6 was demonstrated as K62 capsule depolymerase which can generate a translucent spot on the plate inoculated with K62 reference strain.

Example 3 Analysis of K1-ORF34 capsule depolymerase digested CPS

[0084] The structure of K1-ORF34 capsule depolymerase digested CPS was further analyzed. After incubation with purified K1-ORF34 protein, Kl CPS was reduced to oligosaccharides. Separation by size-exclusion chromatography and analysis by mass spectrum and capillary electrophoresis revealed that the majority of oligosaccharides were hexa-saccharides, and ennea-saccharides were minor, that are dimers and trimers of trisaccharides unit (Figure 2A and 2B). From MS-MS analysis of the oligosaccharides with molecular weight in 1145, it showed that glucuronic acid was reduced into a double-bond derivate which was absorbed at 232 nm, and the modifications including pyruvation and acetylation were maintained (Figure 2C). The structure of digested oligosaccharides was assayed by MR spectra (Figure 2D). The K1-ORF34 digested oligosaccharides still could be recognized by anti-Kl antisera (data not shown). Therefore, the K1-ORF34 enzyme belongs to one kind of lyases and could be applied for the development of Kl CPS conjugate vaccine. Example 4 Analysis of capsule depolymerase digested CPS Analysis of K2-ORF16 capsule depolymerase digested CPS

[0085] The structure of K2-ORF16 capsule depolymerase digested K2 CPS was further analyzed. After incubation with purified K2-ORF16 protein, K2 CPS was reduced to oligosaccharides. The spectra result indicated that two oligosaccharide components with different molecular weights (m/z of 703 and 1365) were released after the enzymatic degradation (Figure 3A) and were further examined by ESI-MS/MS analysis (Figures 3B and 3C). Based on the structure of K2 CPS reported previously, the major products of K2- ORF16-digested CPS were tetrasaccharides (one repeat unit) and the minor products were octasaccharides (two repeat units). Therefore, the K2-ORF16 enzyme belongs to one kind of hydrolases and could be applied for the development of K2 CPS conjugate vaccine.

Analysis of K62 capsule depolymerase digested CPS

[0086] The structure of K62 capsule depolymerase digested K62 CPS was further analyzed. After incubation with purified K62 capsule depolymerase, K62 CPS was reduced to oligosaccharides. From the results of MALDI-TOF and MS-MS spectra, the products of digested K62 CPS are two repeated units (decasaccharide) as majority and one repeat unit (pentasaccharide) as minority (Figure 4). From mass analysis, the K62 capsule depolymerase belongs to one kind of hydrolases and could be applied for the development of K62 CPS conjugate vaccine.

[0087] The capsule depolymerase digested CPSs of KN2, K24, K28 and K64 were analyzed according to similar methods as mentioned above.

Example 5 CPS Conjugate Vaccines

[0088] The major sugar chain lengths of Kl, K2, K24, K28, K62 and K64 oligosaccharides for conjugation with CRM197 carrier protein are as follows: hexasaccharide (two repeat units of Kl CPS), tetrasaccharide (one repeat unit of K2 CPS), decasaccharide (two repeat units of K62 CPS), hexasaccharide (one repeat unit of K64 CPS), pentasaccharide (one repeat unit of K24 CPS) and hexasaccharide (one repeat unit of K28 CPS). The epitope ratio was determined by MALDI-TOF mass spectrometry and the amount of glycan was calculated accordingly. As Kl as a representative example, by changing the amount of digested Kl CPS-SH we can have the immunogen ratio from 1 : 1.4 to 1 : 10.2; the detail immunogen ratio for Kl vaccine is shown in the table below. The immunogen ratio was determined by MALDI-TOF mass spectrometry. Ratio {CR 197 : Sugar) Amount of CRM197 |μ§) Amount of Sugar ffigf

1 1 : 1.4

2 1 : 3.0 1288.8

3 1 : 5.1 537.6

4 1 ; 5.8 380.8 42. S

5 1 : 8,4 372.8

6 1 : 9.4 427.2

7 1 : 10,2 277.2

Example 6 Toxicology assay (Kl as a representative example)

[0089] The body weights (Figure 5A) and rectal temperatures (Figure 5B) of mice before and one day after each vaccination of Kl CPS conjugated vaccine were recorded. Sera of mice were collected at one week after 1 ^st , 2 ^nd and 3 ^rd administration of Kl CPS conjugate vaccines and then the liver (ALT) and renal (BUN and creatinine) functions were determined (Figure 5C). These results indicated that side effects were not observed in mice administrated with three doses of Kl CPS conjugate vaccine. The toxicology assays for the CPS of K2, K24, K28, K62 or K64 was conducted according to similar method as mentioned above.

Example 7 Antibody response and serum bactericidal assay

[0090] Sera of mice EVI administrated with Kl or K2 or K62 CPS conjugated vaccine collected for antibody detection and bactericidal assay. The results of dot blotting indicated that antibodies induced by the CPS conjugated vaccines can interact with their original CPS (Figure 6)

[0091] The results of bactericidal assay revealed that sera from Kl CPS conjugated vaccine immunized mice can kill more than 50% Kl bacteria compared to the sera from non- immunized mice even a 1 : 128 dilution of sera was used (the bactericidal titer was 32 to 128). The bactericidal titer to K2 bacteria of sera from mice immunized with K2 CPS conjugated vaccine was 8 to 32. The bactericidal activity to K62 bacteria was detected in 40% sera from mice immunized with K62 CPS conjugated vaccine (the bactericidal titer was 8 to 32). Therefore, the CPS conjugated vaccine can successfully induce production of capsular type specific antibody in mice and the antibody has bactericidal effect.

Example 8 Protection assay

[0092] The immunized mice were also challenged with K. pneumoniae to evaluate if the vaccine has protective effect in vivo. Mice were EVI inoculated with Kl or K2 CPS conjugated vaccine once a week (the control group were given adjuvant only). One week after third vaccination, mice were IP infected with 1 x 10 ⁴ CFU K. pneumoniae NTUH-K2044 or NTUH-A4528. The result of the 30 days after challenging with K. pneumoniae revealed that the survival rate of mice received Kl or K2 CPS conjugated vaccine was significantly higher than those that had received adjuvant only (Figures 7A and B).

[0093] Mice inoculated with the K62 CPS conjugated vaccine which were treated with cyclophosphamide to induce neutropenia were then challenged with 5x l0 ⁶ cfu of K62 bacteria. K62 CPS conjugated vaccine significantly protect immunocompromised mice from subsequent infection of K62 bacteria (Figure 7C).

Example 9 Efficacy of Kl and K2 CPS conjugated divalent vaccines

[0094] Kl and K2 are the prevalent capsular types of K. pneumoniae strains causing invasive infections. Therefore, the protection efficacy of divalent vaccine (mixtures of equal amounts of Kl and K2 CPS conjugated vaccines) was further examined (Figure 8A and 8B). IP infection with 1 x 10 ⁴ CFU of NTUH-K2044 and NTUH-A4528 resulted in 80% and 100% death of adjuvant-received mice, respectively. In contrast, no mortality was observed among divalent vaccine-received mice after IP infection. Thus, divalent vaccination significantly protected the mice from the infection of Kl and K2 K. pneumoniae simultaneously.

Example 10 The structures of K64, K24, K28 and KN2

capsule depolymerase digested CPS

1. K64

[0095] Digested K64 CPS are major in one repeat unit (hexasaccharide) and minor in two repeats (dodecasaccharides). The K64 CPS-cleavage enzyme is to be one kind of lyases because the new double bond signal is shown in the MR spectra of the reaction products. The major K64 fragment MS-MS (Hexasaccharide) is shown in Figure 9.

2. K24

[0096] According to the published K24 CPS structure, it was composed of four hexoses and one hexuronic acid. The spectrum of digested K24 CPS showed that the major product was two-repeat unit oligosaccharide with acetylation modification [m/z 1773, (Hex)8(HexA)2], and the minor one was one-repeat unit oligosaccharide with/without acetylation modification (m/z 907 and 865), indicating that K24 enzyme works as one kind of hydrolase. The major K24 fragment MS-MS (Pentasaccharide) is shown in Figure 10. 3. K28

[0097] From the spectrum of MALDI-TOF, it showed that the digest-KN2 CPS is major in one repeat unit (hexasaccharide). The major K28 fragment MS-MS (Hexasaccharide) is shown in Figure 11.

4. KN2

[0098] K. pneumoniae KN2 belongs to a new capsular type, there was still no publication describing its chemical structure. From the spectrum of MALDI-TOF, it showed that the digest-KN2 CPS is composed of four hexoses and one hexuronic acid (MW 1027). Further, the KN2 enzyme was one kind of hydrolases according to the m/z value of the MALDI-TOF. The m/z 1027 was further analyzed by ESI-MS/MS. The fragments of the MS/MS spectrum confirmed that our speculation was correct. In the near future, the composition and linkages of KN2 CPS by GC-MS will be applied to elucidate the detail chemical structure of KN2 CPS. The MALDI-TOF spectrum of KN2 hydrolase-digested CPS is shown in Figure 12.

Example 11 Comparison Between CPS Vaccine and CPS Conjugated Vaccine

[0099] The induction of anti-CPS antibodies and serum bactericidal activity in mice received Kl crude CPS (2 μg) or Kl CPS conjugated vaccine (2 μg) were compared (Figures 13 A and B). The amounts of anti-Kl antibodies in mice received Kl CPS conjugated vaccine were higher than those in mice received Kl crude CPS. Accordingly, the serum bactericidal activity was also significantly higher in mice received Kl CPS conjugated vaccine.