Login| Sign Up| Help| Contact|

Patent Searching and Data


Title:
LINKER MOLECULE AND USE THEREOF IN METHODS FOR PURIFYING PEPTIDES
Document Type and Number:
WIPO Patent Application WO/2017/129818
Kind Code:
A1
Abstract:
The invention relates to a method for purifying peptides which are produced by solid phase peptide synthesis (SPPS) and corresponding linker molecules for use in said method.

Inventors:
ZITTERBART, Robert (Mendelssohnstrasse 1, Berlin, 10405, DE)
SEITZ, Oliver (Winsstrasse 69, Berlin, 10405, DE)
Application Number:
EP2017/051932
Publication Date:
August 03, 2017
Filing Date:
January 30, 2017
Export Citation:
Click for automatic bibliography generation   Help
Assignee:
HUMBOLDT-UNIVERSITÄT ZU BERLIN (Unter den Linden 6, Berlin, 10099, DE)
International Classes:
C07C243/38; C07C317/18; C07C317/28; C07D207/46; C07K1/00; C07K1/107; C07K1/14; C07K7/08
Foreign References:
US20120270937A12012-10-25
EP2501711B12014-01-08
EP0552368A11993-07-28
EP0552368A11993-07-28
EP2501711B12014-01-08
Other References:
P. G. M. WUTS; T. W. GREENE: "Greene's Protective Groups in Organic Synthesis, 4th ed.", 2007, WILEY, pages: 696 - 926
P. G. M. WUTS; T. W. GREENE: "Greene's Protective Groups in Organic Synthesis, 4th ed.", 2007, WILEY, pages: 435 - 477
F. GUILLIER; D. DRAIN; M. BRADLEY: "Linkers and Cleavage Strategies in Solid-Phase Organic Synthesis and Combinatorial Chemistry", CHEM. REV., vol. 100, 2000, pages 2091 - 2157, XP002248255, DOI: doi:10.1021/cr980040+
A. DIRKSEN; P. DAWSON, BIOCONJUGATE CHEM., vol. 19, 2008, pages 2543 - 2548
J. GUISAN, ENZYME MICROB. TECHNOL., vol. 10, 1988, pages 375
A. BREDIHHIN; U. MÄEORG, TETRAHEDRON, vol. 64, 2008, pages 6788 - 6793
Attorney, Agent or Firm:
BOEHMERT & BOEHMERT (KRAUSS, Jan B, Pettenkoferstrasse 20 - 22 Munich, 80336, DE)
Download PDF:
Claims:
Ansprüche

1. Verbindung der Formel

XrL-X2 (l), wobei

Xi ausgewählt ist aus

wobei jedes R1 und R2 unabhängig voneinander ausgewählt ist aus H oder B, wobei wenigstens

R1 oder R2 B ist, wobei

R3 aus H oder B ausgewählt ist,

wobei B eine säurelabile Amin-Schutzgruppe ist, wobei

- R4 ausgewählt ist aus H, Ci-Ci2-Alkyl oder Aryl, wobei die Aldehyd- oder Ketogruppe durch eine säurelabile Schutzgruppe geschützt vorliegen kann,

L ausgewählt ist aus funktionellen Linkerverbindungen, die unter basischen Bedingungen von X2 nukleophil abspaltbar sind, insbesondere weist L die Form -T-U- auf, wobei

T ein Abstandshalter zwischen Xi und U ist, wobei T insbesondere ausgewählt ist aus substituierte oder unsubstituierte -Ci-Ci2-Alkyl-, insbesondere Ci-C6-Alkyl, insbesondere Cp C3-Alkyl, -R5-C(=0)-NH-R6-, -R5-C(=0)-0-R6-, -R5-C(=0)-0-, -C(=0)-0-R6-, -C(=0)-NH-R6- , -C(=0), -C(=0)-0-, -R5-phenyl-R6-, -R5-phenyl-, -phenyl-R6-, -phenyl-,

wobei R5 und R6 unabhängig voneinander ausgewählte substituierte oder unsubstituierte Ci-Ci2-Alkyle, insbesondere Ci-Ce Alkyle, besonders C1-C3 Alkyle sind, und wobei U der die Spaltung aktivierende Teil der funktionellen Linkerverbindung ist, wobei der aktivierende Teil ausgebildet ist ein bei einer basischen Abspaltung von X2 entstehendes Anion zu stabilisieren,

X2 die Form -Y-Z aufweist, wobei

Y aus -0-C(=0)- oder -S(=0)2- ausgewählt ist, und

Z eine elektronenziehende Fluchtgruppe ist.

2. Verbindung nach Anspruch 1 , wobei

- B ausgewählt ist aus Boc (-C=OOtBu), Trityl (-C(Ph)3), Mmt (-C(Ph)2C6H4OMe), DMT (- C(Ph)(C6H4OMe)2), Cbz (-C=OOCH2Ph), Benzylideneamin (=CPh), Phtalimide (=(CO)2C6H4), p-Toluenesulfonamide (-S02C6H4Me), Benzylamin (-CH2Ph), Acetamide (-COMe), Trifluoracetamid (-COCF3), Dde (l -(4,4-Dimethyl-2,6-dioxocyclohex-l -ylidene)-3-ethyl) und l -(4,4-Dimethyl-2,6-dioxocyclohex-l -ylidene)-3-methylbutyl (ivDde), wobei B insbesondere Boc ist, und/oder die

Acetal- oder Ketalschutzgruppen, ausgewählt sind aus

wobei r 0 bis 12, insbesondere 0, 1 oder 2, ist.

3. Verbindung nach Anspruch 1 oder 2, wobei T ausgewählt ist aus -CrCi2-Alkyl-, -R5-C(=0)-NH- R6-, -R5-C(=0)-0-R6-, -R5-C(=0)-0-, -C(=0)-0-R6-, -C(=0)-NH-R6-, -C(=0)-, -C(=0)-0-, wobei R5 und R6 unabhängig voneinander ausgewählte Ci-C6-Alkyle, insbesondere Ci-C2-Alkyle sind, insbesondere ist T ausgewählt aus -CH2-, -CH2-C(=0)-NH-(CH2)2-, -(CH2)-C(=0)-0-(CH2)2-, - CH2-C(=0)-0-, -C(=0)-0-, -C(=0)-0-(CH2)2-, -C(=0)-, insbesondere -CH2-, -CH2-C(=0)-NH- (CH2)2-, -C(=0)-0-(CH2)2-, -CH2-C(=0)-0-, -C(=0)-.

4. Verbindung nach wenigstens einem der Ansprüche 1 bis 3, wobei U der Verbindung T-U-Y ausgewählt ist aus den Verbindungen nach den Formeln (5), (6), (7), (8), (9), (10) und (1 1), insbesondere aus (5), (6), (8), (9) und (10),

wobei R8 ausgewählt ist aus Ci-C6-Alkyl, CF3, CH2CF3,

insbesondere aus Boc-Lys(Boc)-,

- wobei R7n, R9m, R10^1 , R13r und R14s ausgewählt ist aus Ci-Cö-Alkyl oder -I und/oder -M-Effekte erzeugenden Substituenten, insbesondere Ci-C3-Alkyle, -F, -Cl, -Br, -I, - CN -NO2, -N3, -CF3, -SO3H, -C02H,

wobei n gleich 0, 1, 2, 3 oder 4, insbesondere n ist 0 oder 1 , insbesondere 0, ist wobei m gleich 0, 1, 2 oder 3, insbesondere m ist 0 oder 1, insbesondere 0, ist wobei p gleich 0, 1, 2, 3 oder 4, insbesondere p ist 0 oder 1 , insbesondere 0, ist wobei q gleich 0, 1, 2 oder 3, insbesondere q ist 0 oder 1, insbesondere 0, ist wobei r gleich 0, 1, 2 oder 3, insbesondere r ist 0 oder 1, insbesondere 0, ist wobei s gleich 0, 1, 2 oder 3, insbesondere s ist 0 oder 1, insbesondere 0, ist.

5. Verbindung nach wenigstens einem der Ansprüche 1 bis 4, wobei Z ausgewählt ist aus der Gruppe -F, -Cl, -Br, -I, -N3, -SR12, -OCF3, -OCH2CF3, -OS02CF3, -SO2C6H4CH3, -S02CF3, -S02CH3

insbesondere -ci, insbesondere

oder

wobei R ein Ci-C6-Alkyl-, ein Aryl- oder ein Benzylrest ist.

6. Verbindung nach wenigstens einem der Ansprüche 1 bis 5, wobei Xi eine Verbindung nach Formel (2) oder (3) ist, insbesondere Formel (3), wobei R3 H ist, R1 und R2 eine Boc- Schutzgruppe aufweisen oder R1 H ist und R2 eine Boc-Schutzgruppe ist, wobei insbesondere R1 H ist und R2 eine Boc-Schutzgruppe ist.

7. Verbindung nach wenigstens einem der Ansprüche 1 bis 6, wobei Y die Form -0-C(=0)- aufweist.

8. Verbindung nach wenigstens einem der Ansprüche 1 bis 7,

- wobei T die Form -(CH2)-C(=0)-NH-(CH2)2-, -(CH2)-C(=0)-0-(CH2)2-, -C(=0)-0-(CH2)2- aufweist, insbesondere -C(=0)-0-(CH2)2- und -(CH2)-C(=0)-NH-(CH2)2-, insbesondere- (CH2)-C(=0)-NH-(CH2)2-,

wobei U eine Verbindun nach Formel (5) oder (6) ist, insbesondere nach Formel (6),

9. Verbindung nach wenigstens einem der Ansprüche 1 bis 7,

- wobei T die Form -CH2-C(=0)-0-, -C(=0)-0- aufwei -C(=0)-0-,

wobei U eine Verbindung nach Formel (7) ist, (7), wobei R7 ausgewählt ist Ci-C6-Alkyl oder -I und/oder -M-Effekt erzeugenden Substituenten, insbesondere Ci-C3-Alkyl, -F, -Cl, -Br, -I, -CN -N02, -N3, -CF3, -S03H, -C02H wobei n gleich 0, 1 , 2, 3 oder 4, insbesondere 0 oder 1 , insbesondere 0, ist.

10. Verbindung nach wenigstens einem der Ansprüche 1 bis 7,

wobei T die Form -CH2- aufweist,

wobei U eine Verbindung nach Formel (8) ist,

wobei R8 Boc-Lys(Boc) und r gleich 0 ist.

11. Verbindung nach wenigstens einem der Ansprüche 1 bis 7,

wobei T die Form -CH2-, -(C=0)-, insbesondere -CH2-, aufweist,

wobei U eine Verbindung nach Formel (9) ist, wobei s gleich 0 ist,

12. Verbindung nach wenigstens einem der Ansprüche 1 bis 7,

wobei T die Form -C(=0)- aufweist,

wobei U eine Verbindung nach Formel (10) ist, wobei m gleich 0 ist,

wobei Y die Form -SO2- aufweist, und

wobei Z Cl ist.

13. Verwendung einer Verbindung nach wenigstens einem der Ansprüche 1 bis 12, als Verbindung zwischen der N-terminalen Aminogruppe eines Volllängenpeptids und einer festen Phase.

14. Eine Verbindung der Formel XpL-Y-PEP (12), wobei Xi, L und Y nach dem unabhängigen Anspruch 1 und den abhängigen Ansprüchen von Anspruch 1 definiert ist, und wobei PEP ein Volllängenpeptid umfasst, das über seinen N-Terminus mit X2' verbunden ist.

15. Eine Verbindung der Formel D-Xi'-L-Y-PEP (13),

wobei D ein oberflächenmodifizierter fester Träger ist, der dadurch gekennzeichnet ist, dass die Oberfläche durch synthetische oder natürliche Polymere modifiziert ist, insbesondere modifizierte Polysaccharide, insbesondere Aldehyd- oder Hydrazin-modifizierte Sepharose/Agarose oder Zellulose.

- wobei Xi' die Form -NH-O-, -NH-NH- oder -C(=0)- aufweist,

wobei L, Y und PEP nach Anspruch 12 definiert sind.

16. Verfahren zur Reinigung von Peptiden, insbesondere mittels Festphasenpeptidsynthese (SPPS) hergestellten Peptiden, das die folgenden Schritte umfasst:

i. In-Kontakt-Bringen einer Zusammensetzung eines zu reinigenden Volllängenpeptids und mindestens einer Verunreinigung, insbesondere mindestens einer acetylierten Abbruchsequenz, mit einer Fängerverbindung nach einem der Ansprüche 1 bis 12, und anschließender Reaktion zu einer Verbindung der Formel (12),

ii. Abspaltung der säurelabilen Schutzgruppen durch Zugabe einer Säure,

iii. In-Kontakt-Bringen der Zusammensetzung aus ii. mit einem oberflächenmodifizierten festen Träger, wobei zwischen der Fängerverbindung und dem festen Träger eine kovalente Hydrazon oder Oxim-Bindung ausgebildet wird, und eine Verbindung der Formel (13) bereitgestellt wird,

iv. Abspaltung des Volllängenpeptids vom festen Träger.

17. Verfahren nach Anspruch 16, wobei der feste Träger an seiner Oberfläche die funktionalen Gruppen Aldehyd, insbesondere -0-CH2-CHO, Keton, Hydroxylamin, insbesondere -ONH2, und Hydrazin, insbesondere -N2H3, aufweist.

18. Verfahren nach Anspruch 16, wobei nach oder bei der Abspaltung des Volllängenpeptids vom festen Träger der feste Träger D von dem Rest X'-L der Fängerverbindung abgespalten und der feste Träger regeneriert wird.

Description:
Linkermolekül und Verwendung desselben in Verfahren zur Reinigung von Peptiden

Gebiet der Erfindung

Die vorliegende Erfindung betrifft ein Verfahren zur Reinigung von Peptiden, die durch Festphasenpeptidsynthese (SPPS) hergestellt werden und entsprechende Linkermoleküle zur Verwendung in diesem Verfahren.

Hintergrund und Stand der Technik

Die Festphasenpeptidsynthese ist eine bekannte Methode zur Herstellung von Peptiden. Neben der Synthese der Peptide ist auch deren Reinigung ein wesentlicher Verfahrensschritt.

Eine weit verbreitete Methode zur Reinigung von Peptiden ist die präparative High Performance Liquid Chromatography (HPLC). Nachteilig an dieser Methode ist die schlechte Skalierbarkeit hinsichtlich der gewünschten Produktionsmengen, so dass unterschiedliche Mengen nicht mit ein und derselben Anlage produziert werden können; dieses verursacht relativ hohe Anschaffungskosten der entsprechenden komplexen Geräte. Ein weiterer Nachteil liegt darin, dass die korrekte analytische Bewertung der einzelnen Fraktionen relativ umfangreiche Kenntnisse notwendig macht; hinzu kommt der Verbrauch an Lösungsmitteln und Säulenmaterial (feste Phase) während des Betriebs.

Zur Senkung der Kosten bei der Peptidherstellung wären daher kostengünstigere und weniger störanfällige Methoden von Vorteil.

Die EP 0 552 368 AI beschreibt ein Verfahren zur Reinigung von Peptiden, bei dem ein sogenannter Linker zum einen an das N-terminale Ende des synthetisierten Volllängenpeptids und zum anderen durch Reaktion einer Thiolgruppe mit funktionalisiertem Kieselgur zu Thioether kovalent gebunden wird. Das Volllängenpeptid wird somit immobilisiert und kann gereinigt werden. Anschließend erfolgt die Freisetzung des Volllängenpeptids unter basischen Bedingungen. Das Verfahren ist jedoch nicht für Thiol-enthaltende Peptide geeignet, wie z.B. solche, die die Aminosäure Cystein oder Penicillamin enthalten. Des Weiteren besteht der Nachteil, dass die zur Reinigung verwendete feste Phase (in diesem Fall Kieselgur) nicht zur Wiederverwendung vorgesehen oder geeignet ist.

EP 2 501 711 Bl schlägt ein analoges Verfahren vor, bei dem der Linker zum einen über das N- terminale Ende des synthetisierten Volllängenpeptids und über eine 1,3-dipolare Cycloaddition zwischen einem Azid (-N 3 ) und einem Alkin (Huisgen-Reaktion) an eine feste Phase (synthetisches, hydrophiles Polymer, z.B. PEGA) gebunden wird. Nachteilig an diesem Verfahren ist hier die Notwendigkeit der Zugabe von Kupfer oder Kupfer-haltigen Verbindungen zur Durchführung der 1,3- dipolaren Cycloaddition. Viele Peptide komplexieren Kupfer, insbesondere solche, die Schwefel aufweisen, also Methionin und /oder Cystein enthalten; ebenfalls können Arginine und Lysine Kupfer binden. Das Kupfer lässt sich daher nur schwer wieder entfernen, und aufgrund der Toxizität des verbleibenden Kupfers ist die Methode nicht in allen Fällen anwendbar, insbesondere nicht für die Reinigung von Peptidtherapeutika. Zudem besteht auch hier der Nachteil, dass die zur Reinigung verwendete feste Phase nicht zur Wiederverwendung vorgesehen oder geeignet ist.

Es ist daher Aufgabe der Erfindung, ein Verfahren zur Reinigung von Peptiden bereitzustellen, das keine komplette HPLC-Anlage erfordert und auch für schwefelhaltige oder Kupfer-bindende Peptide geeignet ist. Darüber hinaus ist es Aufgabe der Erfindung, ein zur Reinigung von Peptiden geeignetes Verfahren zur Verfügung zu stellen, das eine Regeneration und Wiederverwendung der zur Reinigung eingesetzten festen Phase ermöglicht. Des Weiteren ist es Aufgabe der Erfindung, eine Verbindung bereitzustellen, die eine Verbindung zwischen der N-terminalen Aminogruppe eines Volllängenpeptids und einer festen Phase ermöglicht.

In einem ersten Aspekt der vorliegenden Erfindung wird diese Aufgabe durch eine Verbindung gelöst, die die allgemeine Formel

Xi-L-X 2 (l) aufweist, wobei

Xi ausgewählt ist aus

wobei jedes R 1 und R 2 unabhängig voneinander ausgewählt ist aus H oder B, wobei wenigstens

R 1 oder R 2 B ist, wobei

R 3 aus H oder B ausgewählt ist,

wobei B eine säurelabile Amin-Schutzgruppe ist, wobei

- R 4 ausgewählt ist aus H, Ci-Ci 2 -Alkyl oder Aryl, wobei die Aldehyd- oder Ketogruppe durch eine säurelabile Schutzgruppe geschützt vorliegen kann,

L ausgewählt ist aus funktionellen Linkerverbindungen, die unter basischen Bedingungen von X 2 nukleophil abspaltbar sind, insbesondere weist L die Form -T-U- auf, wobei

T ein Abstandshalter zwischen Xi und U ist, wobei T insbesondere ausgewählt ist aus substituierte oder unsubstituierte -Ci-Cn-Alkyl-, insbesondere Ci-C6-Alkyl, insbesondere Cp C 3 -Alkyl, -R 5 -C(=0)-NH-R 6 -, -R 5 -C(=0)-0-R 6 -, -C(=0)-0-R 6 -, -C(=0)-NH-R 6 -, -C(=0), -R 5 - phenyl-R 6 -, -R 5 -phenyl-, -phenyl-R 6 -, -phenyl-,

wobei R 5 und R 6 unabhängig voneinander ausgewählte substituierte oder unsubstituierte Ci-Ci 2 -Alkyle, insbesondere Ci-Ce Alkyle, besonders C 1 -C3 Alkyle sind, sind, und wobei U der die Spaltung aktivierende Teil der funktionellen Linkerverbindung ist, wobei der aktivierende Teil ausgebildet ist ein bei einer basischen Abspaltung von X 2 entstehendes Anion zu stabilisieren,

X 2 die Form -Y-Z aufweist, wobei

Y aus -0-C(=0)- oder -S(=0) 2 - ausgewählt ist, und

Z eine elektronenziehende Fluchtgruppe ist.

Im Kontext der vorliegenden Erfindung bezieht sich der Begriff "Spaltung aktivierender Teil" eines Moleküls auf ein strukturelles Element einer reaktiven Funktion.

„Reaktive Funktion" bezieht sich auf eine Verbindung, die zur Generierung einer reaktiven Spezies, angeregt (aktiviert) werden kann. Dies kann zum Beispiel einen Katalysator oder eine pH-Wert- Änderung geschehen. Die reaktive Spezies ist in der Lage, in kurzer Zeit mit einem geeigneten Reaktionspartner eine kovalente Bindung zu bilden, zum Beispiel eine Carbamat-Bindung. Die reaktive Funktion umfasst also Gruppen, die nach ihrer Aktivierung spezifisch mit anderen funktionellen Gruppen, zum Beispiel Amin- oder Amid-, reagieren.

Der Begriff„Abstandshalter" bezieht sich auf eine Verbindung von mehreren Atomen innerhalb eines Moleküls, die selbst frei von reaktiven Funktionen ist und zwei funktionelle Gruppen des Moleküls räumlich trennt. Der Abstandshalter ist eine kovalent verbundene Ketten- oder Ringstruktur bestehend aus Kohlenstoff-, Phosphor-, Schwefel-, Silizium-, Stickstoff- und/oder Sauerstoffatomen. Der Abstandshalter kann substituierende Gruppen enthalten, die nicht zur Distanz zwischen den zu trennenden funktionellen Gruppen beiträgt.

Der Begriff„Gruppierung" bezieht sich auf eine Verbindung von mehreren Atomen innerhalb eines Moleküls. Typischerweise bilden diese Atome funktionelle Einheiten, wie zum Beispiel einen Abstandshalter, eine reaktive Funktion oder eine molekulare Struktur, die einen mesomeren oder induktiven Effekt ausübt.

Die Begriffe „funktionelle Linkerverbindung" oder „Linkerverbindung" bezieht sich auf eine funktionelle Gruppe, das zwei funktionelle Einheiten innerhalb eines Moleküls verbindet. Die Linkerverbindung ist kovalent mit den funktionellen Gruppen verbunden.

Die Begriffe„Linker",„Linkermolekül",„Linkersystem" und„Fängerverbindung" beziehen sich auf ein Molekül, das zwei andere Moleküle durch Ausbildung einer kovalenten Bindung zu dem jeweils anderen Molekül verbindet. Die kovalenten Bindungen zu den funktionellen Gruppen der zwei anderen Moleküle geschehen nur unter bestimmten Reaktionsbedingungen. Insbesondere beziehen sich die Begriffe „Linker", „Linkermolekül", „Linkersystem" und „Fängerverbindung" auf Verbindungen, die unter Formel (1) fallen und eine Verbindung zwischen einem N-Terminus eines Peptids und einem festen Träger herstellen können. Der Begriff„substituiert" bezieht sich auf die Addition eines Atoms oder einer molekularen Gruppe oder Verbindung an eine Stammverbindung. Die substituierende Gruppe oder Verbindung kann geschützt oder ungeschützt addiert werden an eine oder mehrere verfügbare Stellen im Stammmolekül. Die substituierende Gruppe oder Verbindung selbst kann substituiert oder nicht substituiert sein und direkt oder über eine verbindende Gruppe oder Verbindung wie zum Beispiel eine Alkyl-, Amid- oder Hydrocarbonylgruppe mit dem Stammmolekül verbunden sein. Substituierende Gruppen oder Verbindungen umfassen zum Beispiel Halogene, Sauerstoff, Stickstoff, Schwefel, Hydroxyl-, Alkyl-, Alkenyl-, Alkynyl- Carboxyl- (-C(0)OR a ), Acyl-(-C(0)R a )-Gruppen, aliphatische, alicyclische Gruppen, Alkoxy-, Amino ((-N(R b )(R c )), Imino-(=NR b ), Amido-(- C(0)N(R b )(R c ) oder -N(R b )C(0)R a ) Gruppen, Hydrazinderivate (-C(NH)NR a R b ), Triazole, Tetrazole (CN 4 H 2 ), Azido- (-N 3 ), Nitro (-N0 2 ), Cyano (-CN), Isocyano (-NC), Cyanato (-OCN), Isocyanato- (- NCO), Thiocyanato- (-SCN); Isothio-cyanato- (-NCS); Carbamido- (-OC(0)N(R b )(R c ) oder -(R b )C(0)OR a ) Gruppen, Thiole (-SR b ), Sulfmyl- (-S(0)R b ), Sulfonyl- (-S(0) 2 R b ), Sulfonamidyl- (-S(0) 2 N(R b )(R c ) oder -N(R b )S(0) 2 R b ) Gruppen und fluorinierte Verbindungen wie zum Beispiel - CF 3 , -OCF 3 , -SCF 3 , -SOCF 3 or -S0 2 CF 3 . R a , R b and R c ist unabhängig voneinander H oder eine weitere substituierende Gruppe.

Der Begriff "Alkyl" bezieht sich auf eine gesättigte gerade oder verzweigte Kohlenwasserstoffkette mit bis zu 12 Kohlenstoffatomen. Beispiele für bevorzugte Alkylgruppen sind Methyl-, Ethyl-, Propyl- , Butyl-, Isopropyl-, n-Hexyl-, Oktyl-, Decyl-Gruppen.

Der Begriff "Aryl" bezieht sich auf eine Kohlenwasserstoffverbindung mit alternierenden Doppel- und Einfachbindungen zwischen den Kohlenstoffatomen, wobei eine Ringstruktur gebildet wird.

Der Begriff„Fluchtgruppe" bezieht sich auf eine funktionelle Gruppe innerhalb eines Moleküls, die einen -M und/oder -I-Effekt ausübt und sich dadurch leicht abspalten lässt, wobei das bindende Elektronenpaar nach der Spaltung bei der Fluchtgruppe verbleibt.

Der Begriff„oberflächenmodifizierter fester Träger" bezieht sich auf eine feste Struktur, wie zum Beispiel Sepharose-, Agarose- oder Zelluloseeinheiten, Kieselgel oder Polydextrane, die durch synthetische oder natürliche Polymere wie zum Beispiel Polysaccharide, Polylysin, Polyarylamid, Polyethylenglykol (PEG) oder Acrylamid-PEG-Kopolymere modifiziert sind. Die Oberfläche des festen Trägers ist durch Aldehyd-, Keton-, Hydroxylamin- oder Hydrazingruppen charakterisiert.

In einigen Ausführungsformen ist Z eine elektronenziehende Fluchtgruppe, die einen -M und/oder -I- Effekt ausübt, und bei einem heterolytischen Bindungsbruch das bindende Elektronenpaar mitnimmt.

In einigen Ausführungsformen ist Z eine elektronenziehende Fluchtgruppe, wobei die zum Anion der Fluchtgruppe korrespondierende Säure durch einen pks-Wert von kleiner als fünf charakterisiert ist.

In einigen Ausführungsformen ist Z eine elektronenziehende Fluchtgruppe, wobei die zum Anion der Fluchtgruppe korrespondierende Säure durch einen pks-Wert von kleiner als fünf charakterisiert ist, und wobei die Fluchtgruppe insbesondere einen -M und/oder -I-Effekt ausübt, und bei einem heterolytischen Bindungsbruch das bindende Elektronenpaar mitnimmt.

In einigen Ausführungsformen ist U der die Spaltung aktivierende Teil der funktionellen Linkerverbindung, wobei der aktivierende Teil eine Gruppierung darstellt, die durch -M und -I Effekte eine Anionenbildung ermöglicht, sowie die entstandene anionische Verbindung durch eine Elektronenpaarverschiebung stabilisiert, wobei diese Stabilisierung zu einem heterolytischen Bindungsbruch zwischen U und X 2 führt.

In einigen Ausführungsformen ist B ausgewählt aus Boc (-C=OOtBu), Trityl (-C(Ph) 3 ), Mmt (- C(Ph) 2 C 6 H 4 OMe), DMT (-C(Ph)(C 6 H 4 OMe) 2 ), Cbz (-C=OOCH 2 Ph), Benzylideneamin (=CPh), Phtalimide (=(CO) 2 C 6 H 4 ), p-Toluenesulfonamide (-SC^CeFLMe), Benzylamin (-CH 2 Ph), Acetamide (- COMe), Trifluoracetamid (-COCF 3 ), Dde (l-(4,4-Dimethyl-2,6-dioxocyclohex-l-ylidene)-3-ethyl) und l-(4,4-Dimethyl-2,6-dioxocyclohex-l-ylidene)-3-methylbutyl (ivDde), wobei B insbesondere Boc ist.

In einigen Ausführungsformen sind die Acetal- oder Ketalschutzgruppen ausgewählt aus

,wobei r 0 bis 12, insbesondere 0, 1 oder 2, ist.

Dem Fachmann ist bekannt, dass die erfindungsgemäße Verbindung auch mit anderen säurelabilen Schutzgruppen gebildet werden kann.

In einigen Ausführungsformen ist T ausgewählt aus substituiertem oder unsubstituiertem C 1 -C 12 - Alkyl-,-, insbesondere C r C 6 -Alkyl, insbesondere C r C 3 -Alkyl, -R 5 -C(=0)-NH-R 6 -, -R 5 -C(=0)-0-R 6 -, -R 5 -C(=0)-0-, -C(=0)-0-R 6 -, -C(=0)-NH-R 6 -, -C(=0)-, -C(=0)-0-, wobei R 5 und R 6 unabhängig voneinander ausgewählte substituierte oder unsubstituierte insbesondere Ci-Cö-Alkyle, insbesondere Ci-C3-Alkyle sind.

Wenn T ein substituiertes Alkyl ist, sind die Substituenten insbesondere solche, die die Wasserlöslichkeit erhöhen, zum Beispiel -SO 3 H, -CO 2 H oder -NO 2 .

In einigen Ausführungsformen ist T ausgewählt aus -CH 2 -, -CH 2 -C(=0)-NH-(CH 2 ) 2 -, -(CH 2 )-C(=0)- 0-(CH 2 ) 2 -, -CH 2 -C(=0)-0-, -C(=0)-0-, -C(=0)-0-(CH 2 ) 2 -, und -C(=0)-.

In einigen Ausführungsformen ist T ausgewählt aus -CH 2 -, -CH 2 -C(=0)-NH-(CH 2 ) 2 -, -C(=0)-0- (CH 2 ) 2 -, -CH 2 -C(=0)-0-, und -C(=0)-. In einigen Ausführangsformen ist U der Verbindung T-U-Y ausgewählt aus den Verbindungen nach

(10),

Lys(Boc)-,

wobei R 7 n , R 9 m , R 10 p , R u q , R 13 r und R 14 s ausgewählt ist aus C r C 6 -Alkyl oder -I und/oder -M-Effekt erzeugenden Substituenten, insbesondere Ci-C 3 -Alkyle, -F, -Cl, -Br, -I, -CN -N0 2 , -N 3 , -CF 3 , -S0 3 H, - und C0 2 H,

- wobei n gleich 0, 1 , 2, 3 oder 4, insbesondere n ist 0 oder 1, insbesondere 0, ist

- wobei m gleich 0, 1 , 2 oder 3, insbesondere m ist 0 oder 1 , insbesondere 0, ist

- wobei p gleich 0, 1 , 2, 3 oder 4, insbesondere p ist 0 oder 1 , insbesondere 0, ist

- wobei q gleich 0, 1 , 2 oder 3, insbesondere q ist 0 oder 1 , insbesondere 0, ist

- wobei r gleich 0, 1 , 2 oder 3, insbesondere r ist 0 oder 1 , insbesondere 0, ist

- wobei s gleich 0, 1 , 2 oder 3, insbesondere s ist 0 oder 1 , insbesondere 0, ist. In einigen Ausführangsformen ist R 7 n , R 9 m , R 10 p , R u q , R 13 r und R 14 s ausgewählt aus Ci-Cö-Alkyl oder - I und/oder -M-Effekte erzeugenden Substituenten, insbesondere Ci-C 3 -Alkyle, -F, -Cl, -Br, -I, -CN - N0 2 , -N 3 , -CF 3 , -SO 3 H, und -C0 2 H, insbesondere -F, -Cl, -Br, -I, -N0 2 , und -N 3

- wobei n gleich 0, 1, 2, 3 oder 4, insbesondere n ist 0 oder 1, insbesondere 0, ist

- wobei m gleich 0, 1, 2 oder 3, insbesondere m ist 0 oder 1, insbesondere 0, ist

- wobei p gleich 0, 1, 2, 3 oder 4, insbesondere p ist 0 oder 1 , insbesondere 0, ist

- wobei q gleich 0, 1, 2 oder 3, insbesondere q ist 0 oder 1, insbesondere 0, ist

- wobei r gleich 0, 1, 2 oder 3, insbesondere r ist 0 oder 1, insbesondere 0, ist

- wobei s gleich 0, 1, 2 oder 3, insbesondere s ist 0 oder 1, insbesondere 0, ist.

In einigen Ausführangsformen ist R 7 n , R 9 m , R 10 p , R u q , R 13 r und R 14 s ausgewählt aus die Wasserlöslichkeit erhöhende Substituenten, insbesondere aus -NO 2 , -SO 3 H und -CO 2 H.

In einigen Ausführangsformen ist Z ausgewählt aus der Gruppe -F, -Cl, -Br, -I, -N 3 , -SR 12 , -OCF 3 , - OCH 2 CF 3 , -OSO 2 CF3, -SO 2 C6H 4 CH3, -SO 2 CF3, -SO 2 CH3

wobei R ein C C 6 -Alkyl-, ein Aryl- oder ein Benzylrest ist.

In einigen Ausführangsformen ist Z ausgewählt aus -Cl,

, insbesondere aus und

In einigen Ausführangsformen ist Xi eine Verbindung nach Formel (2) oder (3), wobei R 3 H ist, R 1 und R 2 eine Boc-Schutzgrappe aufweisen oder R 1 H ist und R 2 eine Boc-Schutzgrappe ist.

In einigen Ausführangsformen ist Xi eine Verbindung nach Formel (3), wobei R 1 und R 3 H ist und R 2 eine Boc-Schutzgrappe ist.

In einigen Ausführangsformen weist Y die Form -0-C(=0)- auf.

In einigen Ausführungsformen weist T die Form -CH 2 -C(=0)-NH-(CH 2 ) 2 -, -CH 2 -C(=0)-0-(CH 2 ) 2 -, - C(=0)-0-(CH 2 ) 2 - auf und U ist eine Verbindung nach Formel (5) oder (6),

In einigen Ausführangsformen weist T die Form -C(=0)-0-(CH 2 ) 2 - oder -CH 2 -C(=0)-NH-(CH 2 ) 2 - auf und U ist eine Verbindung nach Formel (6).

In einigen Ausführangsformen weist T die Form -C(=0)-0-(CH 2 ) 2 - oder -CH 2 -C(=0)-NH-(CH 2 ) 2 - auf und U ist eine Verbindung nach Formel (6).

In einigen Ausführangsformen weist T die Form -CH 2 -C(=0)-NH-(CH 2 ) 2 - auf und U ist eine Verbindung nach Formel (6).

In einigen Ausführangsformen weist T die Form -CH 2 -C(=0)-0- oder -C(=0)-0- auf und U ist eine Verbindung nach Formel (7),

wobei R 7 ausgewählt ist aus Ci-C6-Alkyl oder -I und/oder -M-Effekte erzeugenden Substituenten, insbesondere C r C 3 -Alkyl, -F, -Cl, -Br, -I, -CN -N0 2 , -N 3 , -CF 3 , -S0 3 H, und -C0 2 H, wobei n gleich 0, 1, 2, 3 oder 4, insbesondere 0 oder 1 , insbesondere 0, ist.

In einigen Ausführangsformen weist T die Form -CH 2 -C(=0)-0- auf, und U ist eine Verbindung nach Formel (7), wobei n gleich 0 ist.

In einigen Ausführangsformen weist T die Form -CH 2 - auf, und U ist eine Verbindung nach Formel

(8),

(8), wobei R 8 Boc-Lys(Boc)- und und r gleich 0 ist.

In einigen Ausführangsformen weist T die Form -CH 2 - oder -(C=0)- auf, und U ist eine Verbindung nach Formel (9),

(9), wobei s gleich

In einigen Ausführangsformen weist T die Form -CH 2 - auf, und U ist eine Verbindung nach Formel In einigen Ausführangsformen weist T die Form -C(=0)- auf, und U ist eine Verbindung nach Formel (10),

wobei m gleich 0 ist, Y die Form -SO 2 - aufweist und Z Cl ist.

In einigen Ausführangsformen ist die Verbindung nach Formel (1) ausgewählt aus 2,2- Dimethylpropanoyloxy-[2-[2-[2-(4-nitrophenoxy)carbonyloxypro pylsulfonyl]ethylamino]-2-oxo- ethoxy]amino] 2,2-dimethylpropanoat (Formel (14)), [[2-[2-[2-(4-Nitrophenoxy) carbonyloxypropylsulfonyl]ethylamino]-2-oxoethoxy]amino] 2,2-dimethylpropanoat (Formel (15)), [2-(4-Chlorsulfonyl-3-nitrobenzoyl)hydrazino] 2,2-dimethylpropanoat (Formel (16)), [2,2- Dimethylpropanoyloxy-[2-[4-[(2,5-dioxopyrrolidin-l-yl)oxycar bonyloxymethyl]phenoxy]-2-oxo- ethoxy]amino] 2,2-dimethylpropanoat (Formel (17)), [2-(2,2-Dimethylpropanoyloxy)-2-[2-[2-[2-(2,5- dioxopyrrolidin-l-yl)oxycarbonyloxypropylsulfonyl]ethylamino ]-2-oxo-ethyl]hydrazino] 2,2- dimethylpropanoat (Formel (18)), [2-(2,2-Dimethylpropanoyloxy)-2-[2-[2-[2-(2,5-dioxopyrrolidi n-l- yl)oxycarbonyloxyethylsulfonyl]ethylamino]-2-oxo-ethyl]hydra zino] 2,2-dimethylpropanoat (Formel (19)), [2-[5-Azido-2-[(2,5-dioxopyrrolidin-l-yl)oxycarbonyloxymethy l]benzoyl]hydrazino] 2,2- dimethylpropanoat (Formel (20)), [3-[(2,2-Dimethylpropanoyloxyamino)carbamoyl]-4-[(2,5- dioxopyrro lidin- 1 -yl)oxycarbonyloxymethyl]phenyl] 2,6-bis(2,2-dimethylpropanoyloxyamino) hexanoat (Formel (21)), [2-[2-[2-[2-(4-Nitrophenoxy)carbonyloxypropylsulfonyl]ethyla mino]-2-oxo- ethyljhydrazino] 2,2-dimethylpropanoat (Formel (22)), [2-[2-[2-[2-(2,5-Dioxopyrrolidin-l-yl) oxycarbonyloxy-propylsulfonyl]ethylamino]-2-oxo-ethyl]hydraz ino] 2,2-dimethylpropanoat (Formel (23)), [2-[2-[4-[(2,5-Dioxopyrrolidin-l-yl)oxycarbonyloxymethyl]phe noxy]-2-oxo-ethyl]hydrazino] 2,2-dimethyl-propanoat (Formel (24)), [2-[2-[2-(4-Nitrophenoxy)carbonyloxyethylsulfonyl] ethoxycarbonyl] hydrazino] 2,2-dimethylpropanoat (Formel (25)), [3-[[2-(2,2-

Dimethylpropanoyloxy)hydrazino]methyl]-4-[(2,5-dioxopyrro lidin-l -yl)oxycarbonyloxymethyl] phenyl] 2,6-bis(2,2-dimethylpropanoyloxyamino)hexanoat (Formel (26)), [2-[[5-Azido-2-[(2,5- dioxopyrro lidin- 1 -yl)oxycarbonyloxymethyl]phenyl]methyl]hydrazino] 2,2-dimethylpropanoat (Formel (27)),

Boc (14),

(19), 11

In einigen Ausführangsformen ist die Verbindung nach Formel (1) ausgewählt aus einer Verbindung nach Formel (14), (15), (16), (17), (18), (19), (20) und (21 ).

In einigen Ausführungsformen ist die Verbindung nach Formel (1) ausgewählt aus einer Verbindung nach Formel (16), (19), (20) und (21).

In einem weiteren Aspekt wird die Aufgabe der Erfindung durch die Verwendung einer Verbindung nach dem ersten Aspekt gelöst, die eine Verbindung zwischen der N-terminalen Aminogruppe eines Volllängenpeptids und einer festen Phase bildet.

In einem weiteren Aspekt wird die Aufgabe der Erfindung durch eine Verbindung der Formel (12), Xi-L-Y-PEP (12), gelöst, wobei Xi, L und Y durch den ersten Aspekt und seine Ausführungsformen definiert sind, und wobei PEP ein Volllängenpeptid umfasst, das über seinen N-Terminus mit X 2 ' verbunden ist.

In einem weiteren Aspekt wird die Aufgabe der Erfindung durch eine Verbindung der Formel (13), D- Xi'-L-Y-PEP (13), gelöst, wobei D ein oberflächenmodifizierter fester Träger ist, der dadurch gekennzeichnet ist, dass die Oberfläche durch synthetische oder natürliche Polymere modifiziert ist, wobei Xi' die Form -NH-O-, -NH-NH- oder -C(=0)- aufweist und wobei L, Y und PEP durch den ersten Aspekt und seine Ausführungsformen definiert sind.

In einigen Ausführungsformen ist der oberflächenmodifizierte feste Träger D durch modifizierte Polysaccharide charakterisiert.

In einigen Ausführungsformen ist der oberflächenmodifizierte feste Träger D durch Aldehyd- oder Hydrazin-modifizierte Sepharose/Agarose oder Zellulose charakterisiert.

In einem weiteren Aspekt wird die Aufgabe der Erfindung durch ein Verfahren zur Reinigung von Peptiden gelöst, insbesondere von mittels Festphasenpeptidsynthese (SPPS) hergestellten Peptiden, das die folgenden Schritte umfasst:

i. In-Kontakt-Bringen einer Zusammensetzung eines zu reinigenden Volllängenpeptids und mindestens einer Verunreinigung, insbesondere mindestens einer acetylierten Abbruchsequenz, mit einer Fängerverbindung, die durch den ersten Aspekt und seine Ausführungsformen definiert ist, und anschließender Reaktion zu einer Verbindung der Formel (12),

ii. Abspaltung der säurelabilen Schutzgruppen durch Zugabe einer Säure,

iii. In-Kontakt-Bringen der Zusammensetzung aus ii. mit einem oberflächenmodifizierten festen Träger, wobei zwischen der Fängerverbindung und dem festen Träger eine kovalente Hydrazon- oder Oxim-Bindung ausgebildet wird, und eine Verbindung der Formel (13) bereitgestellt wird,

iv. Abspaltung des Volllängenpeptids vom festen Träger. In einigen Ausführungsformen umfasst Schritt i. das In-Kontakt-Bringen einer Mischung von Volllängenpeptid und Abbruchsequenzen, die sich noch an der festen Phase (dem Syntheseharz) befinden, mit einer Verbindung (Fängermolekül) der allgemeinen Formel Xi-L-X 2 wobei Xi, X 2 und L wie oben definiert sind und wobei der Schritt des in-Kontakt-Bringens zu einer Reaktion der Verbindung X 1 -L-X 2 an X 2 mit der freien N-terminalen Aminogruppe des Volllängenpeptids unter Ausbildung einer kovalenten Bindung führt. Die Abspaltung der Peptide von der festen Phase (Syntheseharz) erfolgt mittels Säuren, wodurch eine Mischung von Volllängenpeptid, das mit dem Fängermolekül kovalent verbunden ist und acetylierten Abbruchsequenzen von Peptiden aus einer Festphasen-Peptidsynthese (SPPS) erhalten wird. Die Trennung der festen und flüssigen Phase erfolgt z.B. durch Filtration. Die nicht-peptidischen Verunreinigungen werden durch Fällung in Ether bei einer Temperatur von -78 °C bis 0 °C entfernt. Vorzugsweise wird die Säuremischung dabei in den vorgelegten Ether gegeben, wobei alles peptidische Material ausfällt und organische Verunreinigungen im Ether verbleiben. Anschließend erfolgt eine Trennung der etherischen Lösung von der Peptidmischung z.B. durch Zentrifugation. Die Peptidmischung wird als amorpher Feststoff erhalten.

In einigen Ausführungsformen umfasst Schritt ii. die Aufnahme des amorphen Feststoffs aus Schritt i) in einer zumindest teilweise wässrigen Pufferlösung bei einem pH- Wert zwischen 2 und 4, bevorzugt zwischen 2,5 und 3,5 besonders bevorzugt bei 3. Die Einstellung des pH- Wertes erfolgt dabei geeignet durch Zugabe von Säuren oder Basen.

In einigen Ausführungsformen umfasst Schritt iii. das In-Kontakt-Bringen der Mischung aus ii) mit einem Oberflächen-modifizierten festen Träger (Reinigungsharz), zwecks kovalenter Anbindung der mit dem Fängermolekül (Schritt i) modifizierten Volllängenpeptide über die Bildung einer Hydrazon oder Oxim-Bindung. Besonders vorteilhaft ist hier die Zugabe von Aminen und/oder Essigsäure als Katalysator zur Verbesserung der Kinetik der Anbindungsreaktion.

Die nicht über die Hydrazon/Oxim-Bindung an den festen Träger gebundenen peptidischen Abbruchsequenzen werden durch Waschen mit organischen Lösungsmitteln und/oder mit Wasser und wässriger Pufferlösung, vorzugsweise unter Zusatz von chaotropen Stoffen, um eventuell nicht kovalent gebundene Peptide zu lösen, entfernt.

In einigen Ausführungsformen umfasst Schritt iv. die Abtrennung der Volllängenpeptide von der festen Phase durch Spaltung des Linkers L von Y unter basischen (nukleophilen) Bedingungen, wobei Y in Form von CO 2 oder SO 2 freigesetzt wird.

Bei der Abspaltung des Volllängenpeptids ausgehend von der Formel (13) (D-Xi'-L-Y-PEP), entstehen das Volllängenpeptid (PEP), C0 2 oder S0 2 (Υ') und D-Xi'-L oder D' und Xi'-L'.

In einigen Ausführungsformen weist der feste Träger an seiner Oberfläche die funktionalen Gruppen Aldehyd, Keton, Hydroxylamin und Hydrazin auf. In einigen Ausführungsformen weist der feste Träger an seiner Oberfläche die funktionale Gruppe -O-

In einigen Ausführungsformen weist der feste Träger an seiner Oberfläche die funktionalen Gruppen - ONH 2 oder -N 2 H 3 auf.

In einigen Ausführungsformen wird die feste Phase von den gewünschten Volllängenpeptiden durch Filtration getrennt; die feste Phase (Reinigungsharz, D) wird durch Behandlung mit Hydrazin (H 4 N 2 ) und/oder Ammoniumhydroxid H 4 NOH und/oder Aldehyden und/oder Ketonen und/oder Waschen mit Wasser regeneriert.

Zur Abspaltung der Peptide vom Syntheseharz (Schritt i) werden Säuren verwendet, bevorzugt sind hier organische und anorganische Säuren, die einen pks Wert unter 4 besitzen. Besonders geeignet sind Säuren ausgewählt aus der Gruppe der fluorhaltigen Säuren: Trifluoressigsäure (TFA), Flussäure (HF) und Triflourmethansulfonsäure. Außerdem geeignet sind Bromwasserstoffsäure (HBr), Chlorwasserstoffsäure (HCl), Schweflige Säure (H 2 SO 3 ), Schwefelsäure (H 2 SO 4 ), Phosphorsäure (H 3 PO 4 ), Salpetersäure (HNO 3 ) oder Methansulfonsäure.

Zur Fällung in Schritt i) werden organische Lösungsmittel verwendet die bei den Fällungstemperaturen in flüssiger Form vorliegen, solche Lösungsmittel sind dem Fachmann allgemein bekannt. Bevorzugt werden organische Lösungsmittel aus der Gruppe der Ether, besonders bevorzugt sind Diethylether und/oder Methyl-tert-butylether. Auch Alkane, die bei den Fällungstemperaturen in flüssiger Form vorliegen, können verwendet werden, wobei n-Hexan und oder n-Pentan besonders bevorzugt sind. Geeignete, zumindest teilweise wässrige, Pufferlösungen, die in Schritt ii) Anwendung finden sind dem Fachmann bekannt, nämlich Puffer, die im pH Bereich 2-5 eine Pufferkapazität aufweisen, somit Puffer mit den Anionen: Citrat, Malat, Format, Lactat, Succinat, Acetat, Pivalat, und Phosphat in Kombination mit den Kationen: Natrium, Kalium, Ammonium (NH 4 , NMe 4 , NEt 4 , NPr 4 , NBIL,, HNC 5 H 5 ).

Zur Einstellung des pH- Wertes können organische oder anorganische Säuren, bevorzugt HCl und als Basen bevorzugt Alkali- und/oder Erdalkali-Hydroxide, besonders bevorzugt NaOH und/oder KOH, verwendet werden.

Zur besseren Löslichkeit des Peptids kann es in Schritt ii) vorteilhaft sein, dem System mit Wasser mischbare organische Lösungsmittel zuzugeben, solche Lösungsmittel sind dem Fachmann allgemein bekannt und können ausgewählt sein aus der Gruppe: Dimethylformamid (DMF), Acetonitril. Tetrahydrofuran (THF), Dioxan, Pyridin, Aceton, Dimethylsulfoxid (DMSO), Methanol, Ethanol, 1- Propanol, 2-Propanol, 1-Butanol, Formamid, N -Methylpyrolidon (NMP).

Zur Beschleunigung der Immobilisierung in Schritt iii) können der wässrigen Lösung Amine und/oder Essigsäure zugegeben werden. Amine können dabei ausgewählt sein aus der Gruppe bestehend aus: Pyridin, Piperidin, Methylamin, Ethylamin, Propylamin, Butylamin, Anilin und Dimethylamin. Als oberflächenmodifizierter fester Träger (Reinigungsharz) in Schritt iii) kommen synthetische und natürliche Polymere in Frage. Die Oberflächenmodifizierung ist dabei derart, dass sie mit Xi zu Hydrazonen oder Oximen reagiert. Ist Xi eine Verbindung gemäß Formel (2) oder (3), so besteht die Oberflächenmodifizierung in aldehydischen oder ketonischen Gruppen, welche dann entsprechend zu Hydrazonen oder Oximen reagieren. Ist Xi eine Aldehyd- oder Ketonfunktion der allgemeinen Formel (4), so sollte die Oberflächenmodifizierung -ONH 2 , oder -N 2 H 3 , aufweisen. Bevorzugt als feste Träger sind oberflächenmodifizierte natürliche oder auch Biopolymere, besonders bevorzugt oberflächenmodifizierte Polysacharide. Ganz besonders bevorzugt ist die Verwendung von aldehydmodifizierter Sepharose/Agarose, sowie Cellulose, wobei Xi eine Verbindung nach Formel (3) ist, wobei R 1 und R 3 H sind.

Im Schritt iii. (Waschen der an das Reinigungsharz gebundenen Volllängenpeptide) kann mit Wasser, wässrigen Waschlösungen oder organischen Lösungsmitteln gewaschen werden. Als chaotrope Stoffe zu der wässrigen Waschlösung in Schritt iii. sind geeignet: Bariumsalze, Guadiniumhydrochlorid, Guadiniumthiocyanate, Thiocyanate, Perchlorate, Jodide, Butanol, Phenol, Thioharnstoff, Harnstoff, oder Ammoniumsulfat. Lösungsmittel können ausgewählt sein aus der Gruppe von: Dichlormethan (DCM), Trichlormethan, Tetrachlorkohlenstoff, Ethylacetat, Diethylether, Methyl-tert-butylether, Essigsäure, 2,2,2-Trifluorethanol, Hexafluorisopropanol, Dimethylformamid (DMF), Acetonitril. Tetrahydrofuran (THF), Dioxan, Pyridin, Aceton, Dimethylsulfoxid (DMSO), Methanol, Ethanol, 1 - Propanol, 2-Propanol, 1 -Butanol, Phenol, Formamid und N-Methylpyrolidon (NMP).

Die Spaltung in Schritt iv. erfolgt durch Basen in wässrigen Lösungen oder organischen Lösungsmitteln, die Peptide lösen. Basen können ausgewählt sein aus der Gruppe von: LiOH, NaOH, KOH, Ammonium (NH 4 , NMe 4 , NEt 4 , NPr 4 , NBIL,, HNEt(iPr) 2 , HNMe 3 , HNEt 3 , HNPr 3 , HNBu 3 , HNC 5 H 5 ) hydroxide, Piperidin, Methylamin, Ethylamin, Propylamin, Butylamin, Hydrazin, Hydroxylamin, Methylhydrazin und O-Methylhydroxylamin. Organischen Lösungsmitteln, die Peptide lösen, können ausgewählt sein aus der Gruppe von: Dimethylformamid (DMF), Acetonitril. Tetrahydrofuran (THF), Dioxan, Pyridin, Aceton, Dimethylsulfoxid (DMSO), Methanol, Ethanol, 1 - Propanol, 2-Propanol und 1 -Butanol.

Die Filtration in Schritt iv) erfolgt bevorzugt mittels handelsüblichen Spritzenreaktoren oder Filtersystemen. Die Filterlochgrößen sollten zwischen 10 bis 100 μιη liegen.

In einigen Ausführungen wird nach oder bei der Abspaltung des Volllängenpeptids vom festen Träger der feste Träger D von dem Rest X'-L der Fängerverbindung abgespalten und der feste Träger regeneriert.

Ein besonderer Vorteil der erfindungsgemäßen Methode liegt in der Reversibilität der Hydrazon- sowie Oximbindung.

Das hier beschriebene Verfahren kann durch die Gleichgewichtsnatur der Hydrazon/Oximbindung wie eine Affinitätschromatographie benutzt werden. Nach dem Aus- oder Wegwaschen der Verunreinigungen und der Spaltung des basenlabilen Linkers und somit Erhalt des Zielpeptides kann das Reinigungsharz wieder regeneriert werden und ist somit für eine weitere Reinigung zugänglich. Befindet sich an der Oberfläche des Reinigungsharzes ursprünglich Aldehyd- oder Ketogruppen, stellt Waschen mit saurer wässriger Lösung in der Aldehyde oder Ketone gelöst sind die Aldehyd oder Keton Funktion wieder her. Befindet sich an der Oberfläche des Reinigungsharzes ursprünglich Hydrazin oder Hydroxylaminderivate, stellt Waschen mit saurer wässriger Lösung mit Hydrazin oder Hydroxylamin die Hydrazin oder Hydroxylaminfunktion wieder her. Es wird dasselbe Material wie bei der Protein- Aufreinigung mittels Affinitätschromatographie verwendet, Sepharose/ Agarose.

Des Weiteren lässt sich das Verfahren auf Cellulose übertragen, welches das häufigste Biomaterial auf der Erde darstellt und somit kostengünstig verfügbar ist.

Proteine werden standardmäßig über Affinitätschromatographie aufgereinigt, und diese Methode ist auch im Vergleich zur HPLC Reinigung sehr kostengünstig und effizient, sowie skalierbar. Durch die niedrigen Drücke und höheren Beladungsdichten ist die Affinitätschromatographie auch viel besser für große Synthesemengen geeignet als die HPLC.

In einem Unteraspekt des 1. Aspekts der vorliegenden Erfindung wird die Aufgabe durch eine Verbindung gelöst, die als Linker eine Verbindung zwischen der N-terminalen Aminogruppe eines Volllängenpeptids und einer festen Phase herstellt. Die erfindungsgemäße Verbindung weist die allgemeine Formel

X r L-X 2

auf, wobei

Xi ausgewählt ist aus worin Yi = O, N und wobei Ri und R 2 gleich oder verschieden sein können und Ri und R 2 H oder B ist, wobei B eine nicht basenlabile Schutzgruppe für eine Aminogruppe ist, die unter sauren Bedingungen Amine liefert.

In einer bevorzugten Ausführungsform ist B ausgewählt aus der Gruppe: Boc (-C=OOtBu), Trityl (- C(Ph) 3 ), Mmt (-C(Ph) 2 C 6 H 4 OMe), DMT (-C(Ph)(C 6 H 4 OMe) 2 ), Cbz (-C=OOCH 2 Ph), Benzylidenamin (=CPh), Phtalimid (=(CO) 2 C 6 H 4 ), p-Toluolsulfonamid (-S0 2 C 6 H 4 Me), Benzylamin (-CH 2 Ph), Acetamid (-COMe), Trifluoracetamid (-COCF 3 ), Dde (l-(4,4-Dimethyl-2,6-dioxocyclohex -1-yliden )-3-ethyl) und l-(4,4-Dimethyl-2,6-dioxocyclohex-lyliden)-3-methylbutyl (ivDde).

Dem Fachmann sind weiter Schutzgruppen aus P. G. M. Wuts, T. W. Greene, Greene's Protective Groups in Organic Synthesis, 4th ed., Wiley, 2007, Seite 696-926 bekannt.

Xi kann alternativ sein, wobei R 3 = H ist, oder eine gesättigte oder ungesättigte, verzweigte oder nicht verzweigte, substituierte oder nicht substituierte aliphatische oder aromatische Kette einer Länge von bis zu 12 Kohlenstoffatomen ist und wobei die Aldehyd-, oder Keto-Gruppe in einer dem Fachmann bekannten Art und Weise geschützt vorliegen kann

wobei n zwischen 0 und 12 sein kann, besonders bevorzugt 0, 1 oder 2.

Als geschütztes Aldehyd oder Keton können alle Acetal-Ketalschutzgruppen dienen, die sich unter sauren Bedingungen spalten lassen. Eine Übersicht findet sich insbesondere in: P. G. M. Wuts, T. W. Greene, Greene's Protective Groups in Organic Synthesis, 4th ed., Wiley, 2007, Seite 435-477.

X 2 kann sein, worin Z eine elektronenziehende Fluchtgruppe ist, die bei einem heterolytischen Bindungsbruch das bindende Elektronenpaar mitnimmt. In einer besonderen Ausführungsform ist Z ausgewählt aus der Gruppe F, Cl, Br, J, N 3 , SRg (worin R 8 wie R3 definiert ist),

X 2 stellt somit eine Carbamatvorstufe dar, die mit der Aminogruppe des VolUängenpeptids ein Carbamat bilden soll.

L ist ein funktioneller Linker, der Xi und X 2 trennt und unter basischen Bedingungen (nukleophil) spaltbar ist. Eine Auswahl der nukleophil spaltbaren Linker findet sich bei F. Guillier, D. Drain, M. Bradley, Linkers and Cleavage Strategies in Solid-Phase Organic Synthesis and Combinatorial Chemistry, Chem. Rev. 2000, 100, 2091-2157.

In einigen Ausführungsformen sind die Verbindungen nach der allgemeinen Formel X-L-X 2 pharmazeutisch akzeptable Salze davon.

In einigen Ausführungsformen wird die Verbindung nach der allgemeinen Formel X 1 -L-X 2 als Linker verwendet, der eine Verbindung zwischen der N-terminalen Aminogruppe eines VolUängenpeptids und einer festen Phase bildet. In einer bevorzugten Ausführungsform ist der Linker L ausgewählt aus den allgemeinen Strukturen a, b oder c

A: C c -C 2 . aromatisch, aliphatisch, ungesättigt, gesättgt

»: H Afkyl oder etektronenzietieftcj« Gruppe

R§, R«: gleich oder verschieden H r>-:- Ah ! C r C 1 ?

R 7 ; gltich od« verschieden H » ©tetetfone»efi» < M ,; t < fst pw Ί·Η > Alkyt C f -C«

worin A eine gesättigte oder ungesättigte, verzweigte oder nicht verzweigte, substituierte oder nicht substituierte aliphatische oder aromatische Kette mit einer Länge von 0 bis zu 12 Kohlenstoffatomen ist und wobei R4 = H, eine Alkylkette von 0 bis zu 12 Kohlenstoffatomen oder eine Gruppe ist, die fähig ist, Elektronen durch einen induktiven oder mesomeren Effekt an sich zu ziehen.

Wobei R 5 und Re gleich oder verschieden sein können und R 5 , Re = H, eine Alkylkette mit einer Länge von 1 bis 12 Kohlenstoffatomen oder eine Gruppe ist, die fähig ist Elektronen durch einen induktiven oder mesomeren Effekt an sich zu ziehen. R 7 ist H, eine Alkylkette mit einer Länge von 1 bis 12 Kohlenstoffatomen oder eine Gruppe die fähig ist Elektronen durch einen induktiven oder mesomeren Effekt an sich zu ziehen.

In einem weiteren Aspekt wird die Aufgabe der Erfindung durch ein Verfahren gelöst, das die folgenden Schritte umfasst.

i) In-Kontakt-Bringen einer Mischung von Volllängenpeptid und Abbruchsequenzen, die sich noch an der festen Phase (dem Syntheseharz) befinden, mit einer Verbindung (Fängermolekül) der allgemeinen Formel X r L-X 2 wobei Xi, X 2 und L wie oben definiert sind und wobei der Schritt des in-Kontakt- Bringens zu einer Reaktion der Verbindung X 1 -L-X 2 an X 2 mit der freien N-terminalen Aminogruppe des Volllängenpeptids unter Ausbildung einer kovalenten Bindung führt. ii) Abspaltung der Peptide von der festen Phase (Syntheseharz) mittels Säuren und Erhalten einer Mischung von Volllängenpeptid, das mit dem Fängermolekül kovalent verbunden ist und acetylierten Abbruchsequenzen von Peptiden aus einer Festphasen-Peptidsynthese (SPPS);

iii) Trennung der festen und flüssigen Phase, z.B. durch Filtration;

iv) Entfernen der nicht-peptidischen Verunreinigungen durch Fällung in Ether bei einer Temperatur von -78 °C bis 0 °C. Vorzugsweise wird die Säuremischung dabei in den vorgelegten Ether gegeben, wobei alles peptidische Material ausfällt und organische Verunreinigungen im Ether verbleiben. Anschließend erfolgt eine Trennung der etherischen Lösung von der Peptidmischung z.B. durch Zentrifugation. Die Peptidmischung wird als amorpher Feststoff erhalten;

v) Aufnahme des amorphen Feststoffs aus Schritt iv) in einer zumindest teilweise wässrigen Pufferlösung bei einem pH-Wert zwischen 2 und 4, bevorzugt zwischen 2,5 und 3,5 besonders bevorzugt bei 3. Die Einstellung des pH- Wertes erfolgt dabei geeignet durch Zugabe von Säuren oder Basen;

vi) In Kontakt bringen der Mischung aus v) mit einem Oberflächen-modifizierten festen Träger (Reinigungsharz), zwecks kovalenter Anbindung der mit dem Fängermolekül (Schritt i) modifizierten Volllängenpeptide über die Bildung einer Hydrazon oder Oxim-Bindung. Besonders vorteilhaft ist hier die Zugabe von Aminen und/oder Essigsäure als Katalysator zur Verbesserung der Kinetik der Anbindungsreaktion;

vii) Entfernung der nicht über die Hydrazon/Oxim-Bindung an den festen Träger gebundenen peptidischen Abbruchsequenzen durch Waschen mit organischen Lösungsmitteln und/oder mit Wasser und wässriger Pufferlösung, vorzugsweise unter Zusatz von chaotropen Stoffen, um eventuell nicht kovalent gebundene Peptide zu lösen;

viii) Abtrennung der Volllängenpeptide von der festen Phase durch Spaltung des Linkers L unter basischen (nukleophilen) Bedingungen;

ix) Filtration zur Abtrennung der festen Phase von den gewünschten Volllängenpeptiden; und x) Regeneration der festen Phase (Reinigungsharz) durch Behandlung mit Hydrazin (H 4 N 2 ) und/oder Ammoniumhydroxid H 4 NOH und/oder Aldehyden und/oder Ketonen und/oder Waschen mit Wasser.

Zur Abspaltung der Peptide vom Syntheseharz (Schritt ii)) werden Säuren verwendet, bevorzugt sind hier organische und anorganische Säuren die einen pks Wert unter 4 besitzen. Besonders geeignet sind Säure ausgewählt aus der Gruppe der fluorhaltigen Säuren: Trifluoressigsäure (TFA), Flussäure (HF) und Triflourmethansulfonsäure. Außerdem geeignet sind Bromwasserstoffsäure (HBr), Chlorwasserstoffsäure (HCl), Schweflige Säure (H 2 SO 3 ), Schwefelsäure (H 2 SO 4 ), Phosphorsäure (H 3 PO 4 ), Salpetersäure (HNO 3 ), Methansulfonsäure. Zur Fällung in Schritt iii) werden organische Lösungsmittel verwendet die bei den Fällungstemperaturen in flüssiger Form vorliegen, solche Lösungsmittel sind dem Fachmann allgemein bekannt. Bevorzugt werden organische Lösungsmittel aus der Gruppe der Ether, besonders bevorzugt sind Diethylether und/oder Methyl-tert-butylether. Auch Alkane die bei den Fällungstemperaturen in flüssiger Form vorliegen können verwendet werden besonders bevorzugt sind n-Hexan und oder n-Pentan.

Geeignete zumindest teilweise wässrige Pufferlösungen die in Schritt v) Anwendung finden sind dem Fachmann bekannt, nämlich Puffer, die im pH Bereich 2-5 eine Pufferkapazität aufweisen, somit Puffer mit den Anionen: Citrat, Malat, Format, Lactat, Succinat, Acetat, Pivalat, und Phosphat in Kombination mit den Kationen: Natrium, Kalium, Ammonium (NFL, NMe 4 , NEt 4 , NPr 4 , NBU 4 , HNC 5 H 5 ).

Zur Einstellung des pH- Wertes können organische oder anorganische Säuren, bevorzugt HG und als Basen bevorzugt Alkali- und/oder Erdalkali-Hydroxide, besonders bevorzugt NaOH und/oder KOH, verwendet werden.

Zur besseren Löslichkeit des Peptids kann es in Schritt v) vorteilhaft sein, dem System mit Wasser mischbare organische Lösungsmittel zuzugeben, solche Lösungsmittel sind dem Fachmann allgemein bekannt und können ausgewählt sein aus der Gruppe: Dimethylformamid (DMF), Acetonitril. Tetrahydrofuran (THF), Dioxan, Pyridin, Aceton, Dimethylsulfoxid (DMSO), Methanol, Ethanol, 1- Propanol, 2-Propanol, 1-Butanol, Formamid und N -Methylpyrolidon (NMP).

Zur Beschleunigung der Immobilisierung in Schritt vi) können der wässrigen Lösung Amine und/oder Essigsäure zugegeben werden. Amine können dabei ausgewählt sein aus der Gruppe bestehend aus: Pyridin, Piperidin, Methylamin, Ethylamin, Propylamin, Butylamin, Anilin und Dimethylamin.

Als oberflächenmodifizierter fester Träger (Reinigungsharz) in Schritt vi) kommen synthetische und natürliche Polymere in Frage. Die Oberflächenmodifizierung ist dabei derart, dass sie mit zu

"f

Hydrazonen oder Oximen reagiert. Ist Xi = (Yi =NH, O) so besteht die

Oberflächenmodifizierung in aldehydischen oder ketonischen Gruppen, welche dann entsprechend zu Hydrazonen oder Oximen reagieren. Ist Xi eine Aldehyd- oder Ketonfunktion der allgemeinen Formel-Pv3C=0, so sollte die Oberflächenmodifizierung eine NH 2 -Yi-R 7 (R 7 = fester Träger) Gruppe aufweisen. Bevorzugt als feste Träger sind oberflächenmodifizierte natürliche oder auch Biopolymere, besonders bevorzugt oberflächenmodifizierte Polysacharide. Ganz besonders bevorzugt ist die Verwendung von Aldehyd-modifizierter Sepharose/Agarose, sowie Cellulose und Xi = NH 2 -NH- c=oo-.

Im Schritt vi. (Waschen der an das Reinigungsharz gebundenen Volllängenpeptide) kann mit Wasser, wässrigen Waschlösungen oder organischen Lösungsmitteln gewaschen werden. Als chaotrope Stoffe zu der wässrigen Waschlösung in Schritt vi. sind geeignet: Bariumsalze, Guadiniumhydrochlorid, Guadiniumthiocyanate, Thiocyanate, Perchlorate, Iodide, Butanol, Phenol, Thioharnstoff, Harnstoff, Ammoniumsulfat. Lösungsmittel können ausgewählt sein aus der Gruppe: Dichlormethan (DCM), Trichlormethan, Tetrachlorkohlenstoff, Ethylacetat, Diethylether, Methyl-tert-butylether, Essigsäure, 2,2,2-Trifluorethanol, Hexafluorisopropanol, Dimethylformamid (DMF), Acetonitril. Tetrahydrofuran (THF), Dioxan, Pyridin, Aceton, Dimethylsulfoxid (DMSO), Methanol, Ethanol, 1-Propanol, 2- Propanol, 1 -Butanol, Phenol, Formamid und N-Methylpyrolidon (NMP).

Die Spaltung in Schritt vii. erfolgt durch Basen in wässrige Lösungen oder organischen Lösungsmitteln, die Peptide lösen. Basen können ausgewählt sein aus der Gruppe: LiOH, NaOH, KOH, Ammonium (NH 4 , NMe 4 , NEt 4 , NPr 4 , NBIL,, HNEt(iPr) 2 , HNMe 3 , HNEt 3 , HNPr 3 , HNBu 3 , HNC 5 H 5 ) hydroxide, Piperidin, Methylamin, Ethylamin, Propylamin, Butylamin, Hydrazin, Hydroxylamin, Methylhydrazin und O-Methylhydroxylamin. Organischen Lösungsmitteln, die Peptide lösen, können ausgewählt sein aus der Gruppe: Dimethylformamid (DMF), Acetonitril. Tetrahydrofuran (THF), Dioxan, Pyridin, Aceton, Dimethylsulfoxid (DMSO), Methanol, Ethanol, 1 - Propanol, 2-Propanol und 1 -Butanol. Die Filtration in Schritt viii) erfolgt bevorzugt mittels handelsüblichen Spritzenreaktoren oder Filtersystemen. Die Filterlochgrößen sollten zwischen 10 bis 100 μιη liegen.

In einigen Ausführungsformen ist das erfindungsgemäße Verfahren dadurch gekennzeichnet, dass die Trennung der festen und flüssigen Phasen durch Filtration erfolgt.

In einigen Ausführungsformen ist das erfindungsgemäße Verfahren dadurch gekennzeichnet, dass in Schritt vi. Amine und/oder Essigsäure als Katalysator zugegeben werden.

In einigen Ausführungsformen ist das erfindungsgemäße Verfahren dadurch gekennzeichnet, dass die Pufferlösung in Schritt v. einen pH- Wert zwischen 2.5 und 3.5 und bevorzugt bei 3 aufweist.

In einigen Ausführungsformen ist das erfindungsgemäße Verfahren dadurch gekennzeichnet, dass die Entfernung in Schritt vii. durch Waschen mit organischen Lösungsmitteln und/oder mit Wasser und wässriger Pufferlösung, vorzugsweise unter Zusatz von chaotropen Stoffen, um eventuell nicht kovalent gebundene Peptide zu lösen, erfolgt.

In einigen Ausführungsformen ist das erfindungsgemäße Verfahren dadurch gekennzeichnet, dass die Abtrennung der Volllängenpeptide von der festen Phase in Schritt viii. durch Spaltung des Linkers L unter basischen (nukleophilen) Bedingungen erfolgt.

In einigen Ausführungsformen ist das erfindungsgemäße Verfahren dadurch gekennzeichnet, dass zur Abtrennung der Peptide vom Syntheseharz in Schritt ii. Säuren verwendet werden, die einen pks Wert von unter 4 aufweisen. In einigen Ausführangsformen ist das erfindungsgemäße Verfahren dadurch gekennzeichnet, dass zur Fällung in Schritt iii. organische Lösungsmittel aus der Gruppe der Ether, besonders bevorzugt Diethylether und/oder Methyl-tert-butylether oder n-hexan und oder n-Pentan verwendet werden.

In einigen Ausführungsformen ist das erfindungsgemäße Verfahren dadurch gekennzeichnet, dass als oberflächenmodifizierter fester Träger (Reinigungsharz) in Schritt vi. synthetische und natürliche Polymere verwendet werden, z.B. oberflächenmodifizierte Polysaccharide, besonders bevorzugt Aldehyd-modifizierte Sepharose/ Agarose, oder Cellulose und Xi= NH 2 -NH-C=00-.

Ein besonderer Vorteil der erfindungsgemäßen Methode liegt in der Reversibilität der Hydrazon- sowie Oximbindung.

Das hier beschriebene Verfahren kann durch die Gleichgewichtsnatur der Hydrazon/Oximbindung wie eine Affinitätschromatographie benutzt werden. Nach dem Aus- oder Wegwaschen der Verunreinigungen und der Spaltung des basenlabilen Linkers und somit Erhalt des Zielpeptides kann das Reinigungsharz wieder regeneriert werden und ist somit für eine weitere Reinigung zugänglich. Befindet sich an der Oberfläche des Reinigungsharzes ursprünglich Aldehyd- oder Ketogruppen, stellt Waschen mit saurer wässriger Lösung in der Aldehyde oder Ketone gelöst sind die Aldehyd oder Keton Funktion wieder her. Befindet sich an der Oberfläche des Reinigungsharzes ursprünglich Hydrazin oder Hydroxylaminderivate, stellt Waschen mit saurer wässriger Lösung mit Hydrazin oder Hydroxylamin die Hydrazin oder Hydroxylaminfunktion wieder her. Es wird dasselbe Material wie bei der Protein- Aufreinigung mittels Affinitätschromatographie verwendet, Sepharose/ Agarose.

Des Weiteren lässt sich das Verfahren auf Cellulose übertragen, welches das häufigste Biomaterial auf der Erde darstellt und somit kostengünstig verfügbar ist.

Proteine werden standardmäßig über Affinitätschromatographie aufgereinigt, und diese Methode ist auch im Vergleich zur HPLC Reinigung sehr kostengünstig und effizient, sowie skalierbar. Durch die niedrigen Drücke und höheren Beladungsdichten auch vielmehr für große Synthesemengen geeignet als die HPLC.

Im Folgenden soll, die Allgemeinheit der Lehre nicht einschränkend, die Erfindung anhand einiger Beispiele mit Bezug auf die Figuren erläutert werden.

Allgemeines Syntheseschema

Die erfindungsgemäßen Fängermoleküle können nach dem allgemeinen Syntheseschema (1) hergestellt werden. Nach diesem Schema kann der nukleophile linke Teil des Linkermoleküls zwischen Hydroxylamin und Hydrazin variiert werden. Der spaltbare Teil des Linkers L kann ebenfalls variiert werden. Es kann zwischen Sulfonlinkern und Phenolester-Linkersystemen unterschieden werden. Darüber hinaus kann der rechte Carbonatteil des Linkersystems unterschiedliche Fluchtgruppen aufweisen. Somit ergibt sich eine Fülle an Kombinationsmöglichkeiten Die Bausteine LI und L3 sind kommerziell erhältlich L2 kann nach Schema 2 hergestellt werden.

4

L3: M = O

Schema 1: Allgemeines Syntheseschema für die Linkersynthese nach einem Baukastenprinzip, a) i) CH 2 CI 2 , n) für die Thioetherbausteine LI und L2 werden mit mCPBA in CH 2 CI 2 zu Sulfonen oxidiert. DCC: Dicyclohexylcarbodiimid, DIEA: Diisopropylethylamin, Boc: teri-Butyloxycarbonyl.

L1 : R = H; L2: R = CH 3

Schema 2: Synthese des Linkerbausteins LI und L2.

Beschreibung der Abbildungen

Figur 1 zeigt eine schematische Darstellung des erfindungsgemäßen Verfahrens zur Verdeutlichung desselben, i) SPPS mit Acetylierung nach jeder Kupplung, n-fache Wiederholung; ii) Zugabe von Molekül X1-L-X2, iii) Immobilisierung; iv) Waschen; v) basische Spaltung; vi) Filtration; vii) Regeneration. 1 : Reinigungsharz, 2: Fängermolekül, 3: natives Peptid (gewünschtes Produkt), 4: Abbruchsequenzen, x = 1 bis n, n: Volllängenpeptid, n-x: Abbruchsequenzen.

Figur 2 zeigt die Absorption bei 278 nm bei Vermessung des Überstandes nach Abspaltung des Peptids (Verbindung 3 in Schema 3) mit 0,5 vol. % N 2 H 4 zur Demonstration der Reversibilität der Hydrazonbindung aus Beispiel 1. Abs.: Absorption des Überstandes von mit Peptid beladenen Aldehyd-modifizierten Agarose-Trägers bei 278 nm. t: Zeit, die nach der Zugabe von einer 0.5% Hydrazinlösung vergangen ist in Minuten (min), n: Aufgrund der Absorption berechnete Menge an Peptid im Überstand in nmol. Gestrichelte-Linie: Nicht-lineare Regression nach Hill mit der Formel: y = 0.142*x/(3.16+x), R 2 = 92, t 1/2 = 3.16 min. Figur 3 zeigt Chromatogramme der einzelnen Phasen bei erfindungsgemäßer Reinigung eines Peptides nach Nativer Chemischer Ligation (NCL) aus Beispiel 2. Chromatogramm 1 zeigt das gewünschte Produkt (P) im Reaktionsgemisch der NCL nach 24 Stunden. Chromatogramm 2 zeigt den Überstand nach 30 Minuten Immobilisierung. Chromatogramm 3 zeigt das gewünschte Produkt (P) nach 30-minütigem Waschen und Abspalten. P: Peak des gewünschten Produkts.

Figur 4 zeigt Chromatogramme bei erfindungsgemäßer Reinigung der Peptide 7-13 nach der Festphasenpeptidsynthese aus Beispiel 4. Die Chromatogramme, die mit Überstand beschriften sind, zeigen die Verunreinigungen, welche mit der Methode abgetrennt werden konnten. FM = erfindungsgemäßes Fängermolekül; (a) Peptid 7 (Taul); (b) Peptid 8 (Tau2); (c) Peptid 9 (GNRH), (d) Peptid 10 (Magainin); (e) Peptid 11 (Terts72Y); (f) Peptid 12 (Bivalrudin); (g) Peptid 13 (TAT), (h) Peptid 14 (Forschungspeptid). Das jeweils obere Diagramm zeigt das Peptid nach der Synthese und das jeweils untere Diagramm zeigt das Peptid nach der Reinigung.

Figur 5 zeigt eine schematische Darstellung des erfindungsgemäßen Verfahrens zur Verdeutlichung desselben. Figur 5 zeigt eine alternative Darstellung zu Figur 1.

SEQ ID Nos: 1 bis 10 zeigen Peptide aus den Beispielen 1, 2 und 4. Beispiele

Beispiel 1. Demonstration der Reversibilität der Hydrazonbindung/Oximbindung

Die reversible Anbindung des Peptids an Aldehyd-modifizierte Agarosebeads, wird im Folgenden am Beispiel der Hydrazonbindung demonstriert, durch die elektronische Ähnlichkeit (siehe auch A. Dirksen, P. Dawson, Bioconjugate Chem. 2008, 19, 2543-2548.) sind die Ergebnisse auf die Oxim- Bindung übertragbar. Es zeigt sich, dass das Gleichgewicht durch die Zugabe von Hydrazin (N 2 H 4 ) gesteuert werden kann.

Schema 3: Reversibilität der Hydrazonbindung zwischen einem Peptid und einem

Reinigungsharz, i) 0.1 M NH 4 OAc, pH = 4, 0.1 M PhNH 2 , 30 min; ii) 0.5% N 2 H 4 , 5 mM TCEP; die Peptidsequenz (weiße Buchstabenfolge in schwarzer Fläche) ist SEQ ID NO: 1 zugeordnet.

Das Peptid 3 wurde in dem Konjugationspuffer (0,1 M NH 4 OAc, 0,1 M PhNH 2 , pH= 3) in 30 min auf den Träger 1 gebracht (Schema 3). Anschließend wurde mit Wasser gewaschen und der Überstand entfernt. Dann wurde auf die Beads eine Lösung von 0,5 Volumenprozent Hydrazin-hydrat gegeben und die Absorption bei 278 nm des Überstandes (200 μΕ) im zeitlichen Abstand gemessen (mit dem Gerät ND-I000 Spectrophotometer der Firma NanoDrop Technologie). Dabei zeigte sich, dass nach 10 min 80% des Peptides im Überstand zu messen ist. Nach weiteren 50 Minuten konnten 86 % des Peptides rückgewonnen werden. Durch nicht-lineare Regression wurde eine Halbwertszeit von drei Minuten ermittelt, Figur 2 zeigt die Adsorption bei 278 nm bei Vermessung des Überstandes nach Zugabe von N 2 H 4 .

Beispiel 2: Reinigung eines Peptides nach der Nativen Chemischen Ligation (NCL)

Es wurde die Reinigung eines Peptids aus einem komplexen System, das ein Gemisch peptidischen Materials, sowie organische und anorganische Verunreinigungen enthielt durchgeführt.

H{YENRI )-MPA-G-NH2

3 eq.

Schema 4:Reinigung eines Peptids nach nativer chemischer Ligation i) 0.1 M Na 2 HP0 4 , 3 M Gdn*HCl, 20 mM TCEP, 50 mM MesNa, 1% (v/v) PhSH, pH=7, 15 h; ii) Zugabe Sepharose Harz und 2-faches Vol. von 0.1 M NH 4 OAc pH=2.5, pH=4, 30min; iii) Waschen H 2 0, EtOH; iv) N 2 H 4 , 4 mM TCEP, 30 min. Die Peptidsequenzen sind SEQ ID NO: 1 (weiße Buchstabenfolge in schwarzer Fläche) und SEQ ID NO: 2 („YENDRIK" in weißer Fläche) zugeordnet.

Die zu reinigende Mischung wurde nach einer NCL erhalten (Schema 4). Diese Reaktion findet im wässrigen Puffersystem statt und wird verwendet, um größere Peptide und Proteindomänen zu synthetisieren. Nach 24 h Reaktionszeit der NCL liegt die rohe Mischung vor, die im Wesentlichen das gewünschte Ligationsprodukt, sowie den Thioester (H-YENRIK-MESA), der im Überschuss eingesetzt worden ist, enthielt. Dieses ist im Chromatogramm (UPLC-MS der Firma Waters, Acquity H-Class PDA/QDa, auf Polaris C18 A 5 μιη 250/4 Säule) in Figur 3 zu sehen.

Dem Ligationspuffer (0,1 M Na 2 HP0 4 , 20 mM TCEP, 50 mM MesNa, pH = 7) wurde das doppelte Volumen Konjugationspuffer zugesetzt. Anschließend wurden modifizierte Sepharosebeads hinzugegeben und das Zweiphasensystem wurde 30 Minuten geschüttelt. Es wurde der Überstand des Sepharosegels mittels UPLC-MS analysiert (Fig. 3, Chromatogramm 2), in dem angeschlossenen Massenspektrometer konnte keine Masse gefunden werden, die sich dem Ligationsprodukt zuordnen ließ. Da aber ein Absorptionssignal bei der Retentionszeit des Produktes zu sehen ist, wird hierbei auch deutlich, dass Verunreinigungen entfernt werden können, die nicht mit Hilfe der HPLC getrennt werden können. Nach Waschen mit Wasser sowie etwas Ethanol und Acetonitril wurde 0.5 vol.% Hydrazinhydrat in Wasser zu den peptidbeladenen Sepharosebeads gegeben und nach 30 Minuten der Überstand analysiert, wobei das Chromatogramm 3 (Fig. 3) erhalten wurde. Dieses zeigt eine hohe Reinheit des Peptids (gewünschtes Produkt) von über 90%.

Beispiel 3: Exemplarische Reinigung einer Peptidmischung nach der Festphasenpeptidsynthese Das Reaktionsschema (Schema 5) der erfindungsgemäßen Reinigung ist im Folgenden dargestellt.

Schema 5: Erfindungsgemäße Reinigung einer Peptidmischung nach der Festphasenpeptidsynthese (SPPS) i) SPPS mit Acetylierung nach jeder Kupplung, n-fache Wiederholung; ii) Zugabe von Molekül 2; iii) Spaltung mit TFA; iv) Immobilisierung auf Reinigungsharz durch Zugabe von Ph-NH 2 bei pH 3-4; v) Waschen mit Wasser und Puffer; vi) Base 5% NH 4 OH; vii) Regeneration des Reinigungsharzes 1 durch Zugabe von H 2 0/Aceton/TFA (49,5/49,5/1). 1 : Reinigungsharz, 2: Fängermolekül, 3: natives Peptid (gewünschtes Produkt), 4: Abbruchsequenzen, x = 1 bis n, n: Volllängenpeptid, n-x: Abbruchsequenzen.

1

Schema 6: Funktionalisierung von Agarose Beads i) NaOH, NaBH 4 , H 2 0, r.t, o/n, 18 h; ii) 20 mM NaI0 4 , H 2 0, r.t, 1 h. Nach der Festphasensynthese (SPPS) wird ein Fängermolekül 2 (Schema 5) auf die letzte gekuppelte Aminosäure aufgebracht. Wichtige Voraussetzung hierbei ist, dass die Acetylierung in den vorherigen Schritten vollständig verlief. Danach werden alle Abbruchsequenzen und das Fängermolekül- modifizierte Volllängenpeptid vom Harz gespalten. Anschließend werden nicht-peptidische Verunreinigungen durch Etherfällung entfernt und die rohe Peptidmischung wird in einem Acetat Puffer gelöst, der einen pH- Wert von 3-4 hat und dem 0.1 M Anilin als Katalysator beigefügt ist. Diese Lösung wird nun auf funktionalisierte Sepharose-Beads 1 gegeben (Schema 5 und 6). Dieses Material findet Anwendung in der Proteinreinigung als Material für die Affinitätschromatographie. Die Sepharose hat den Vorteil, leicht für die Peptide penetrierbar zu sein. Die Sepharose wird vorher Aldehyd-modifiziert (siehe Schema oben), die Aldehydmodifikation der Sepharose ist bekannt aus: J. Guisan, Enzyme Microb. Technol. 1988, 10, S.375.

Hierbei werden nur Peptide auf dem festen Träger verankert, die das Fängermolekül mit der Hydrazidfunktion tragen. Amine, die theoretisch auch mit Aldehyden reagieren können, sind bei dem zu verwendenden pH-Wert protoniert und somit nicht nukleophil genug für einen Angriff am Aldehyd. Die Abbruchsequenzen, die sich noch in der Sepharose befinden, können mit Wasser herausgewaschen werden. Eine Behandlung der Sepharose mit einer basischen Lösung, z.B. Ammoniak in Wasser, lässt das Fängermolekül zerfallen und das Volllängenpeptid geht in Lösung über. Die Lösung kann danach lyophilisiert werden, wobei Ammoniak entfernt wird. Das Peptid wird dann in reiner Form als Feststoff erhalten. Ein Vorteil der Methode ist die schnelle Immobilisierung und die breite Anwendbarkeit bei unterschiedlichen Peptiden.

Beispiel 4: Exemplarische Regenerierung des Reinigungsharzes

Nach der Peptidreinigung mit dem Fängermolekül 2 (Schema 5) bleibt die ursprüngliche Aldehydfunktion von 1 mit Hydrazin blockiert zurück, um das Reinigungsharz wieder für einen neuen Reinigungszyklus bereit zu stellen, muss das Harz regeneriert werden und somit die Aldehydfunktion wiederhergestellt werden. Dies gelingt bei Verschieben des Gleichgewichtes durch Zugabe von Aldehyden oder Ketonen. Die exemplarische Durchführbarkeit wurde wie folgt gezeigt. Es wurde das Reinigungsharz 1 in drei gleiche Aliquote geteilt (I, II, III) und zwei Aliquote (II, III) wurden mit Hydrazin im Konjugationspuffer für 30 min behandelt. Anschließend wurde mit Wasser gewaschen und Aliquot III wurde mit einer Mischung aus Wasser, Aceton und TFA (49.5:49.5: 1) siebenmal gewaschen. Danach wurden alle Aliquote mit FmocN 2 H 3 in Konjugationspuffer über 14 h behandelt und dann wurde mit jeweils fünfmal mit Wasser, DMF und Wasser gewaschen. Es folgte eine zweimalige Behandlung mit DMF/Piperidin(20%) je 4 min und dann wurde die UV Absorption bei 301 nm des entstandenen Fluoren Piperidin Addukts im Überstand gemessen (SmartSpec™Plus Spectrophotometer der Firma BioRad in 1 mL Halbmikro-Quarzküvetten der Firma Hellma). Das unbehandelte Aliquot I zeigte eine Beladung von 27 μιηοΐ/g; das Aliquot II ohne Regeneration eine Beladung von 18 μιηοΐ/g (67% von I), und das regenerierte Harz zeigte eine Beladungsdichte von 25 μιηοΐ/g (93% von I). Dieses Experiment zeigt die erfolgreiche Regeneration des Reinigungsharzes. Tabelle 1 : UV- Absorption und Beladungsdichte von Reinigungsharzen nach unterschiedlichen Regenerationsbehandlungen

Aliquot A(301nm) S^mol/g) Anteil [%]

I 0,286 27 100

II 0,199 18 67

III 0,267 25 93

Beispiel 5: Reinigung einer Peptidmischung

Das erfindungsgemäße Verfahren zur Reinigung von Peptiden wurde auf sieben Peptide unterschiedlicher Polarität angewendet, diese waren H-TLADEVSASLAK-OH (SEQ ID NO: 3) (7) Fragment 427-438 des Alzheimer relevanten Tau-Proteines, H-ATLADEVSASLAK-NH 2 (SEQ ID NO: 4) (8) Fragment 427-439 von Tau, das Cysteinylpeptid H- CQWSLHRKRHLARTLLTAAREPRPAPPSSNKV-NH 2 (SEQ ID NO: 5) (8) aus Protein Progona- doliberin-2 (9), H-GIGKFLHSAKKFGKAFVGEIMNS-NH 2 (SEQ ID NO: 6) Magainin (10), H- YLFFYRKSV-NH 2 Terts72Y (SEQ ID NO: 7) (11), H-FPRPGGGGNGDFEEIPEEYL-NH 2 (SEQ ID NO: 8) Bivalirudin (12) und H-GRKKRRQRRRPQ-NH 2 TAT (SEQ ID NO: 9) (13).

Es wurde die Rohpeptidmischung im Konjugationspuffer gelöst und auf die Sepharose-Beads 1 innerhalb von 30-60 min aufgebracht, anschließendes Waschen mit Wasser und wässrigen neutralen Lösungen (4M Harnstoff, IM Kochsalz) konnten alle acetylierten Abbruchsequenzen und andere Verunreinigungen entfernt werden. Die Spaltung des Linkers 2 (Schema 7) erfolgte mit 5%iger Ammoniak Lösung in Wasser über 20min, anschließend wurde in-situ mit Essigsäure neutralisiert und die Löslichkeit erhöht.

Mit Hilfe der UPLC-MS wurde die Reinheit der einzelnen Phasen überprüft. Die Chromatogramme der nicht gereinigten (ohne Fängermolekül FM) und gereinigten Peptide, sowie des die Verunreinigungen enthaltenden Überstandes sind in Figur 4 zu sehen. Es konnte eine Peptidreinheit bei 7 von 85% (ursprünglich 39%), bei 8 von 93%> (ursprünglich 39%>), bei 9 von 80%> (ursprünglich 24%), bei 10 von 90% (ursprünglich 23%), bei 11 von 87% (ursprünglich 60%), bei 12 von 90% (ursprünglich 40%>), bei 13 von 95%> (ursprünglich 37%>) erreicht werden (vgl. Abb. 4). Tabelle 2: Reinheit und Ausbeute verschiedener Peptide nach Anwendung des erfindungsgemäßen Reinigungsverfahrens

Name Nr. Anwendung Status Länge Hydro Reinheit Reinheit Ausin AS phobe Rohnach beute

AS produkt Verfahren

Taul 7 Alzheimer präklinisch 13 62% 40% 85% 70%

Tau2 8 Alzheimer präklinisch 12 58% 39% 93 % 69%

GNRH 9 Fertilisation zugelassen 32 59% 35% 80% 42%

Magainine 10 Antibiotikum zugelassen 23 65% 23 % 90% 62%

Terts72Y 11 Lungenkrebs Phase II 9 77% 60% 87% 92%

Bivalrudin 12 Anti- zugelassen 20 65% 40% 90% 89% koagulation

TAT 13 HIV Phase II 12 17% 37% 95% 83 %

Testpeptid 14 Forschung - 13 46% 45% 60% -

Die Synthese des basenlabilen Linkers 2 erfolgte nach folgendem Schema 7.

A)

Schema 7: Synthese des basenlabilen Linkers i) N 2 H 4 *H 2 0; ii) 2.2 eq. pN0 2 PhC0 2 Cl; iii) mCPBA; n: Peptid.

Material und Methoden

Festphasenpeptidsynthese der Peptide sowie Reinigung

Die automatisierte Festphasenpeptidsynthese erfolgte in 25 μιηοΐ Ansätzen, mit einem MultiPep RS- Peptidsyntheseautomaten der Firma Intavis AG. Die Synthesen der Peptidamide erfolgten am Tentagel R RAM Harz (0.2 mmol · g -1) der Firma Rapp Polymer. Vor Beginn der Synthese wurde das Harz in

3 mL Spritzenreaktoren (PE-Reaktor der Firma Multisyntech) überfuhrt und in DMF gequollen. Soweit nicht anders beschrieben, bezieht sich die Angabe der Äquivalente auf die Erstbeladung des eingesetzten Harzes.

Fmoc-Abspaltung: Zur Abspaltung der temporären Fmoc-Schutzgruppen wurde das Harz einmal

4 min und ein weiteres Mal 6 min mit 400 μΕ Piperidin/DMF (4:1) behandelt und nachfolgend fünfmal mit 800 μΕ DMF gewaschen und es wurde mit der Kupplung der Fmoc-Aminosäurederivate fortgefahren.

Kupplung der Fmoc-Aminosäurederivate: Eine Lösung von 5 eq. Aminosäure in DMF (0.3 M) wurde

1 min bei Raumtemperatur mit Lösungen von 4.5 eq. HCTU in DMF (0.3 M) und 10 eq. NMM in DMF (0.6M) voraktiviert und anschließend zum Harz gegeben. Nach 30 min Reaktionszeit wurde das Harz dreimal mit 800 μΕ DMF gewaschen und es wurde mit dem Blockieren der Abbruchsequenzen fortgefahren.

Blockieren der Abbruchsequenzen: Das Harz wurde einmal 5 min mit 400 μΐ einer Lösung von AC 2 0/2,6-Lutidin/DMF (5:6:89) behandelt und nachfolgend dreimal mit je 800 μΕ DMF gewaschen.

Letzter Schritt Kopplung des Fängermoleküls: Als letzter Schritt der Festphasenpeptidsynthese wurde das Fängermolekül 2 auf das gewünschte Zielpeptid gekuppelt. Es wurde das Syntheseharz mit einer Lösung aus 5 eq. Fängermolekül 2 in DMF (0.3 M) und 5 eq. Oxyma in DMF (0,3 M) und 12 eq. DIPEA in DMF (0,7 M) gemischt. Nach 60 min Reaktionszeit wurde zweimal mit je 800 μΕ DMF gewaschen.

Freisetzung vom polymeren Träger: Das Harz wurde mit 2 mL einer Lösung von 96% TFA, 2% Wasser, 2% Triisopropylsilan, im Falle von thiolhaltigen Aminosäuren (Cystein oder Methionin) in der Zielsequenz wurde der Lösung 0,5% Ethandithiol und 0,5% Thioanisol zugesetzt wobei die Menge an TFA um 1 % reduziert wurde. Das Syntheseharz wurde mit dieser Abspaltmischung versetzt und

2 h bei Raumtemperatur geschüttelt. Anschließend wurde die Abspaltlösung aufgefangen und das Harz zweimal mit je 1 mL TFA nachgewaschen. Die Abspaltlösung wurde mit den Waschlösungen vereinigt und in 50 ml kaltem Diethylether ausgefällt. Diese Suspension wurde anschließend zentrifugiert und der organische Überstand wurde verworfen.

Immobilisierung auf Reinigungsharz: Der krude Niederschlag wurde nach der Zentrifugation in 3 ml des Konjugationspuffer (0.1 M NH 4 OAc, 0,1 M Anilin, pH = 3) aufgenommen, wenn sich die Mischung nicht vollständig löste wurde Acetonitril dazugegeben. Diese Lösung wurde in eine 6 ml Spritze der Firma bBraun mit einem Filtereinsatz PE 25 μιη Porengröße der Firma Multisyntech gegeben, in dieser Spritze befand sich ein gram funktionalisierte Sepharose. Die Immobilisierung wurde 30 bis 60 min durchgeführt. Anschließend wurde 5-mal mit deionisiertem Wasser der Reinheit MilliQ gewaschen, 5-mal mit einer 4M Harnstoff Lösung und 5-mal mit Wasser. Anschließend wurde das gewünschte Peptid basisch mit 5 v% NH 4 OH und 1 v% Mercaptoethanol in Wasser vom Harz gespalten. Lyophilisieren lieferte die gewünschten Peptide als weißer flockiger Feststoff.

Synthese des Fängermoleküls 2 (Verbindung 2 in Schema 7 - entspricht Verbindung (25)):

tert-Butylhydrazincarboxylat 5 (Verbindung 5 in Schema 7)

Hydrazinmonohydrat (80%, 32,5 g, 520 mmol) wurde mit Isopropanol (100 ml) bei 0 °C, mit einer Lösung aus B0C 2 O (50,0 g, 230 mmol) in Isopropanol (50 ml) tropfenweise versetzt. Das Reaktionsgemisch wurde trüb nach der Zugabe und das Rühren wurde bei Raumtemperatur für 2 h fortgesetzt. Das Lösungsmittel wurde entfernt, der Rückstand in Dichlormethan gelöst und über Magnesiumsulfat getrocknet. Dann wurde das Lösungsmittel verdampft und der Rückstand wurde aus Hexan umkristallisiert, was die Titelverbindung 5 (22,8 g, 75%) als farblose Kristalle ergab. Smp 36- 37°C Rf (EtOAc / Hexan 1 : 1) 0,20. 'H- NMR (300 MHz, CDC1 3 ): δ 6, 16 (s, 1H, NH), 3,67 (s, 2H, NH 2 ), 1 ,42 (s, 9H, C(CH 3 ) 3 ). 13 C-NMR (75 MHz, CDC1 3 , TMS): δ 158,3, 77,2,28,5. Die analytischen Daten stimmen mit den Literaturdaten überein (A. Bredihhin, U. Mäeorg, Tetrahedron 2008, 64, 6788- 6793).

Bis(4-Nitrophenyl)( thiobis(ethan-2, 1 -diyl))bis(carbonat) 6 (Verbindung 6 in Schema 7)

6,72 (33 mmol) 4-Nitrophenylchlorformiat wurde zu einer Lösung von 1 ,87 ml (2, 12 g, 15 mmol) 2,2- Thiodiethanol in 40 ml wasserfreiem Dichlormethan gegeben. Dann wurde 2,68 ml (33 mmol) wasserfreies Pyridin langsam tropfenweise unter Eiskühlung und kräftigem Rühren zugegeben. Die Reaktionsmischung wurde für 1 h bei Raumtemperatur gerührt. Die Reaktionslösung wurde mit 100 ml gesättigter Ammoniumchloridlösung versetzt und dreimal mit 100 ml Chloroform extrahiert und über wasserfreiem Magnesiumsulfat getrocknet. Die organischen Phasen wurden vereinigt und im Vakuum eingeengt. Der Rückstand wurde in Ethylacetat aufgenommen und mit wenig Cyclohexan wurde das Produkt ausgefällt. Nach dem Filtrieren wurden 5,43g (12 mmol, 80%>) als weißer Feststoff erhalten. Schmelzpunkt: 136,5 °C, Rf (EtOAc / Cyclohexan 1 : 1) 0,78. 'H NMR (300 MHz, DMSO) δ 8.30 (d, J= 9,2 Hz, 2H, Ar-H), 7,55 (d, J= 9,3 Hz, 2H, Ar-H), 4,42 (t, J= 6,4 Hz, 2H, CH 2 ), 2,96 (t, J= 6,5 Hz, 2H, CH 2 ). 13 C-NMR (75 MHz, CDC1 3 , TMS): δ 155,22, 151 ,93, 145,17, 125,41 , 122,56, 67,85, 29,63.

2-[2-(l-((tert-Butyl)oxy-carbonyl)oxy-carbonyl)-hydrazyl-eth ylsulfanyl]-ethyl 4-nitrophenylcarbonat 7 (Verbindung 7 in Schema 7)

Es wurden 1 ,97 g (4,31 mmol) bis(4-nitrophenyl) (thiobis(Ethan-2, 1 -diyl))bis(carbonat) 6 in 20 ml trockenem Dichlormethan vorgelegt und bei 0 °C wurden 1 eq. (0,58 g, 4,31 mmol) tert-butyl hydrazincarboxylat 5 mit 3 eq. (1 , 13 ml, 6,66 mmol) DIPEA langsam über eine Stunde hinzugetropft. Die Reaktionslösung wurde 12 weitere Stunden gerührt und anschließend mit Wasser versetzt. Das Produkt wurde dreimal mit 100 ml Dichlormethan extrahiert und über wasserfreiem Magnesiumsulfat getrocknet. Die organischen Phasen wurden vereinigt und im Vakuum eingeengt. Der Rückstand wurde säulenchromatographisch gereinigt (EtOAc / Cyclohexan 2: 1), wonach 1 ,03 g (2,31 mmol, 53%) eines durchsichtigen Öls erhalten wurde. Rf (EtOAc / CyclOhexan 1 : 1) 0,20. l U NMR (300 MHz, CDCh) δ 8,28 (d, J= 9,1 Hz, 2H, Ar-H), 7,39 (d, J= 9,1 Hz, 1H, Ar-H), 6,64 (s, 1H, NH), 6,33 (s, 1H, NH), 4,44 (t, J = 6,8 Hz, 2H, CH 2 ), 4,33 (t, J = 6,6 Hz, 2H, CH 2 ), 2,92 (t, J = 6,8 Hz, 2H, CH 2 ), 2,84 (t, J = 6,6 Hz, 2H, CH 2 ), 1 ,46 (s, 9H). 13 C NMR (75 MHz, CDC1 3 ) δ 155,52, 152,57, 125,47, 121 ,96, 82,09, 68,06, 65,34, 64,18, 31 ,10 ,30,59, 28,27, 27,03.

2-[2-(l-((tert-Butyl)oxy-carbonyl)oxy-carbonyl)-hydrazyl-eth ylsulfonyl] -ethyl4-nitrophenylcarbonat 2 (Verbindung 2 in Schema 7)

Zu einer Lösung des Thioethers 7 (0,52 g, 1 , 1 mmol) in 50 ml Dichlormethan wurde langsam bei Raumtemperatur m-CPBA 77%ig (489 g, 2,2 mmol) zugegeben. Nach Rühren für 12 h wurde die Reaktionsmischung mit IM NaHCÜ 3 Lösung versetzt und die organische Phase dreimal mit 50 ml Dichlormethan extrahiert. Die vereinten organischen Phasen wurden über Magnesiumsulfat getrocknet und am Rotationsverdampfer wurde das Lösungsmittel entfernt worauf das Produkt als weißer amorpher Feststoff ausfiel 0,52mg (1 , 1 mmol, quantitativ). 'H NMR (300 MHz, CDC1 3 ) δ 8,29 (d, J= 9,2 Hz, 2H, Ar-H), 7,41 (d, J= 9,2 Hz, 2H, Ar-H), 6,89 (s, 1H, NH), 6,36 (s, 1H, NH), 4,74 (t, J = 5,9 Hz, 2H, CH 2 ), 4,63 (t, J = 5,3 Hz, 2H, CH 2 ), 3,54 (t, J = 5,9 Hz, 2H, CH 2 ), 3,45 (t, J = 5,5 Hz, 2H, CH 2 ), 1 ,45 (s, 9H). 13 C NMR (75 MHz, CDC1 3 ) δ 155,85, 155,18, 152.29, 145,79, 125,56, 122,00, 82,32, 62,25, 59,45, 54,01 , 53,24, 28,23.

Die Synthese der Verbindungen nach Formel (14), (15), (17), (18), (19): erfolgte nach einem Baukastenprinzip, das im allgemeinen Syntheseschema (Schema 1) dargestellt ist.

Synthesen zur Darstellung der Verbindung der Formel (14)

N,N'-Bis-(tert-Butoxycarbonyl)-aminooxyacetyl-N-hydroxylsucc inimid Ester (BS2: X = O, Rj = Boc)

Zu einer Lösung des kommerziell erhältlichen NN'-bis-Boc-amino-oxyessigsäure (1.00 g, 3.20 mmol) in 1 1 ml Ethylacetat/Dioxan (1 : 1) wurde bei 0 °C N-Hydroxylsuccinimid (0.41 g, 3.20 mmol) und Dicyclohexylcarbodiimid (0.67 g, 0.32 mmol) hinzugegeben. Bei Raumtemperatur wurde die Lösung für 3 Stunden rühren gelassen und die Suspension wurde über Celite abfiltriert und mit Ethylacetat nachgewaschen. Das Filtrat wurde unter Vakuum zur Trockne konzentriert und wieder in 100 ml Ethylacetat gelöst. Es wurde mit 5%iger NaHC0 3 -Lösung, gesättigter NaCl-Lösung und Wasser (je 100 ml) gewaschen. Die organische Phase wurde mit MgSÜ 4 getrocknet und unter Vakuum verdampft wobei 1.24 g (3.20 mmol) Produkt als weißer Feststoff erhalten wurde. Ausbeute: 1.24 g (quant.); Rf (Cyclohexan / Ethylacetat, 1 : 1) 0.50; 'H NMR (300 MHz, CDC1 3 ) δ 4.86 (s, 2H), 2.85 (s, 4H), 1.53 (s, 18H).

N,N'-Bis-(tert-Butoxycarbonyl)-aminooxyacetyl-l-((2-amino ethyl)thio)propan-2-ol Amid (BS3: X = O, Ri = Boc) BS2 (X = O, Ri = Boc, 1.00 g, 2.55 mmol) wurde in 25 ml Dichlormethan mit l-((2- aminoethyl)thio)propan-2-ol (0.38 g, 2.55 mmol) und Diisopropyl-ethylamin (DIPEA, 0.53 ml, 3.06 mmol) gemischt und über Nacht rühren gelassen. Es wurde mit 5 %iger NaHCCVLösung, gesättigter NaCl-Lösung und Wasser (je 100 ml) gewaschen. Die organische Phase wurde mit MgS0 4 getrocknet und unter Vakuum eingeengt wobei 1.04 g (2.55 mmol) Produkt als weißer Feststoff erhalten wurde. Ausbeute: 1.04 g (quant); Rf (CH 2 C1 2 / MeOH, 98:2) 0.35; l U NMR (300 MHz, CDC1 3 ) δ 7.95 (s, 1H), 4.44 (s, 2H), 3.92 - 3.82 (m, 1H), 3.53 (qd, J = 6.7, 1.5 Hz, 2H), 2.83 - 2.65 (m, 4H), 2.49 (dd, J = 13.7, 8.7 Hz, 1H), 1.55 (s, 18H), 1.25 (d, J = 6.2 Hz, 3H); 13 C NMR (75 MHz, CDC1 3 ) δ 167.94, 150.57, 85.41, 65.98, 41.86, 38.81, 32.21, 28.19, 22.23.

2, 2-Dimethylpropanoyloxy-f 2-f 2-f 2-(4-nitrophenoxy)carbonyloxypropylthionyl]ethylamino ]-2-oxo- ethoxy] amino] 2,2-dimethylpropanoat P ' (X = O, Rj = Boc, R 2 = OC 6 H 4 PNO 2 )

Bis(4-nitrophenyl)carbonat (1.01 g, 4.95 mmol) wurden zu einer Lösung von BS3 (X = O, Ri = Boc) (1.52 g, 3.30 mmol) in 5 ml trockenem CH 2 CI 2 gegeben. Dann wurde trockenes Pyridin (0.40 ml, 4.95 mmol) unter Eiskühlung hinzugetropft. Die Reaktionslösung wurde 18 Stunden gerührt. Der Niederschlag wurde abfiltriert und es wurde mit 50 ml DCM nachgewaschen. Das Filtrat wurde mit gesättigter NH 4 C1-Lösung (50 ml) gewaschen und die wässrige Phase wurde mit 50 ml CHCI 3 extrahiert. Nach dem Trockenen mit MgS04 wurden die vereinigten organischen Phasen am Rotationsverdampfer eingeengt und der Rückstand wurde mittels Säulenchromatographie (Cyclohexan/EtOAc, 2:1) gereinigt. Ausbeute: 1.27 g (67%); Rf (Cyclohexan/EtOAc, 1 :1) 0.44; l U NMR (300 MHz, CDC1 3 ) δ 8.27 (d, J= 9.2 Hz, 2H), 7.89 (s, 1H), 7.39 (d, J= 9.2 Hz, 2H), 5.00 (dd, J = 12.5, 6.3 Hz, 1H), 4.43 (s, 2H), 3.53 (dd, J = 13.3, 6.5 Hz, 1H), 2.86 - 2.69 (m, 2H), 1.53 (s, 18H), 1.47 (d, J= 6.3 Hz, 3H).

2, 2-Dimethylpropanoyloxy-[ 2-[ 2-[ 2-(4-nitrophenoxy)carbonyloxypropylsulfonyl]ethylamino ]-2-oxo- ethoxy] amino] 2,2-dimethylpropanoate Formel (14)

Zu einer Lösung von P ' (X = O, Ri = Boc, R 2 = OCeH NOj) (1.27 g, 2.15 mmol) in 21 ml Dichlormethan wurde langsam bei Raumtemperatur m-CPBA (0.96 g, 4.30 mmol) gegeben. Nach 12- stündigem Rühren wurde das Reaktionsgemisch zweimal mit einer gesättigten NaHC0 3 -Lösung (15 ml) gewaschen und die organischen Phase nach dem Trocknen mit MgS0 4 im Vakuum konzentriert. Das Sulfon wurde als weißer Feststoff erhalten. Ausbeute: 1.26 g (97%); Rf (Cyclohexan/EtOAc, 1 : 1) 0.29; 'H NMR (300 MHz, CDC1 3 ) δ 8.28 (d, J= 9.3 Hz, 1H), 8.15 (t, J= 5.8 Hz, 1H), 7.41 (d, J= 9.3 Hz, 1H), 5.48 - 5.39 (m, 1H), 4.44 (s, 1H), 3.83 (dd, J = 6.2, 4.2 Hz, 1H), 3.56 (dd, J = 14.9, 8.3 Hz, 1H), 3.37 (t, J = 6.5 Hz, 1H), 3.27 (dd, J = 14.9, 3.9 Hz, 1H), 1.57 (d, J = 6.4 Hz, 1H), 1.54 (s, 7H). 13 C NMR (75 MHz, CDC1 3 ) δ 168.58, 155.42, 151.58, 150.52, 145.67, 125.46, 122.04, 85.60, 77.16, 76.62, 70.63, 58.19, 53.67, 33.07, 28.16, 20.21; ESI-MS: (berechnet MNa+: 628.16 g/mol, gefunden: 628.17 m/z). Synthesen zur Darstellung der Verbindung der Formel (18)

((tert-Butoxycarbonyl)amino)glycin (BS 1 X = NH, Ri = H)

Zu einer methanolischen Lösung (10 ml) von NaOH (0.70 g, 17.4 mmol) und Boc-Hydrazin (1.17 g, 8.7 mmol) wurde bei 0°C Bromessigsäure (1.48 g, 10.4 mmol) gegeben. Die Lösung wurde für 5 Stunden unter Rückfluss erhitzt. Anschließend wurde MeOH entfernt und 50 ml Wasser hinzugegeben. Die wässrige Phase wurde dreimal mit Ethylacetat (50 ml) extrahiert. Anschließend wurde die wässrige Phase mit Zitronensäure auf pH 2 gebracht und dreimal mit 50 ml Ethylacetat extrahiert. Die vereinigten organischen Phasen wurden mit MgS0 4 getrocknet und das Lösungsmittel wurde unter verminderten Druck entfernt. Ausbeute: 0.85 g (51%) weißer Feststoff; Rf (CH 2 CI 2 / MeOH, 8:2) 0.15. l U NMR (300 MHz, DMSO) δ 8.55 (s, 2H), 8.17 (s, 2H), 3.40 (s, 2H), 1.37 (s, 9H); ESI-MS: (berechnet MH+: 191.10 g/mol, gefunden: 191.33 m/z).

N-(tert-Butoxycarbonyl)-N-((tert-butoxycarbonyl)amino)gly cin (BS1 X = NBoc, Rj = H)

Zu einer Lösung aus ((tert-Butoxycarbonyl)amino)glycin (5.00 g, 26.0 mmol) und NaOH (1.57 g, 39.04 mmol) in 104 ml Dioxan/H 2 0 (1 : 1) wurde Boc 2 0 (5.74 g, 26.03 mmol) als Feststoff hinzugegeben. Die Lösung wurde 18 h über Nacht bei Raumtemperatur gerührt und anschließend wurde das Dioxan unter verminderten Druck entfernt. Der wässrige Rückstand wurde mit 100 ml gesättigter NaHC03 Lösung versetzt und es wurde zweimal mit 100 ml Et 2 0 gewaschen. Die wässrige Phase wurde mit Zitronensäure auf pH 2 gebracht. Die weiße Suspension wurde dreimal mit 150 ml Ethylacetat extrahiert. Nach dem Trocknen mit MgS0 4 wurde das Lösungsmittel entfernt wobei sich ein weißer Feststoff bildete. Ausbeute: 7.56 g (quant); Rf (CH 2 C1 2 / MeOH, 9: 1) 0.75; 'H NMR (300 MHz, DMSO) δ 12.34 (s, 1H), 9.24 (s, 1H), 3.56 (s, 2H), 1.46 - 1.32 (m, 18H).

N-(tert-Butoxycarbonyl)-N-((tert-butoxycarbonyl)amino)gly cinyl-N-hydroxylsuccinimid (BS2 X = NBoc, Ri = H)

Zu einer Lösung des N-(tert-Butoxycarbonyl)-N-((tert-butoxycarbonyl)amino)glycin s (1.36 g, 4.45 mmol) in 15 ml Ethylacetat/Dioxan (1 : 1) wurde bei 0 °C N-Hydroxylsuccinimid (0.52 g, 4.45 mmol) und Dicyclohexylcarbodiimid (DCC, 0.93 g, 4.45 mmol) hinzugegeben. Bei Raumtemperatur wurde die Lösung für 15 Stunden rühren gelassen. Anschließend wurde die Suspension wurde über Celite abfiltriert und mit Ethylacetat nachgewaschen. Das Filtrat wurde unter Vakuum zur Trockne konzentriert und wieder in 100 ml Ethylacetat gelöst. Es wurde mit 5%iger NaHC0 3 -Lösung, gesättigter NaCl-Lösung und Wasser (je 100 ml) gewaschen. Die Organische Phase wurde mit MgS0 4 getrocknet und unter Vakuum verdampft wobei 1.24 g (3.20 mmol) Produkt als weißer Schaum erhalten wurde. Ausbeute: 1.51 g (88%); Rf (Cyclohexan / Ethylacetat, 1 : 1) 0.45; 1 H NMR (300 MHz, CDCI 3 ) δ 4.67 (s, 1H), 4.19 (s, 2H), 2.87 (s, 4H), 1.49 (m, 18H).

N-(tert-Butoxycarbonyl)-N-((tert-butoxycarbonyl)amino)gly cinyl-l-((2-aminoethyl)tfc

Amid (BS3: X = NBoc, R } = H) BS2 (X = NBoc, Ri = H, 0.36 g, 0.92 mmol) wurde in 10 ml Dichlormethan mit l-((2- aminoethyl)thio)propan-2-ol (0.13 g, 0.92 mmol) und DIPEA (0.18 ml, 1.01 mmol) gemischt und über Nacht rühren gelassen. Es wurde mit 5 %iger NaHC0 3 -Lösung, gesättigter NaCl-Lösung und Wasser (je 100 ml) gewaschen. Die organische Phase wurde mit MgS0 4 getrocknet und unter Vakuum eingeengt wobei 0.27 g (0.65 mmol) Produkt als weißer Schaum erhalten wurde. Ausbeute: 0.27 g (quant); Rf (CH 2 C1 2 / MeOH, 98:2) 0.36; NMR (300 MHz, CDC1 3 ) δ 8.34 (s, 1H), 6.66 (s, 1H), 4.05 (s, 2H), 3.90 - 3.81 (m, 1H), 3.49 (dd, J = 10.4, 4.0 Hz, 2H), 2.78 - 2.63 (m, 3H), 2.47 (dd, J = 13.7, 8.7 Hz, 1H), 1.49 (s, 9H), 1.46 (s, 9H), 1.23 (d, J= 6.2 Hz, 3H).

[ 2-(2, 2-Dimethylpropanoyloxy)-2-[ 2-[ 2-[ 2-(2, 5-dioxopyrrolidin-l-yl)oxycarbonyloxypropylthionyl] ethylaminoJ-2-oxo-ethylJhydrazinoJ 2,2-dimethylpropanoate P ' (X = O, Rj = Boc, R 2 = ONO 2 C 2 H 4 )

Ν,Ν-Disuccinimidyl carbonat (0.19 g, 0.72 mmol) wurden zu einer Lösung von BS3 (X = NBoc, Ri = H) (0.25 g, 0.72 mmol) in 5 ml trockenem CH 2 CI 2 gegeben. Dann wurde trockenes Pyridin (0.06 ml, 0.73 mmol) unter Eiskühlung hinzugetropft. Die Reaktionslösung wurde 17 Stunden gerührt. Der Lösung wurde 50 ml DCM hinzugefügt. Die organische Phase wurde mit 10%iger Zitronensäure- Lösung gewaschen und mit MgSÜ 4 getrocknet. Die vereinigten organischen Phasen wurden am Rotationsverdampfer eingeengt und der Rückstand wurde mittels Säulenchromatographie (CH 2 Cl 2 /MeOH, 19: 1) gereinigt. Ausbeute: 1.27 g (67%); Rf (CH 2 Cl 2 /MeOH, 9:1) 0.60; 'H NMR (300 MHz, CDCI 3 ) δ 8.53 (d, J = 95.5 Hz, 1H), 7.07 (s, J = 9.0 Hz, 1H), 4.01 (s, 2H), 3.82 (ddd, J = 8.2, 6.1, 3.9 Hz, 1H), 3.41 (d, J = 6.1 Hz, 4H), 2.67 (dt, J = 13.2, 9.3 Hz, 4H), 2.46 (dd, J = 13.7, 8.2 Hz, 2H), 1.44 (s, 9H), 1.41 (s, 9H), 1.18 (t, J = 6.8 Hz, 3H). 13 C NMR (75 MHz, CDC1 3 ) δ 169.71, 162.47, 154.43, 77.16, 66.04, 50.53, 41.57, 39.13, 32.22, 28.18, 28.12, 25.57, 22.06, 18.88.

[ 2-(2, 2-Dimethylpropanoyloxy)-2-[ 2-[ 2-[ 2-(2, 5-dioxopyrrolidin-l-yl)oxycarbonyloxypropylsulfonyl] ethylaminoJ-2-oxo-ethylJhydrazinoJ 2,2-dimethylpropanoate (Formel (18)),

Zu einer Lösung von P ' (X = NBoc, Ri = H, R 2 = ON0 2 C 2 H 4 ) (0.10 g, 0.18 mmol) in 5 ml Dichlormethan wurde langsam bei Raumtemperatur m-CPBA (0.81 g, 0.36 mmol) gegeben. Nach 14- stündigem Rühren wurde das Reaktionsgemisch dreimal mit 5 % NaHCÜ 3 in einer gesättigten NaCl- Lösung (je 33 ml) gewaschen und die organische Phase danach mit MgSÜ 4 getrocknet. Das Lösungsmittel wurde im Vakuum entfernt und das Sulfon wurde als weißer amorpher Feststoff erhalten. Ausbeute: 0.08 g (76%); Rf (CH 2 Cl 2 /MeOH, 9: 1) 0.45 'H NMR (300 MHz, CDC1 3 ) δ 8.48 (s, 1H), 6.95 (s, 1H), 4.39 (dt, J = 15.7, 7.8 Hz, 1H), 4.06 (s, 2H), 3.73 (d, J = 4.3 Hz, 2H), 3.48 - 3.17 (m, 4H), 3.41 (d, J = 6.1 Hz, 2H), 3.02 (d, J= 13.2 Hz, 1H), 2.85 - 2.68 (m, 3H), 1.46 (s, 9H), 1.43 (s, 9H), 1.30 (d, J = 6.4 Hz, 3H); 13 C NMR (75 MHz, CDC1 3 ) δ 170.18, 167.99, 154.71, 133.30, 131.86, 130.13, 129.83, 128.20, 77.16, 62.88, 53.37, 33.53, 28.23, 28.16, 25.57, 23.25. ESI-MS: (berechnet MNa + : 603.19 g/mol, gefunden: 603.06 m/z).

Synthesen zur Darstellung der Verbindung der Formel (15) N-(tert-Butoxycarbonyl)-aminooxyacetyl-l-((2-aminoethyl)thio )propan-2-ol Amid (BS3: X = O, Rj = H)

Kommerziell erhältliches 2-(((tert-Butoxycarbonyl)amino)oxy)essigsäure (1.00 g, 4.73 mmol) wurde in trockenem CH 3 CN (47 ml) gelöst. N-Hydroxysuccinimid (0.66 g, 5.68 mmol) und DCC (1.18 g, 5.68 mmol) wurden nacheinander zu der Lösung gegeben, und das resultierende Reaktionsgemisch wurde bei Raumtemperatur für 1 Stunde gerührt. Danach wurde eine Lösung von l-((2- aminoethyl)thio)propan-2-ol (0.85 g, 5.68 mmol) in 3 ml trockenem CH 3 CN zugegeben und die resultierende Reaktionsmischung bei Raumtemperatur für 18 h gerührt. Das CH 3 CN wurde entfernt und das Konzentrat in 50 ml Ethylacetat aufgenommen. Es wurde mit 10%iger Zitronensäure-Lösung (50 ml) und gesättigter NaCl-Lösung gewaschen. Der erhaltene Rückstand wurde durch Chromatographie auf einer Kieselgelsäule mit einem Stufengradienten von MeOH (1-8%) in CH 2 CI 2 als mobile Phase gereinigt. Der gewünschte Baustein wurde als weißer Schaum erhalten. Ausbeute: 0.26 g (16%); Rf (CH 2 Cl 2 /MeOH, 9: 1) 0.50; NMR (300 MHz, Acetone) δ 8.14 (s, 1H), 4.22 (s, 2H), 3.85 (t, J = 1.6 Hz, 1H), 3.53 - 3.38 (m, 2H), 2.72 - 2.66 (m, 2H), 2.62 - 2.58 (m, 2H), 1.46 (s, 9H), 1.19 (d, J= 6.1 Hz, 3H).

[ 2-[ 2-[ 2-(4-Nitrophenoxy)carbonyloxypropylthionyl]ethylamino ] -2-oxo-ethoxy] amino ] 2, 2- dimethylpropanoat P ' (X = O, Rj = H, R 2 = OC6H 4 PNO 2 )

Bis(4-nitrophenyl)carbonat (0.276 g, 0.90 mmol) wurden zu einer Lösung von BS3 (X = O, Ri = H) (0.24 g, 0.75 mmol) in 5 ml trockenem CH 2 CI 2 gegeben. Dann wurde trockenes Pyridin (0.07 ml, 0.75 mmol) unter Eiskühlung hinzugetropft. Die Reaktionslösung wurde 18 Stunden gerührt. Der Niederschlag wurde abfiltriert und es wurde mit 50 ml DCM nachgewaschen. Das Filtrat wurde mit gesättigter NH 4 C1-Lösung (50 ml) gewaschen und die wässrige Phase wurde mit 50 ml CHCI 3 extrahiert. Nach dem Trockenen mit MgS04 wurden die vereinigten organischen Phasen am Rotationsverdampfer eingeengt und der Rückstand wurde mittels Säulenchromatographie (Cyclohexan/EtOAc, 2:1) gereinigt. Ausbeute: 0.27 g (96%); Rf (Cyclohexan/EtOAc, 1 :1) 0.34; 'H NMR (300 MHz, CDC1 3 ) δ 8.35 (s, 1H), 8.27 (d, J = 9.1 Hz, 2H), 7.58 (s, 1H), 7.40 (d, J = 9.1 Hz, 2H), 5.06 - 4.94 (m, 1H), 4.32 (s, 2H), 3.54 (d, J = 6.3 Hz, 2H), 2.87 - 2.73 (m, 4H), 1.48 (d, J = 4.1 Hz, 3H), 1.47 (s, Hz, 9H).

[ 2-[ 2-[ 2-(4-Nitrophenoxy)carbonyloxypropylsulfonyl]ethylam ino ] -2-oxo-ethoxy Jam ino ] 2, 2- dimethylpropanoate Formel (15)

Zu einer Lösung von P ' (X = O, Ri = Boc, R 2 = OCeH NOj) (0.30 g, 0.59 mmol) in 5 ml Dichlormethan wurde langsam bei Raumtemperatur m-CPBA (0.263 g, 1.18 mmol) gegeben. Nach 12-stündigem Rühren wurde das Reaktionsgemisch zweimal mit einer gesättigten NaHC0 3 -Lösung (15 ml) gewaschen und die organische Phase nach dem Trocknen mit MgSÜ 4 im Vakuum konzentriert. Das Sulfon wurde als weißer Schaum erhalten. Ausbeute: 0.250 g (84%>); Rf (Cyclohexan/EtOAc, 1 : 1) 0.05; 1H NMR (300 MHz, CDC13) δ 8.51 (s, 1H), 8.28 (d, J = 9.2 Hz, 2H), 7.64 (s, 1H), 7.41 (d, J= 9.2 Hz, 3H), 5.47 - 5.35 (m, 1H), 4.33 (s, 2H), 3.88 - 3.79 (m, 2H), 3.57 (dd, J = 14.9, 8.3 Hz, 1H), 3.41 - 3.34 (m, 2H), 3.28 (dd, J = 14.8, 3.8 Hz, 1H), 1.57 (d, J = 6.4 Hz, 3H), 1.48 (s, 9H); 13 C NMR (75 MHz, CDC1 3 ) δ 168.58, 155.42, 151.58, 150.52, 145.67, 125.46, 122.04, 85.60, 77.16, 76.62, 70.63, 58.19, 53.67, 33.07, 28.16, 20.21 ; ESI-MS: (berechnet MH+: 528.16 g/mol, gefunden: 528.15 m/z).

Synthesen zur Darstellung der Verbindung der Formel (16)

Natrium 4-carboxy-2-nitrobenzenesulfonat

Es wurde 4-Sulfamylbenzoesäure in einer Mischung aus 5 ml rauchender HNO 3 und 10 ml H 2 SO 4 (95%) gelöst. Die Reaktionslösung wurde bei 90°C über Nacht gerührt und anschließen mit 100 ml Wasser verdünnt. Bei 0 °C wurde die Säure durch Zugabe von Na 2 C0 3 neutralisiert. Anschließend wurde durch Zugabe von HCl solange angesäuert bis der pH- Wert 2 betrug. Das Wasser wurde entfernt und der Rückstand wurde mit EtOH/iPrOH (1 : 1) extrahiert. Anschließend wurde die organischen Lösungsmittel entfernt wobei das Produkt als brauner Feststoff erhalten wurde. Ausbeute: 6.86 g (61%); Rf (CH 2 Cl 2 /MeOH/AcOH, 7:2: 1) 0.05; l U NMR (300 MHz, MeOD) δ 8.23 (d, J = 1.6 Hz, 1H), 8.17 (d, J = 1.6 Hz, 1H), 8.16 (s, 1H); ESI-MS(neg.): (berechnet (M-Na) " : 245.97 g/mol, gefunden: 296.00 m/z).

Natrium 4-(2-(tert-Butoxycarbonyl)hydrazin-l-carbonyl)-2-nitrobenzol sulfonat

Eine Lösung von i-Butyl-Carbazat (1.91 g, 14.27 mmol) und Natrium 4-carboxy-2-nitrobenzolsulfonat (3.84 g, 14.27 mmol) sowie l -Ethyl-3-(3-dimethylaminopropyl)carbodiimid (2.76 g, 14.27 mmol) wurde in 60 ml Methanol/H 2 0 (1 :1) über Nacht bei Raumtemperatur gerührt. Die Lösungsmittel wurden unter verminderten Druck entfernt und der Rückstand wurde mittels Säulenchromatographie (CH 2 Cl 2 /MeOH, 9:1) gereinigt. Eine Lösung von i-Butyl-Carbazat (1.91 g, 14.27 mmol) und Natrium 4-carboxy-2-nitrobenzolsulfonat (3.84 g, 14.27 mmol) sowie l -Ethyl-3-(3- dimethylaminopropyl)carbodiimid (2.76 g, 14.27 mmol) wurde in 60 ml Methanol/H 2 0 (1 : 1) über Nacht bei Raumtemperatur gerührt. Die Lösungsmittel wurden unter verminderten Druck entfernt und der Rückstand wurde mittels Säulenchromatographie (CH 2 Cl 2 /MeOH, 9: 1) gereinigt. Ausbeute: 6.86 g (61%); Rf (CH 2 Cl 2 /MeOH/AcOH, 7:2: 1) 0.30; 'H NMR (300 MHz, DMSO) δ 10.46 (s, 1H), 9.04 (s, 1H), 8.01 (d, J = 1.5 Hz, 1H), 7.99 (d, J = 1.5 Hz, 1H), 7.96 (s, 1H), 1.43 (s, 9H); ESI-MS(neg.): (berechnet (M-Na) " : 360.05 g/mol, gefunden: 360.00 m/z). tert-Butyl 2-(4-(chlorosulfonyl)-3-nitrobenzoyl)hydrazin-l-carboxylat

Zu einer Lösung von Natrium 4-(2-(tert-butoxycarbonyl)hydrazin-l -carbonyl)-2-nitrobenzolsulfonat (0.55 g, 1.42 mmol) und 18-Krone-6 Ether (0.02 g, 0.07 mmol) wurde Cyanurchlorid (0.26 g, 1.42 mmol) in trockenem Aceton gegeben. Die Lösung wurde für 18 h unter Rückfluss erhitzt. Nach dem Abkühlen wurde die Reaktionsmischung über Celite filtriert und mittels Säulenchromatographie gereinigt (CH 2 Cl 2 /MeOH, 9: 1). Ausbeute: 0.23 g (43%); 'H NMR (300 MHz, CDC1 3 ) δ 10.18 (s, 2H), 8.22 (d, J = 0.5 Hz, 1H), 8.22 (dd, J = 1.7, 0.5 Hz, 1H), 8.18 (d, J = 1.6 Hz, 1H), 8.15 (d, J = 0.6 Hz, 1H), 1.23 (s, 9H); ESI-MS(neg.): (berechnet (M) " : 379.02 g/mol, gefunden: 378.92 m/z).

Synthesen zur Darstellung der Verbindung der Formel (20)

6-Azidoisobenzofuran-l (3H)-on

Eine klare Lösung von 6-Amino-phtalid (2.50 g, 15.92 mmol) in IM HCl (28 ml) wurde auf 0°C gekühlt und mit 3 ml einer wässrigen Lösung aus NaN0 2 (1.66 g, 13.89 mmol) tropfenweise versetzt. Die so erhaltene Suspension wurde für 10 min bei 0°C gerührt und mit 10 ml einer Lösung aus NaN 3 (2.09 g, 31.85 mmol) tropfenweise bei 0°C versetzt (heftige HN 3 -Gasentwicklung!, Schaumbildung). Die schaumige Suspension wurde eine Stunde bei 0°C gerührt. Der Niederschlag wurde abgesaugt und mit mehrfach mit insgesamt 300 ml Wasser gewaschen. Der braune Feststoff wurde zerstoßen und im Trockenschrank über Nacht getrocknet. Anschließend wurde er in 300 ml CH 2 CI 2 gelöst und ab filtriert. Das Filtrat wurde unter Vakuum vom Lösungsmittel befreit wobei ein hellbrauner Feststoff erhalten wurde. Ausbeute: 2.53 g (91%); Rf (CH 2 Cl 2 /MeOH/AcOH, 7:2: 1) 0.30; 'H NMR (300 MHz, CDCI 3 ) δ 7.58 (d, J = 1.9 Hz, 1H), 7.47 (dd, J = 8.2, 0.7 Hz, 1H), 7.31 (dd, J = 8.2, 2.1 Hz, 1H), 5.31 (s, 2H); ESI-MS: (berechnet (MH) + : 176.05 g/mol, gefunden: 176.23 m/z).

5- Azido-2-(hydroxymethyl)benzohydrazid

6- Azidoisobenzofuran-l(3H)-on (0.50 g, 2.83 mmol) wurden in 6 ml Dimethylformamid (DMF) gelöst und es wurde Hydrazinhydrat (0.71 ml, 14.13 mmol) hinzugegeben und die Lösung wurde bei 70 °C für 3 Stunden gerührt. Das DMF und das Hydrazinhydrat wurden unter Vakuum entfernt. Der Rückstand wurde mittels Säulenchromatographie (CH 2 Cl 2 /MeOH, 9: 1) gereinigt, wobei ein hellgelbes Pulver erhalten wurde. Ausbeute: 0.10 g (17%). Rf (CH 2 Cl 2 /MeOH, 9:1) 0.53; 'H NMR (300 MHz, DMSO) δ 9.62 (s, 1H), 7.57 (d, J = 8.3 Hz, 1H), 7.20 (dd, J = 8.3, 2.4 Hz, 1H), 7.09 (d, J = 2.4 Hz, 1H), 5.31 - 5.21 (m, 1H), 4.57 (d, J = 5.7 Hz, 2H), 4.50 (s, 2H), 3.33 (s, 2H), ESI-MS: (berechnet (MH) + : 208.08 g/mol, gefunden: 207.90 m/z), (berechnet (MNa) + : 230.07 g/mol, gefunden: 230.01 m/z).

tert-Butyl 2-(5-azido-2-(hydroxymethyl)benzoyl)hydrazin-l-carboxylat

5-Azido-2-(hydroxymethyl)benzohydrazid (0.10 g, 0.48 mmol) wurden in Dioxan/EtOAc/z ' PrOH (1 : 1 : 1) 10 ml gelöst und mit Boc-Anhydrid (0.105 g, 0.48 mmol) und DIPEA (0.10 ml, 0.57 mmol) versetzt. Die Lösung wurde bei Raumtemperatur 12 Stunden gerührt und anschließend wurde das Lösungsmittel unter verminderten Druck entfernt. Der Rückstand wurde in 50 ml CH 2 C1 2 aufgenommen und zweimal mit einer 10%>igen Zitronensäure Lösung gewaschen (je 50 ml). Nach dem Trocknen mit MgSÜ 4 und entfernen des organischen Lösungsmittel wurde ein gelbliches Öl erhalten. Ausbeute: 0.10 g (67%). Rf (CH 2 Cl 2 /MeOH, 9:1) 0.75; 'H NMR (300 MHz, DMSO) δ 10.06 (s, 1H), 9.04 (d, J= 30.3 Hz, 1H), 7.69 - 7.58 (m, 1H), 7.25 (dd, J= 8.3, 2.4 Hz, 1H), 7.10 (d, J= 1.3 Hz, 1H), 5.28 (t, J = 5.7 Hz, 1H), 4.62 (d, J = 5.6 Hz, 2H), 1.43 (s, 9H); ESI-MS: (berechnet (MNa) + : 330.12 g/mol, gefunden: 330.29 m/z).

tert-Butyl 2-(5-azido-2-( ((((2, 5-dioxopyrrolidin-l-yl)oxy)carbonyl)oxy)methyl)benzoyl)hydra zin-l- carboxylat

Ν,Ν-Disuccinimidyl carbonat (0.105 g, 0.41 mmol) wurden zu einer Lösung von tert-Butyl 2-(5- azido-2-(hydroxymethyl)benzoyl)hydrazin-l-carboxylat (0.105 g, 0.34 mmol) in 5 ml trockenem Dimehtylformamid gegeben. Dann wurde trockenes Pyridin (0.03 ml, 0.41 mmol) hinzugetropft. Die Reaktionslösung wurde 17 Stunden bei Raumtemperatur gerührt. Das Lösungsmittel wurde unter Vakuum entfernt. Der Lösung wurde 50 ml DCM hinzugefügt. Die organische Phase wurde mit 10%iger Zitronensäure-Lösung gewaschen (2x 50 ml) und mit MgS0 4 getrocknet. Die vereinigten organischen Phasen wurden am Rotationsverdampfer eingeengt und der Rückstand wurde mittels Säulenchromatographie (CH 2 Cl 2 /MeOH, 19:1) gereinigt. Ausbeute: 0.06 g (40%). Rf (CH 2 Cl 2 /MeOH, 19: 1) 0.45; 'H NMR (300 MHz, DMSO) δ 10.06 (s, J = 10.9 Hz, 1H), 8.99 (s, J = 8.4 Hz, 1H), 7.62 (d, J = 8.3 Hz, 1H), 7.53 (s, 1H), 7.25 (dd, J = 8.3, 2.4 Hz, 1H), 5.76 (s, 2H), 3.34 (s, 4H), 1.43 (s, 9H), ESI-MS: (berechnet (MNa) + : 471.12 g/mol, gefunden: 471.25 m/z).

Synthesen zur Darstellung der Verbindung der Formel (21)

6-Methoxyisobenzofuran-l (3H)-on

Eine Mischung aus 3-Methoxybenzoesäure (10.00 g, 65.07 mmol) , 37% iger Formalin-Lösung (7.5 ml, 80 mmol), 37%> iger HCl (8.00 ml) und 75 ml 100%) iger Essigsäure wurde unter Rückfluss 18 Stunden erwärmt. Nach dem Abkühlen wurde die klare Lösung wird der Rührer abgeschaltet und 14 Stunden bei dieser Temperatur belassen. Die Essigsäure wurde bei 80 °C im Luftstrom entfernt. Der Rückstand wurde in 150 ml Toluol aufgenommen und auf 40 ml konzentriert. Die 80 °C heiße Lösung wurde mit 40 ml Portionen 20%> iger Na 2 C0 3 -Lösung (3 -mal) und mit 40 ml Wasser gewaschen. Nach Zugabe von 3 ml Morpholin wurde die organische Phase 2 h bei 80 °C gerührt und dann mit 50 ml Portionen 1 Oprozentiger H 2 4 (3 -mal) und Wasser gewaschen. Zur Kristallisation des Produkts wurde das Gemisch auf 25 ml konzentriert und das Gemisch wurde gerührt. Das Produkt wurde durch Abfiltrieren in Form von weißen Kristallen erhalten. Ausbeute: 3.52 g (33%>). 'H NMR (300 MHz, DMSO) δ 7.58 (dd, J = 8.3, 0.7 Hz, 1H), 7.35 (dd, J = 8.3, 2.4 Hz, 1H), 7.31 (d, J = 2.2 Hz, 1H), 5.34 (s, 2H), 3.84 (s, 3H).

6-Hydroxyisobenzofuran-l (3H)-on

Stickstoffatmosphäre wurde 6-Methoxyisobenzofuran-l (3H)-on (3.00 g, 18.09 mmol) in wasserfreiem Dichlormethan (100 ml) gelöst. Die resultierende Mischung wurde magnetisch gerührt und im Eisbad für 10 min gekühlt. Danach wurde BBr 3 (3.46 ml, 36.18 mmol) zugetropft. Dann wurde sich das Reaktionsgemisch auf Raumtemperatur erwärmen lassen und 12 Stunden gerührt. Anschließend wurde 5 ml Wasser zugegeben, und das Gemisch wurde in einen Scheidetrichter überführt und mit Ethylacetat (3 x 100 ml) extrahiert. Die vereinigten organischen Extrakte wurden über Magnesiumsulfat getrocknet, filtriert und unter reduziertem Druck konzentriert, wobei ein weißer Feststoff erhalten wurde. Ausbeute: 1.52 g (56%). l H NMR (300 MHz, DMSO) δ 10.08 (s, 1H), 7.47 (dd, J = 8.3, 0.6 Hz, 1H), 7.19 (d, J = 2.3 Hz, 1H), 7.16 (d, J = 2.3 Hz, 1H), 7.10 (d, J = 2.0 Hz, 1H), 5.28 (s, 2H); ESI-MS: (berechnet (MH) + : 151.04 g/mol, gefunden: 151.05 m/z).

5- Azido-2-(hydroxymethyl)benzohydrazid

6- Hydroxyisobenzofuran-l(3H)-on (0.43 g, 2.83 mmol) wurden in 6 ml Dimethylformamid (DMF) gelöst und es wurde Hydrazinhydrat (1.42 ml, 28.26 mmol) hinzugegeben und die Lösung wurde bei 100 °C für 3 Stunden gerührt. Das DMF und das Hydrazinhydrat wurden unter Vakuum entfernt. Der Rückstand wurde mittels Säulenchromatographie (CH 2 Cl 2 /MeOH, 9: 1) gereinigt, wobei ein hellgelbes Pulver erhalten wurde. Ausbeute: 0.10 g (17%). Rf (CH 2 Cl 2 /MeOH, 9:1) 0.40; 'H NMR (300 MHz, DMSO) δ 10.08 (s, 1H), 9.73 (s, 1H), 7.47 (d, J= 8.3 Hz, 1H), 7.18 (dd, J = 8.3, 2.3 Hz, 1H), 7.10 (d, J = 2.3 Hz, 1H), 4.57 (d, J = 5.7 Hz, 2H), 4.50 (s, 2H), 3.33 (s, 2H), ESI-MS: (berechnet (MH) + : 183.08 g/mol, gefunden: 183.15 m/z).

Exemplarische Reinigung mit Fängermolekül (14)

Die Reinigung wurde mit einem weiteren Beispielpeptid 14 (AKADEVSLHKWYG; SEQ ID NO: 10) und einem Linker nach Formel (14) (Fängermolekül 14) auf kommerziell erhältlicher, Aldehydmodifizierter Agarose (High Density Glyoxal, 6BCT von ABT) durchgeführt.

Festphasenpeptidsynthese der Peptide sowie Reinigung

Die automatisierte Festphasenpeptidsynthese erfolgte in 100 μιηοΐ Ansätzen, mit einem MultiPep RS- Peptidsyntheseautomaten der Firma Intavis AG. Die Synthese wurde an einem Wang-Harz (1.0-1.4 mmol/g) der Firma Carl Roth durchgeführt. Vor dem Beginn der Synthese wurde die entsprechende Menge an Peptid-Syntheseharz in 5 mL Spritzenreaktoren (PE-Reaktor der Firma Intavis) eingewogen und in DMF gequollen. Die Einwaage an Äquivalenten an Aminosäure bezog sich, sofern nicht anders erwähnt, auf die Erstbeladung des eingesetzten Harzes.

Fmoc-Abspaltung:

Zur Abspaltung der temporären Fmoc-Schutzgruppen wurde das Harz einmal 5 min und ein weiteres Mal 8 min mit 1500 μΕ Piperidin/DMF (4: 1) behandelt und nachfolgend siebenmal mit 10.2 mL DMF gewaschen und es wurde mit der Kupplung der Fmoc- Aminosäurederivate fortgefahren.

Kupplung der Fmoc-Aminosäurederivate:

Eine Lösung von 5 eq. Aminosäure in DMF (0.3 M) wurde 1 min bei Raumtemperatur mit Lösungen von 4.5 eq. HCTU in DMF (0.3 M) und 10 eq. NMM in DMF (0.6 M) voraktiviert und anschließend zum Harz gegeben. Nach 30 min Reaktionszeit wurde das Harz dreimal mit 10.2 mL DMF gewaschen und es wurde mit dem Blockieren der Abbruchsequenzen fortgefahren. Blockieren der Abbruchsequenzen:

Das Harz wurde zweimal 5 min mit 1.5 mL einer Lösung von AC 2 0/2,6-Lutidin/DMF (5:6:89) behandelt und nachfolgend siebenmal mit je 10.2 mL DMF gewaschen.

Letzter Schritt Kopplung des Fängermoleküls:

Als letzter Schritt der Festphasenpeptidsynthese wurde das Fängermolekül (14) auf das gewünschte Zielpeptid (50 μιηοΐ) gekuppelt. Es wurde das Syntheseharz mit einer Lösung aus 4 eq. Fängermolekül (0.3 M), 6 eq. HOBt in DMF (0.4 M) und 4 eq. DIPEA in DMF (0,3 M) gemischt. Nach 60 min Reaktionszeit wurde zweimal mit je 2 mL DMF, zweimal mit 2 mL CH 2 CI 2 und anschließend wieder zweimal mit 2 mL DMF gewaschen.

Alternativer letzter Schritt der Acetylierung des Vollängenpeptids:

Analog zur Vorschrift zur Blockierung der Abbruchsequenzen wurde das Vollängenpeptid als Kontrollprobe ebenfalls acetyliert (Peptid- Acetyliert).

Freisetzung vom polymeren Träger:

Das Harz wurde mit 3 mL einer Lösung von 95% TFA, 2.5% Wasser und 2.5% Triisopropylsilan, behandelt. Das Syntheseharz wurde mit dieser Abspaltmischung versetzt und 3 h bei Raumtemperatur geschüttelt. Anschließend wurde die Abspaltlösung aufgefangen und das Harz zweimal mit je 1 mL TFA nachgewaschen. Die Abspaltlösung wurde mit den Waschlösungen vereinigt und durch Argonstrom eingeengt auf ca. 1 mL Volumen. Anschließend wurde mit 10 mL kaltem Diethylether gefällt und anschließend der Niederschlag abzentrifugiert. Der Überstand wurde verworfen. In Fig. 4h (oben) ist das Chromatogramm des Peptids ohne Linker vor der Reinigung mit einer Reinheit von 45% gezeigt.

Reinigung

Der krude Niederschlag (etwa 5 μιηοΐ theoretische Ausbeute) wurde in Konjugationspuffer (0.1 M NH 4 OAc, 0.1 M Anilin, pH = 3.8) aufgenommen. Wenn sich die Mischung nicht vollständig löste, wurde Acetonitril zugegeben. In einen 3 mL Spritzenreaktor mit einem 25 μιη PE Vorfilter wurden 400 μΕ (-160 mg) Agarose gegeben. Das Reinigungsharz wurde dann durch 3 -maliges Waschen mit Konjugationsspuffer (0.1 M NH 4 OAc, 0.05 M Anilin, pH = 3.8) konditioniert. Die Peptidlösung wurde dann auf das Reinigungsharz gegeben. Die Immobilisierung wurde anschließend 60 min durchgeführt. Danach wurde dreimal mit Konjugationspuffer, dreimal mit einer 5 M Harnstoff Lösung, dreimal mit 70%igem Ethanol und schließlich fünfmal mit Wasser gewaschen. Das Gemisch wurde dann basisch mit 5 v% NH 4 OH in Wasser behandelt, um konjugiertes Peptid vom Harz zu spalten. Lyophilisieren liefert das Peptid als weißen flockigen Feststoff. Nachweis Immobilisierung

Um die Immobilisierung eindeutig nachzuweisen, wurde in diesem Experiment acetyliertes Peptid, sowie Peptid mit gebundenem Linker sowohl auf modifizierter, als auch auf reiner Agarose (6% B Agarose Bead STANDARD, ABT) mit PEC gereinigt. Das Eluat nach der Linkerspaltung wurde jeweils mittels UPLC-UV vermessen. Im Ergebnis zeigte sich, dass nach der Spaltung lediglich bei Peptid mit gebundenem Linker auf modifiziertem Reinigungsharz ein signifikantes Signal mit der Produktmasse detektiert wird. Zusätzlich erkennt man, dass auch bei reiner Agarose etwa 2.3% Produkt im Vergleich zu modifizierter Agarose erhalten wird.

Tabelle 3 : Integrale über den Produktpeak für die Peptide nach Reinigung mit modifizierter und nicht modifizierter Agarose

Peptid-Linker Peptid-Acetyliert

Agarose modifizierte Agarose Agarose modifizierte Agarose

Integral (μν*8) 17759 763044 197 131

Anteil 2.31% 100% 0.03% 0.02%

Regenerierung des Reinigungsharzes

Nach der Peptidreinigung mit dem Fängermolekül (14) bleibt die ursprüngliche Aldehydfunktion von 1 mit dem Hydroxyl-modifizierten Fängermolekül blockiert zurück. Um das Reinigungsharz wieder für einen neuen Reinigungszyklus bereit zu stellen, muss das Harz regeneriert und somit die Aldehydfunktion wiederhergestellt werden. Dies gelingt bei Verschieben des Gleichgewichtes durch Zugabe von Aldehyden oder Ketonen. Die Regenration für wiederholte Reinigungszyklen wurde wie folgt gezeigt:

Es wurden zwei Reinigungen von Peptid 14 simultan durchgeführt (Reinigung I). Anschließend wurde das Reinigungsharz für die Regeneration je viermal mit einer Mischung aus Wasser, Aceton und TFA (Keton, 49.95:49.95:0.1), bzw. Wasser, Acetaldehyd und TFA (Aldehyd, 89.95:9.95:0.1) und 5-mal mit Wasser gewaschen. Danach erfolgte die Reinigung inklusive der Konditionierung analog zum oben beschriebenen Vorgehen. Die Regeneration und Reinigung wurde insgesamt dreimal durchgeführt (Reinigung II - IV) und das lyophilisierte Produkt je in gleichen Volumina Wasser, Acetonitril und TFA (69.9:29.9:1) aufgenommen und mittels UPLC-MS vermessen.

Tabelle 4: Integrale über den Produktpeak und prozentualer Anteil für die Peptide nach Reinigung mit modifizierter Agarose (Reinigung I) und nach drei Regenrationszyklen (Reinigung II - IV).

Keton Aldehyd

Reinigung Integral (μν*8) Anteil Reinheit Integral (μν*8) Anteil Reinheit

I 4100144 100% 58,9% 2138955 100% 58,2%

II 2044538 50% 58,5% 911365 43% 58,7%

III 1719147 42% 57,8% 567140 27% 58,6%

IV 381717 9% 61,5% 576371 27% 59,8% Im Ergebnis zeigte sich, dass sich in beiden Fällen das Harz regenerieren lässt. Die Regenerierung mit einem Keton fällt erst im dritten Zyklus (Reinigung IV) deutlich ab. Im Unterschied dazu verbleibt die Reinigungskapazität bei der Aldehyd-Regenerierung bei etwa einem Viertel der Ausgangskapazität, fällt dafür aber schon nach dem zweiten Zyklus (Reinigung III) auf diesen Wert. Bei beiden Experimenten konnte eine Reinheit von etwa 60% erzielt werden, die konstant über die Regenerationszyklen erhalten bleibt (Beispielchromatogramm zu Reinigung I, Aldehyd, Fig. 4h (unten)).