Login| Sign Up| Help| Contact|

Patent Searching and Data


Title:
MEANS FOR TREATING MICROBIAL DISEASES IN CULTIVATED PLANTS
Document Type and Number:
WIPO Patent Application WO/2012/130221
Kind Code:
A2
Abstract:
The invention addresses the problem of developing an environmentally compatible, storable and long-acting agent against phytopathogenic microorganisms, especially fungi, on the basis of defined biological factors. Said problem is solved by an antifungal agent for treating fungal and other microbial and viral infections, which is prepared on the basis of spores of Bacillus amyloliquefaciens plantarum. Representatives of said taxonomic group have the ability to form at least ten different antimicrobial substances which belong to the families of dipeptides (bacilysin), lipopeptides and siderophores (bacillomycin D, fengycin, surfactin and bacillibactin), polyketides (difficidin, bacillaene and macrolactin) and the group consisting of bacteriocins/microcins (amylocyclicin and plantazolicin). The new strain B. amyloliquefaciens plantarum AB101 is characterised by improved persistence in the area of the plant rhizospere and increased effectiveness against the root rot disease ("black scurf") in potatoes caused by Rhizoctonia solani. The bacteriocin amylocyclicin produced from AB101 is a previously unknown bacteriocin having a strong effect against gram-positive bacteria. The invention can be used in plant protection, biotechnology and agriculture.

Inventors:
BORRISS RAINER (DE)
Application Number:
DE2012/000326
Publication Date:
October 04, 2012
Filing Date:
March 24, 2012
Export Citation:
Click for automatic bibliography generation   Help
Assignee:
ABITEP GMBH (DE)
BORRISS RAINER (DE)
Domestic Patent References:
WO2000029426A12000-05-25
Foreign References:
US6960342B22005-11-01
US6015553A2000-01-18
US20040265292A12004-12-30
US6524998B12003-02-25
EP1449914A12004-08-25
Other References:
BORRISS, R. ET AL.: "Relationship of Bacillus amyloliquefaciens clades associated with strains DSM7T and FZB42; a proposal for Bacillus amyloliquefaciens subsp. amyloliquefaciens subsp. nov. and Bacillus amyloliquefaciens subsp. plantarum subsp. nov. based on their discriminating complete genome sequences.", IJSEM, 3 September 2010 (2010-09-03)
KOUMOUTSI, A.; X. H. CHEN; A. HENNE; H. LIESEGANG; G. HITZEROTH; P. FRANKE; J. VATER; R. BORRISS: "Structural and functional characterization of gene clusters directing nonribosomal synthesis of bioactive cyclic lipopeptides in Bacillus amyloliquefaciens strain FZB42.", J BACTERIOL., vol. 186, 2004, pages 1084 - 96
LE BRETON, Y.; N. P. MOHAPATRA; W. G. HALDENWANG.: "In vivo random mutagenesis of Bacillus subtilis by use of TnYLB-1, a mariner-based transposon.", APPL ENVIRON MICROBIOL, vol. 72, 2006, pages 327 - 33
WIRAWAN, R. E.; K. M. SWANSON; T. KLEFFMANN; R. W. JACK; J. R. TAGG.: "Uberolysin: a novel cyclic bacteriocin produced by Streptococcus uberis.", MICROBIOLOGY., vol. 153, 2007, pages 1619 - 30
CHEN, X.-H ET AL.: "Structural and functional characterization of three polyketide synthase gene clusters in Bacillus amyloliquefaciens FZB42.", J. BACTERIOL., vol. 186, 2006, pages 4024 - 4036
CHEN, X-H.; KOUMOUTSI, A.; SCHOLZ, R.; BORRISS, R.: "More than anticipated-Production of antibiotics and other secondary metabolites by Bacillus amyloliquefaciens FZB42.", J. MOL. MICROBIOL. BIOTECHNOL, vol. 16, 2009, pages 14 - 24
GUSTAFSON, K.; M. ROMAN; W. FINICAL: "The macrolactins, a novel class of antiviral and cytotoxic macrolides from a deep-sea marine bacterium.", J. AM. CHEM. SOC., vol. 111, 1989, pages 7519 - 7524
LANDY, M. ET AL.: "Bacillomycin, an antibiotic from Bacillus subtilis active against pathogenic fungi.", PROC. SOC. EXP. BIOL. MED., vol. 67, 1948, pages 539 - 541
LEENDERS, F.; T. H. STEIN; B. KABLITZ; P. FRANKE; J. VATER.: "Rapid typing of Bacillus subtilis strains by their secondary metabolites using matrix assisted laser desorptionfionization mass spectrometry of intact cells.", RAPID COMMUN. MASS SPECTROM., vol. 13, 1999, pages 943 - 949
NISHIKORI T.; H. NAGANAWA; Y. MURAOKA; T. AOYAGI; H. UMEZAWA: "Plipastatins: new inhibitors of phospholipase A2, produced by Bacillus cereus BMG302-fF67. 111. Structural elucidation of plipastatins.", J. ANTIBIOT., vol. 39, 1986, pages 755 - 761
PEYPOUX, F.; J. M. BONMATIN; J. WALLACH: "Recent trends in the biochemistry of surfactin.", APPL. MICROBIOL. BIOTECHNOL., vol. 51, 1999, pages 553 - 563
SCHOLZ ET AL.: "Plantazolicin, a novel microcin B171streptolysin S-like natural product from Bacillus amyloliquefaciens FZB42.", J. BACTERIOL., vol. 193, 2011, pages 215 - 224
STEINBORN, G.; HAJIREZAEI, M-R; HOFEMEISTER, J.: "Bac genes for recombinant bacilysin and anticapsin production in Bacillus host strains.", ARCH MICROBIOL, vol. 183, 2005, pages 71 - 79
THIMON, L.; PEYPOUX, F.; WALLACH, J.; MICHEL, G.: "Effect of the lipopeptide antibiotic, iturin A on morphology and membrane structure of yeast cells.", FEMS MICROBIOL. LETT., vol. 128, 1995, pages 101 - 106
ZIMMERMAN, S.B.; C. D. SCHWARTZ; R. L. MONAGHAN; B. A. BELAK ET AL.: "Difficidin and oxydifficidin: novel broad spectrum antibacterial antibiotics produceed by Bacillus subtilis. 1. Production, taxonomy and antibacterial activity.", J. ANTIBIOT., vol. 40, 1987, pages 1677 - 1681
BORRISS R; CHEN X; RUECKERT C; BLOM J; BECKER A; BAUMGARTH B; FAN B; PUKALL R; SCHUMANN P; SPRÖER C: "Relationship of Baci!!us amylo!iquefaciens clades associated with strains DSM7T and FZB42: a proposal for Bacillus amyloliquefaciens subsp. amyloliquefaciens subsp. nov. and Bacillus amyloliquefaciens subsp. plantarum subsp. nov. based on their discriminating complete genome sequences.", INT J SYST EVOL MICROBIOL., 3 September 2010 (2010-09-03)
RÜCKERT C; BLOM J; CHEN X; REVA 0; BORRISS R; J BIOTECHNOL.: "Genome sequence of B. amyloliquefaciens type strain DSM7 (T) reveals differences to plant-associated B. amyloliquefaciens FZB42.", J BIOTECHNOL., 22 January 2011 (2011-01-22)
FAN B; CHEN XH; BUDIHARJO A; BLEISS W; VATER J; BORRISS R.: "Efficient colonization of plant roots by the plant growth promoting bacterium Bacillus amyloliquefaciens FZB42, engineered to express green fluorescent protein", J BIOTECHNOT., 13 January 2011 (2011-01-13)
SCHOLZ R; MOLOHON KJ; NACHTIGALL J; VATER J; MARKLEY AL; SÜSSMUTH RD; MITCHELL DA; BORRISS R.: "Plantazolicin, a nove! microcin B171streptolysin S-like natural product from Bacillus amyloliquefaciens FZB42.", J BACTERIOL., vol. 193, no. 1, January 2011 (2011-01-01), pages 215 - 24
CHEN XH; KOUMOUTSI A; SCHOLZ R; SCHNEIDER K; VATER J; SÜSSMUTH R; PIEL J; BORRISS R: "Genome analysis of Bacillus amyloliquefaciens FZB42 reveals its potential for biocontrol of plant pathogens", J BIOTECHNOL., vol. 140, no. 1-2, 10 March 2009 (2009-03-10), pages 27 - 37
CHEN XH; KOUMOUTSI A; SCHOLZ R; BORRISS R.: "More than anticipated - production of antibiotics and other secondary metabolites by Bacillus amyloliquefaciens FZB42.", J MOL MICROBIOL BIOTECHNOL., vol. 16, no. 1-2, 2009, pages 14 - 24
CHEN XH; KOUMOUTSI A; SCHOLZ R; EISENREICH A; SCHNEIDER K; HEINEMEYER I; MORGENSTERN B; VOSS B; HESS WR; REVA 0: "Comparative analysis of the complete genome sequence of the plant growth-promoting bacterium Bacillus amyloliquefaciens FZB42.", NAT BIOTECHNOL., vol. 25, no. 9, September 2007 (2007-09-01), pages 1007 - 14
IDRIS EE; IGLESIAS DJ; TALON M; BORRISS R.: "Tryptophan-dependent production of indole-3-acetic acid (IAA) affects level of plant growth promotion by Bacillus amyloliquefaciens FZB42.", MOL PLANT MICROBE INTERACT., vol. 20, no. 6, June 2007 (2007-06-01), pages 619 - 26
CHEN XH; VATER J; PIEL J; FRANKE P; SCHOLZ R; SCHNEIDER K; KOUMOUTSI A; HITZEROTH G; GRAMMEL N; STRITTMATTER AW: "Structural and functional characterization of three polyketide synthase gene clusters in Bacillus amyloliquefaciens FZB 42.", J BACTERIOL., vol. 188, no. 11, June 2006 (2006-06-01), pages 4024 - 36
KOUMOUTSI A; CHEN XH; HENNE A; LIESEGANG H; HITZEROTH G; FRANKE P; VATER J; BORRISS R: "Structural and functional characterization of gene clusters directing nonribosomal synthesis of bioactive cyclic lipopeptides in Bacillus amyloliquefaciens strain FZB42.", J BACTERIOL., vol. 186, no. 4, February 2004 (2004-02-01), pages 1084 - 96
IDRISS EE; MAKAREWICZ 0; FAROUK A; ROSNER K; GREINER R; BOCHOW H; RICHTER T; BORRISS R.: "Extracellular phytase activity of Bacillus amyloliquefaciens FZB45 contributes to its plant-growth-promoting effect.", MICROBIOLOGY, vol. 148, July 2002 (2002-07-01), pages 2097 - 109
SAMBROOK, J.; FRITSCH, E.F.; MANIATIS, T: "Molecular cloning a laboratory manual(2th ed.)", 1989, CSHLP
Attorney, Agent or Firm:
BAUMBACH, F. (DE)
Download PDF:
Claims:
Patentansprüche

1. Mittel zur Behandlung von mikrobiellen Erkrankungen bei Kulturpflanzen, dadurch gekennzeichnet, dass es einen Stamm der Subspezies Bacillus amyloliquefaciens subsp. plantarum enthält.

2. Mittel nach Anspruch 1 , dadurch gekennzeichnet, dass es den Stamm Bacillus amyloliquefaciens subsp. plantarum ABI01 enthält.

3. Mittel nach Anspruch 1 , dadurch gekennzeichnet, dass es eine flüssige Sporensuspension enthält.

4. Mittel nach Anspruch 1 und 3, dadurch gekennzeichnet, dass die Sporensuspension mindestens 1 x 1010 Sporen/ml enthält.

5. Mittel nach Anspruch 1 , dadurch gekennzeichnet, dass es ein Trockenpräparat („Trocken beize") enthält.

6. Mittel nach Anspruch 1 und 5, dadurch gekennzeichnet, dass das Trockenpräparat („Trocken beize") mindestens 2 x 1010 Sporen/g enthält.

7. Mittel nach Anspruch 1 , dadurch gekennzeichnet, dass es ein Flüssig-Konzentrat, gewonnen aus einer Bacillus amyloliquefaciens subsp. plantarum Kultur, mit einer Lipopeptidkonzentration von mindestens 1 g/L enthält.

8. Mittel nach Anspruch 1 , dadurch gekennzeichnet, dass es ein Flüssig-Konzentrat, gewonnen aus einer Bacillus amyloliquefaciens subsp. plantarum Kultur, mit einer Bacillomyctn D Konzentration von mindestens 1 g/L enthält.

9. Mittel nach Anspruch 1 , dadurch gekennzeichnet, dass es ein Flüssig-Konzentrat, gewonnen aus einer Bacillus amyloliquefaciens subsp. plantarum Kultur, mit einer Lipopeptidkonzentration von mindestens 1 g/L, und einem Sporengehalt von mindestens 1 x 1010 Sporen/ g (ml) enthält.

10. Mittel nach Anspruch 1 , dadurch gekennzeichnet, dass es ein Flüssig- Konzentrat, gewonnen aus einer Bacillus amyloliquefaciens subsp. plantarum Kultur, mit einer Bacillomycin D Konzentration von mindestens 1 g/L, und einem Sporengehalt von mindestens 1 x 10 0 Sporen/g (ml) enthält.

11. Verwendung der Mittel nach Anspruch 1 und 3 bis 6 als Gießpräparate während der Pflanzung.

12. Verwendung der Mittel nach Anspruch 1 und 7 bis 10 als Blattsprühmittel zu einem späteren Zeitpunkt.

13. Verwendung der Mittel nach Anspruch 1 und 3 bis 10 kombiniert als Gießpräparat während der Pflanzung und als Blattsprühmittel zu einem späteren Zeitpunkt.

14. Bacillus amyloliquefaciens subsp. plantarum-Stamm, insbesondere Bacillus amyloliquefaciens subsp. plantarum-Stamm ABI01 , gekennzeichnet durch die gleichzeitige Anwesenheit der folgenden Gencluster: Gencluster für die ribosomale Synthese eines neuen, antimikrobiellen, zyklischen Peptids „Amylocyclicin" (1 ), Gencluster für die ribosomale Synthese des antimikrobiellen, Oxazol/Thiazol enthaltenden Peptids„Plantazolicin" (2), Gencluster für die nichtribosomale Synthese eines antimikrobiellen Lipopeptids„Surfactin" (3), Gencluster für die nichtribosomale Synthese eines antifungalen Lipopeptids der Ituringruppe, z.B. Bacillomycin D (4), Gencluster für die nichtribosomale Synthese eines antifungalen Lipopeptids der Fengycin/Plipastatingruppe, z.B. Fengycin (5), Gencluster für die nicht-ribosomale Synthese eines Fe-Siderophors, z.B. Bacillibactin (6), Gencluster für die nichtribosomale Synthese der antibakteriell wirkenden Polyketide Makrolaktin (7), Bacillaen (8), und Difficidin (9) und die nicht-ribosomale Synthese des antimikrobiellen Dipeptids Bacilysin (10).

15. Bacillus amyloliquefaciens subsp. plantarum-Stamm, insbesondere Bacillus amyloliquefaciens subsp. plantarum-Stamm ABI01 , gekennzeichnet durch die Fähigkeit - zur lang andauernden, insbesondere mehr als vier Monate, kompetitiven Besiedlung der pflanzlichen Wurzelzone,

- zur Unterdrückung phytopathogener Mikroorganismen,

- zur Unterdrückung phytopathogener Pilze,

- zur Unterdrückung des phytopathogenen Pilzes Rhizoctonia solani,

- zur Unterdrückung phytopathogener Bakterien,

- zur Unterdrückung phytopathogener Viren,

- zur Unterdrückung von Tabak-Mosaik-Virus (TMV),

- zur Unterdrückung phytopathogene Fadenwürmer (Nematoden),

16. Bacillus amyloliquefaciens subsp. plantarum-Stamm ABI01 (DSM 10-1092) gekennzeichnet durch die Genomsequenz von 3913505 bp, einen G + C-Gehalt von 46,47 % und 3689 kodierenden Sequenzen (Anlage).

17. Amylocyclicin der Sequenz

LASTLGISTAAAKKAID11DAASTIASIISLIGIVTGAGAISYAIVATAKTMIKKYGKKYAAAW

Amylocyctizin

18. Verfahren zur Isolierung von speziellen Bacillus amyloliquefaciens subsp. plantarum-Stämmen dadurch gekennzeichnet, dass man eine mit Bacillus- Endosporen angereicherte Erdprobe aus einem Gebiet, das vor mindestens 4-6 Monaten mit einem leistungsfähigen B. amyloliquefaciens subsp. plantarum Stamm behandelt wurde, entnimmt und zur Anreicherung von hitzeresistenten Endosporen die wässrige Erdsuspension mindestens 1 h kocht. Die spezifische Anreicherung von

B. amyloliquefaciens plantarum erfolgt durch Inkubation der hitzebehandelten Suspension in flüssigem Minimalmedium mit Lactose als einziger C-Quelle für mehrere Tage bei Temperaturen zwischen 25 - 40 °. Nach Ausplattieren auf ein verfestigtes Lactose-Minimalmedium, dem zusätzlich 0,1% AZCL HE-Cellulose zugefügt wurde, werden Bacillus-Kolonien mit lytischer Wirkung gegen Cellulose und ähnlicher Koloniemorphologie wie die Ausgangs-Bacillus amyloliquefaciens-Stämme ausgewählt, isoliert und identifiziert.

19. Verfahren nach Anspruch 14, dadurch gekennzeichnet, dass der Stamm FZB42 eingesetzt wird und der erhaltene Stamm ABI01 isoliert und weiter kultiviert wird.

Description:
Mittel zur Behandlung von mikrobiellen Erkrankungen bei Kulturpflanzen Einleitung

Die Erfindung betrifft ein biologisches Mittel zur Behandlung von mikrobiellen Erkrankungen bei Kulturpflanzen auf der Basis von Bacillus amyloliquefaciens subsp. plantarum-Stämmen sowie seine Verwendung. Sie betrifft ferner einzelne neue Stämme dieser Subspezies und ein Verfahren zu ihrer Gewinnung und weiterhin eine neue antibakterielle Verbindung.

Anwendungsgebiete der Erfindung sind der Pflanzenschutz, die Biotechnologie und die Landwirtschaft.

Stand der Technik

Die umweltfreundliche Kontrolle von mikrobiell verursachten Erkrankungen stellt eine dringende Notwendigkeit dar, um den zunehmenden Nahrungsbedarf einer wachsenden Weltbevölkerung zu decken. Heutige Praktiken beruhen größtenteils auf der genetischen Resistenz der Wirtspflanze, einem abgestimmtem Management von Pflanze und Umwelt und dem Einsatz synthetischer Pestizide, die nach andauernder Anwendung ihre Wirksamkeit einbüßen und häufig einen ungünstigen Einfluss auf die Umwelt ausüben. Die Einführung von biologischen Pflanzenschutzmitteln („Biopestizide") stellt eine attraktive Alternative zu den bisher überwiegend eingesetzten chemischen Pflanzenschutzmitteln dar. Biopestizide werden von der US Umweltschutzagentur EPA (Environmental Protection Agencv) als Pflanzenschutzmittel aus „natürlichem Material" (Tiere, Pflanzen, Bakterien und bestimmte Mineralien) definiert. Dabei haben sich biologische Pflanzenschutzmittel aus Bakterien und Pilzen als besonders wirksam erwiesen. Z.B. hat sich die Entwicklung von Bioformulierungen von so genannten „Pflanzenwachstums- fördernden Bakterien" („plant growth promoting bacteria", PGPR) mit Biokontrolleigenschaften als besonders viel versprechend gezeigt. Diese Bakterien vermögen nicht nur das Pflanzenwachstum zu fördern, sondern unterdrücken gleichzeitig auch die phytopathogene Mikroflora und beugen der Erkrankung durch pilzliche und bakterielle Erreger durch Induktion der systemischen Resistenz vor. Vertreter der Gattung Pseudomonas, z.B. P. fluorescens, haben sich in der Vergangenheit als effiziente Kolonisatoren der pflanzlichen Wurzelzone, die gleichzeitig die phytopathogene Begleitflora wirkungsvoll unterdrücken, erwiesen. Die Anwendung der aus diesen Bakterien hergestellten industriellen Produkte ist jedoch durch die begrenzte Haltbarkeit und Lagerfähigkeit der vegetativen Bakterienzellen eingeschränkt. Eine erfolgreiche Alternative stellt der Einsatz von ausgewählten sporenbildenden Bakterien, z. B. Repräsentanten der Gattung Bacillus, dar. Sporen sind Dauerformen der Bakterienzelle, die über eine, chemischen Präparaten vergleichbare oder überlegene, Haltbarkeit verfügen. Sie widerstehen extremen Umwelteinflüssen (Temperatur, UV-Strahlung, chemischen Agentien) und können jahrelang ohne Aktivitätsverlust gelagert werden. Bereits heute sind Bioformulierungen von Repräsentanten der Gattung Bacillus, die am häufigsten eingesetzten biologischen Pflanzenschutzmittel (http://www.agraquest.com/). Neben den bekannten Produzenten von Insektiziden, Bacillus thunngiensis und Bacillus kurstakii, sind es Stämme aus dem Verwandtschaftskreis von Bacillus subtiiis, die die meiste Anwendung auf diesem Gebiet erfahren haben. Allerdings ist ihre erfolgreiche Anwendung durch die unzureichende Kenntnis der molekularen und metabolischen Prinzipien, die ihrer - für die Pflanzen vorteilhaften - Wirkung zugrunde liegen, bisher noch stark eingeschränkt. Beispielsweise wurde in PCT WO 00/29426 die antagonistische Wirkung des Bacillus subtiiis Stammes AQ713 auf die Bildung der Lipopeptide IturinA, Plipastatin, Surfactin und einer als„Agrastatin" bezeichneten Gruppe von zyklischen Lipopeptiden, die ebenso wie Plipastatin den Fengycinen entsprechen , zurückgeführt. Mit Ausnahme von Surfactin, das eine schwache antibakterielle Wirkung aufweist, wirken diese Sekundärmetabolite jedoch nur gegen phytopathogene Pilze (8). Aktuelle Untersuchungen ergaben, dass Vertreter einer distinkten taxonomischen Gruppe - Bacillus amyloliquefaciens subsp. plantarum - sich durch ein hohes Potential zur Bildung antifungaler und antibakterieller Metaboliten - auszeichnen (1). Repräsentanten dieser Gruppe sind für ihre pflanzenwachstumsfördernden Eigenschaften und für ihre Fähigkeit zur Suppression phytopathogener Mikroorganismen in der pflanzlichen Wurzelzone bekannt (1). Beispiele für antifungale Wirkstoffe, die durch Repräsentanten dieser taxonomischen Gruppe gebildet werden, sind iturinartige Lipopeptide (Bacillomycin D oder Iturin A) und Fengycin. Weitere Produkte mit biologischer Bedeutung, die auf nicht- ribosomalen Wege hergestellt werden, sind das Eisensiderophor Bacillibactin und das antimikrobielle Dipeptid Bacilysin. Darüber hinaus sind Repräsentanten der „plantarum" Gruppe für die Synthese der antibakteriellen Polyketide Bacillaen, Makrolactin und Difficidin bekannt. Kürzlich wurde eine weitere Verbindung mit schwacher antimikrobieller Wirkung beschrieben, Plantazolicin. Anders als die vorher benannten Lipopeptide und Polyketide wird Plantazolicin durch konventionelle, ribosomale Synthese hergestellt (4). Weiterhin induzieren diese Bakterien gezielte Abwehrreaktionen der Pflanze gegen biotischen und abiotischen Stress, die als „Induzierte systemische Resistenz", ISR, bezeichnet werden und produzieren das pflanzliche Wachstumshormon 2,3-1 ndolyl-Essigsäure (9). Der Typstamm für die „plantarum" Subspecies, das Rhizobakterium FZB42 (=DSM 23117), weist pflanzenwachstumsfördernde und Phytopathogen-supprimierende Eigenschaften auf (2-12) und wird als Bodenhilfsstoff „Rhizovital®" kommerziell im Agrar- und Gartenbereich eingesetzt (http://www.abitep.de/). Voraussetzung für eine effiziente Wirkung des Wurzelbakteriums ist eine effiziente und dauerhafte Besiedlung der pflanzlichen Wurzelzone. Hier weist FZB42, ebenso wie andere zur Förderung des Pflanzenwachstums und zur biologischen Kontrolle phytopathogener Mikroorganismen bisher eingesetzte Bacillus-Stämme (vgl. Patentschriften: US 6,960,342 (2005), US 6,015,553 (2000), US0265292 A1 (2004), US 6,524,998 B1 (2003), EP 1 449 914 A1 (2002), WO 00/29426 (2000)) Nachteile gegenüber wurzelbesiedelnden Gram-negativen Bakterien, z.B. Pseudomonas, auf. Es wurde festgestellt, dass wurzelbesiedelnde Bacillen nur relativ kurze Zeit - nicht länger als sechs Wochen - an den Pflanzenwurzeln nachweisbar waren. Es wird vermutet, dass dieser Effekt auf fehlender Kompetitivität gegenüber anderen Vertretern der mikrobiellen Wurzelflora beruht. Somit kann eine lang andauernde und stabile Wirkung auf das Pflanzenwachstum durch die augenblicklich eingesetzten Bacillus- basierenden Bioformulierungen nicht erwartet werden und die Wirkung dieser Formulierungen ist durch die unzureichende Kenntnis ihrer wirksamen Komponenten eingeschränkt.

Ziel und Aufgabe der Erfindung

Die Erfindung hat das Ziel, ein umweltverträgliches, lagerfähiges und lang andauernd wirksames Mittel gegen phytopathogene Mikroorganismen, insbesondere Pilze, auf der Grundlage definierter biologischer Faktoren zu entwickeln. Aufgabe der Erfindung ist es, effektive Bacillus-Stämme, die der Species Bacillus amyloliquefaciens subsp. plantarum angehören und ein lang andauernd wirksames, antagonistisches Potential aufweisen, für die Entwicklung eines natürlichen, gesundheitlich unbedenklichen Mittels zur Vorbeugung und Behandlung von mikrobiellen Erkrankungen, insbesondere pilzlichen Infektionen, z. B. Rhizoctonia solani an Kartoffeln und anderen Kulturpflanzen, einzusetzen.

Wesen der Erfindung

Die Aufgabe wird gemäß den Ansprüchen 1 , 12, 14, 23 und 25 gelöst; die Unteransprüche sind Vorzugsvarianten.

Bei der Suche nach Mikroorganismen mit verbesserter antagonistischer Aktivität gegen phytopathogene Mikroorganismen wurde gefunden, dass Mitglieder der Subspecies Bacillus amyloliquefaciens plantarum eine ausgezeichnete Wirkung gegen Erreger pilzlicher und anderer mikrobieller und viraler Krankheiten an Kulturpflanzen aufweisen. Unter diesen Stämmen hat der Erfinder der vorliegenden Erfindung den Stamm ABI01 als Vorzugsvariante gewählt, der in seiner Persistenz in der pflanzlichen Rhizosphäre und in seiner antifungalen Leistung den Typstamm FZB42 übertrifft.

Der pflanzenassozierte Bacillus-Stamm ABI01 der vorliegenden Erfindung ist ein

Vertreter der taxonomischen Gruppe Bacillus amyloliquefaciens subsp. plantarum.

Repräsentanten dieser Gruppe sind für ihre pflanzenwachstumsfördernden

Eigenschaften und für ihre Fähigkeit zur Suppression phytopathogener

Mikroorganismen in der pflanzlichen Wurzelzone bekannt (1). Darüber hinaus induzieren sie gezielte Abwehrreaktionen der Pflanze gegen biotischen und abiotischen Stress, die als„Induzierte systemische Resistenz", ISR, bezeichnet wird und produzieren das pflanzliche Wachstumshormon 2,3-lndolyl-Essigsäure (9).

Durch die gezielte Anreicherung von Vertretern dieser taxonomischen Gruppe aus der pflanzlichen Wurzelzone konnte der Stamm ABI01 gewonnen werden, der überraschenderweise in seiner antifungalen Wirksamkeit andere Vertreter dieser

Gruppe, z.B. den Typstamm FZB42, deutlich übertrifft. Die komplette Genomsequenz von ABI01 wurde bestimmt und ist Bestandteil dieser Patentanmeldung. Die Analyse der kompletten Genomsequenz ergab die Anwesenheit von elf Genclustern, die in die Synthese von antimikrobiellen Verbindungen, darunter einem hypothetischen Produkt, eingebunden sind (Abb. 1 -d, Tabelle 1 ). Es wurden insgesamt 10 Sekundärmetabolite mit antifungaler, antibakterieller und antiviraler Wirksamkeit in der Kulturlösung bzw. Oberflächenzellextrakten von ABI01 direkt nachgewiesen. Isoformen von Bacillomycin D mit unterschiedlicher Länge des Fettsäurerestes wurden als Hauptkomponenten der antagonistischen Wirkung gegenüber phytopathogenen Pilzen identifiziert. Das hier erstmalig beschriebene, cyclische Peptid Amylocyclicin supprimiert das Wachstum Gram-positiver Bakterien. Das Polyketid Difficidin wirkt gegen Gram-positive und Gram-negative Bakterien; Bacilysin hat eine generelle antimikrobielle Wirkung. In vergleichenden Feldversuchen erwies ABI01 sich gegenüber anderen eingesetzten Bio- und Chemofungiziden bei der Suppression von Rhizoctonia solani an Kartoffeln als überlegen und zeigte eine höhere Wirksamkeit als FZB42 und das Chemopestizid Cuprozin (Ausführungsbeispiel 7). Gemäß der vorliegenden Erfindung wird der antifungal wirkende ABI01 (Zugangsnummer: DSM 10-1092) zur Verfügung gestellt, der als Bacillus amyloliquefaciens subsp. plantarum klassifiziert wurde.

Nachfolgend wird die vorliegende Erfindung ausführlich beschrieben

ABI01 ist ein Vertreter der taxonomischen Gruppe Bacillus amyloliquefaciens subsp. plantarum (1 ). Der Stamm wurde durch die gezielte Anreicherung von Vertretern dieser taxonomischen Gruppe aus der pflanzlichen Wurzelzone gemäß Ausführungsbeispiel 1 erhalten. Kolonien des Endosporen-bildenden Bakteriums (Abb. 3) wiesen die Fähigkeit zur Laktoseverwertung und zur Hydrolyse von Hydroxyethyl-Cellulose auf, Merkmale die für die Differenzierung dieser taxonomischen Gruppe von Bedeutung sind. Der Stamm ähnelt in seiner Kolonieform dem Stamm FZB42, ist jedoch nach 5-tägigem Wachstum auf DEV-Agar von diesem Stamm deutlich unterscheidbar (Abb. 2). Weitere phänotypische Merkmale des Stammes ABI01 sind in der Tabelle 3 zusammengefasst Durch den Einsatz Sequenz-spezifischer Primer gelang die Amplifikation von DNA-Fragmenten, die für die„plantarum" Gruppe und speziell für den Typstamm FZB42 charakteristisch sind (1 , Abb. 4). Es handelt sich um Sequenzen für ein Gen des Restriktions - und Modifikationssystems (RM), eines Gens für die nicht-ri bosomale Synthese eines unbekannten Peptids (NRSP) und des Bacteriocins „Plantazolicin" (pzn). Damit wurde der Nachweis erbracht, dass die erhaltenen Isolate dem taxonomischen Umfeld von „plantarum' 1 zuzuordnen sind und in enger Verwandtschaft zum Typstamm FZB42 stehen. Diese Einordnung wurde durch die Sequenzierung der kompletten Genomsequenz von ΑΒΙ0 (3,9 Mbp) bestätigt (Tabelle 4). Die ABI01 Genomsequenz weist nur geringe Unterschiede zur Genomsequenz des Typstammes FZB42 auf (Abb. 5, Ausführungsbeispiel 3), 64 Stellen in der Genomsequenz weisen Unterschiede zu FZB42 auf (Tabelle 6). Das ABI01 Genom enthält alle Gencluster, die für die Synthese von Metaboliten mit antagonistischer Wirkung gegen mikrobielle und virale Krankheitserreger bei Kulturpflanzen von Bedeutung sind und von anderen Vertretern der taxonomischen Gruppe Bacillus amyloliquefaciens subsp. plantarum, z.B. FZB42, bekannt sind (Tabelle 1 , Abb. 1 a- d). Die Bildung dieser Sekundärmetaboliten verursacht beispielsweise im Fall von Bacillomycin D und Fengycin eine Wachstumshemmung phytopathogener Pilze, z. B. von Rhizoctonia solani und Fusarium oxysporum. Antibakterielle Wirkung haben die Polyketide Difficin, Bacillaen und Makrolaktin, sowie das Dipeptid Bacilysin. Eine antivirale Wirkung wird für das oberflächenaktive Surfactin angenommen. Das Siderophor Bacillibactin wird unter Eisenmangelbedingungen induziert und trägt zur besseren Eisenversorgung der betreffenden Pflanzen bei. Die Expression der hier genannten Sekundärmetaboliten, sowie des hochmodifizierten Peptids Plantazolicin konnte direkt durch HPLC und MALDI TOF MS der Kulturfiltrate bzw. durch Messung der Oberflächenextrakte nachgewiesen werden (Ausführungsbeispiel 5). Damit wurde der Nachweis erbracht, dass die erhaltenen Isolate dem taxonomischen Umfeld von „plantarum" zuzuordnen sind und in enger verwandtschaftlicher Beziehung zu dem Typ-Stamm FZB42 stehen. Das ist überraschend, da bisher angenommen wurde, dass ein Nachweis von Vertretern der ßac///us-Gruppe im Bereich der pflanzlichen Wurzelzone nur maximal sechs Wochen nach Applikation dieser Bakterien möglich ist. Somit weisen die erhaltenen Isolate eine, gegenüber FZB42 und anderen bisher eingesetzten ßac/7/us-Stämmen, erhöhte Fähigkeit zur Überdauerung (Persistenz) im Bereich der pflanzlichen Wurzelzone auf und sind für den Einsatz bei lang andauernden Kulturen pflanzlicher Nutzpflanzen von besonderem Vorteil. Vergleichende Feldversuche mit Kartoffeln zeigten, dass eine Beize der Kartoffelknollen mit ABI01 zu einer gegenüber FZB42 verbesserten phytosanitären Wirkung führt und die durch den Pilz Rhizoctonia solani verursachte Wurzeltöterkrankheit („black scurf ) stärker zurückdrängt als bei Einsatz alternativer Bio- und Chemofungizide. Zur Ausbildung von Sporen für die Massenproduktion wird der Bacillus amyloliquefaciens plantarum ABI01 der vorliegenden Erfindung unter einer geeigneten Bedingung kultiviert (Ausführungsbeispiel 6). Das Produkt kann als flüssige Sporensuspension, als Trockenbeize oder als Kombination von Bacillus- Sporen und einem Sekundärmetabolitenkonzentrat unter Zusatz sowohl als Gießpräparat für die Bodenbehandlung oder als Sprühpräparat für die Blattbehandlung eingesetzt werden.

Die verschiedenen Anwendungsmöglichkeiten sind ebenfalls Gegenstand dieser Erfindung. Bevorzugt enthalten diese Präparate mindestens 1 x 10 10 Sporen pro Gramm bzw. pro Milliliter.

Flüssig-Konzentrate werden aus einer Bacillus amyloliquefaciens subsp. plantarum Kultur gewonnen, welche eine Lipopeptidkonzentration von mindestens 1 g/L enthält. Eingesetzt werden auch Flüssig-Konzentrate gewonnen aus einer Bacillus amyloliquefaciens subsp. plantarum Kultur mit einer Bacillomycin D Konzentration von mindestens 1 g/L.

Nachfolgend wird die vorliegende Erfindung spezieller durch Beispiele beschrieben. Die folgenden Beispiele sind jedoch nur zur Erläuterung angegeben und daher ist die vorliegende Erfindung nicht durch sie oder auf sie beschränkt.

Ausführungsbeispiele

Beispiel 1 : Anreicherung und Isolierung von Bacillus amyloliquefaciens plantarum

Erfindungsgemäß wurde eine spezifische Methode zur Isolierung von pflanzenassoziierten Bacillus amyloliquefaciens plantarum Stämmen entwickelt:

1. 2,5 g einer Erdprobe, die aus der pflanzlichen Rhizosphäre entnommen worden war, wurden in 25 ml destilliertem Wasser für 2 h bei Raumtemperatur unter Schütteln resuspendiert.

2. Die Suspension wurde eine Stunde gekocht.

3. 10 ml der Suspension wurden zu 40 ml in einem flüssigem Minimalmedium mit Lactose (0,1 %) als einziger C-Quelle zugegeben und für mehrere Tage bei 30°C inkubiert, bis bei der mikroskopischen Kontrolle stäbchenförmige Zellen sichtbar wurden.

4. Verdünnung der Proben von 10 "1 bis 10 '5 und Ausplattierung auf 1 ,5% Minimal-Agar mit Laktose als einziger C-Quelle und Zusatz von 0.1 % AZCL HE (Azure dye angefärbte Hydroxyl Ethyl Cellulose). Inkubation bei 30°C für drei bis fünf Tage. Kolonien, die eine Hydrolyse der Zellulose aufwiesen und in Ihrer Koloniemorphologie dem Typstamm FZB42 (rau, flach, dendritisch, weiß bis durchscheinend) ähnelten (Abb.1), wurden ausgewählt.

5. Chromosomale DNA wurde von diesen Kolonien nach der Phenol- Standardmethode (13) isoliert und für die Polymerase-Ketten Reaktion (PCR) mit den sequenzspezifischen Primern PRBrm5215 tgatggagtaaataataaggctgg, und PRBrm6000 aatacatctaaagttgcatccacc eingesetzt. Diese Reaktion dient dem Nachweis eines, für FZB42 spezifischen 785 bp-Fragmentes des Restriktions- und Modifikationssystem (RM). Darüber hinaus kommen die nachfolgenden Sequenz-spezifische Primerpaare zum Einsatz: PRBnrs3104 tggagaaatatcactgaacaatgc und PRBnrs3943 acgtttagtttcagttctttcacc für die Amplifikation des NRSP-Gen- Fragmentes und PRBptn6179 gatagaagtattagcctggaagca und PRBptn7000 tggaggaggtaacaattatgactc für die Amplifikation eines Gens aus dem Plantazolicin-Synthese Gencluster.

Ein Beispiel für die Anwendung dieser Methode ist nachfolgend gegeben:

Der Versuch wurde in einem Gewächshaus in Lianpengwei village, Dounan town,

Chenggong county, Kunming, China, im März 2010 durchgeführt.

Fünf Monate nach Anwendung einer kommerziellen Sporensuspension von FZB42 (Rhizovital®) zu einer Kultur von Löwenmäulchen (Antirhinum major) wurden entsprechende Bodenproben entnommen und wie oben geschildert behandelt. Die erhaltenen Kolonien wiesen ein für FZB42 typisches Aussehen auf (Abb. 2) und waren zur Nutzung von Laktose als einziger C-Quelle und zur Hydrolyse von HE Cellulose fähig. Die Zellen bildeten nach dreitägiger Kultur auf Nähragar bei 30°C ovale Endosporen aus. Die Sporenmutterzellen waren nicht angeschwollen; die Lage der Sporen war zentral oder vereinzelt distal (Abb. 3). Die mit chromosomaler DNA und sequenzspezifischen Primern (s.o.) durchgeführte PCR erbrachte die Amplifikation der für die BAP-Gruppe typischen Genfragmente einschließlich des für FZB42 charakteristischen Fragments des RM-Systems (Abb.4). Die Ergebnisse sind in der Tabelle 2 zusammengefasst.

Der Stamm KM1-1 (ABI01 ) wurde für die weiteren Untersuchungen ausgewählt. Er wurde unter der Nummer DSM 10-1092 in der deutschen Sammlung von Mikroorganismen und Zellkulturen GmbH, DSMZ, deponiert und seine taxonomische Zugehörigkeit zu BAP durch Untersuchungen des DSMZ bestätigt (siehe Ausführungsbeispiel 2).

Beispiel 2: Phänotypische und genotypische Charakterisierung von Bacillus amyloliquefaciens plantarum ABI01 (DSM 10-1092)

Die Merkmale zur taxonomischen Identifizierung von ABI01 (DSM 10-1092) sind in der Tabelle 2 zusammengefasst und bestätigen die Einordnung als ß. amyloliquefaciens subsp. plantarum.

Weiterhin wurde eine Untersuchung des zellulären Fettsäureprofils von ABI01 durchgeführt, dass die größte Ähnlichkeit zu ß. subtilis (Index der Ähnlichkeit: 0,631) und B. amyloliquefaciens (Index der Ähnlichkeit: 0,614) ergab. Ein gleichfalls durchgeführter Vergleich von ABI01 und FZB42 im Rahmen einer Riboprinteranalyse (Restriktionsenzym: EcoRI) ergab, dass beide Stämme einen Ähnlichkeitsindex von . » 0,93 aufweisen und somit der gleichen RiboGruppe, ECORI 198-1901-S4, angehören. Stämme, die der gleichen RiboGruppe angehören können durch das Riboprint-System nicht weiter differenziert werden und werden nach Aussage des DSMZ als identisch betrachtet. Die Partialsequenz der 16SrRNA wies nach Auskunft des DSMZ eine Übereinstimmung von £99,8% zu Sequenzen von B. subtilis und ß. amyloliquefaciens auf und ist somit für eine weitergehende taxonomische Differenzierung des Stammes nicht ausreichend (vgl. Borriss et al. 2010).

Referenz

Borriss, R. et al. Relationship of Bacillus amyloliquefaciens clades associated with strains DSM7 T and FZB42; a proposal for Bacillus amyloliquefaciens subsp. amyloliquefaciens subsp. nov. and Bacillus amyloliquefaciens subsp. plantarum subsp. nov. based on their discriminating complete genome sequences. IJSEM, published ahead of print Sept 3, 2010

Beispiel 3: Genomsequenz von AB101

Die Sequenzierung von chromosomaler DNA des Stammes ΑΒΪ01 wurde mittels eines Roche/454 (GS-FLX Titanium)- Sequenziergerätes durchgeführt. Es wurden insgesamt ca. 330.000 Sequenzen (118 Mb) mit einer durchschnittlichen Leseweite von 350 bp erzeugt, die zu 25 Contigs zusammengefasst werden konnten. Die Sequenzen wiesen eine hohe Übereinstimmung mit dem Genom des pflanzenwachstumsfördernden Bakterium Bacillus amyloliquefaciens subsp. plantarum FZB42 auf (Abb. 5). 99,34% der Referenzsequenz von FZB42 wurden durch die Sequenzierung abgedeckt. Die vollständige Genomsequenz von AB101 wurde durch Vergleich mit FZB42 assembliert und annotiert. Die wichtigsten Genomdaten von ABI01 im Vergleich zu FZB42 sind in der Tabelle 4 aufgeführt. Insgesamt wurden 35 neue CDS in ABI01 , die nicht in der FZB42 Genomsequenz annotiert worden waren, identifiziert (Tabelle 5). Insgesamt wurden 283 Stellen, die Sequenzunterschiede (SNPs) zu FZB42 aufwiesen, davon 65 mit hoher statistischer Sicherheit, in der ABI01 Genomsequenz identifiziert (Tabelle 6). Von diesen Veränderungen waren insgesamt 32 CDS betroffen. Bei neun von diesen 32 Genen handelt es sich vermutlich um Sequenzierungsfehler im Genom von FZB42. Bei zwei weiteren Genen handelte es sich um „stille" Mutationen, die keine weiteren Auswirkungen auf die Aminosäuresequenz hatten. Somit weisen in dem Genom von ABI01 wenigstens 19 CDS gegenüber FZB42 Unterschiede in der Aminosäuresequenz auf und die Genome von ABI01 und FZB42 sind nicht identisch.

Beispiel 4: Identifizierung des antibakteriellen, cyclischen Peptids, Amylocyclizin

Als antibakteriell wirkende Sekundärmetaboliten waren bisher in Bacillus amyloliquefaciens subsp. plantarum bisher nur die Polyketide Difficidin, Bacillaen und Makrolaktin, sowie das Dipeptid Bacilysin bekannt (siehe Erfindungsbeschreibung). Interessanterweise wurde in Mutantenstämmen, in denen die nicht-ribosomale Synthese von Polyketiden und Bacilysin eliminiert worden war, eine antibakterielle Aktivität gegenüber verschiedenen Gram-positiven Bakterien, u. a. Bacillus subtilis nachgewiesen (Tabelle 7). Zur Identifizierung des Genclusters, das für die Synthese dieser unbekannten, antibakteriellen Verbindung verantwortlich war, wurde eine Transposonmutagenese mit dem Mariner Transposon pMarA (leBreton et al. 2006) in dem Stamm CH5 (nsfp), der nicht mehr zur nicht-ribosomalen Synthese antimikrobieller Sekundärmetaboliten befähigt war, durchgeführt. Mariner- Transposons wie pMarA können an beliebige Stellen des Chromosoms des bakteriellen Wirtes inserieren und dabei die Funktion des dort befindlichen Genes zerstören. Der das mariner Plasmid enthaltene Stamm AB10 wurde über Nacht bei 37°C und 210 rpm geschüttelt und anschließend mit steriler Saline 1 :1000 verdünnt, davon 100 μΙ ausplattiert, 24 h bei 48°C inkubiert und die entstandenen Kolonien anschließend im Transposon-Mutanten-Screening getestet. Die Transposonmutanten wurden parallel jeweils auf eine Kanamycin-Platte und eine Diabrot-Platte (Zusammensetzung siehe unten) überführt. Die 10 x 10 cm große Platte mit Diabrot- Agar wurde zuvor mit 5 ml handwarmen LB Top Agar überschichtet, der 1 :40 mit einer Bacillus subtilis HB0042 (OD ~ 1) Kultur vermischt wurde. Die Kanamycin- Platten wurden ÜN bei 37°C inkubiert, die Diabrot-Platten bei Raumtemperatur. Am nächsten Tag wurden die auf den Diabrot-Platten gewachsenen Klone bezüglich eines Aktivitätsverlustes gegenüber Bacillus subtilis untersucht. Klone mit verminderter bzw. ohne Aktivität wurden von der parallel angefertigten Kanamycin- Platte selektiert und sequenziert. Von den Transposonmutanten wurde chromosomale DNA isoliert. 5 pg der DNA wurden mit Taql geschnitten und nach Aufreinigung mit dem Nucleospin Extract Kit mit dem Rapid Ligation Kit zirkularisiert (DNA Konzentration 5 ng/μΙ). Der Ligationsansatz wurde wiederum mit dem Nucleospin Extract Kit aufgereinigt und eine PCR mit einer Annealing-Temperatur von 60°C bzw. 50°C mit den Primern olPCRI und olPCR2 durchgeführt. Die Transposon-Insertionsmutante WY01 wies keine antibakterielle Aktivität auf. Die Transpososon-lnsertion wurde innerhalb des acnA Gens kartiert. acnA ist Teil eines Genclusters, das offensichtlich in die Synthese der unbekannten antibakteriellen Verbindung involviert ist (Abb. 1 a). AcnA kodiert den 112 AS Präkursor eines Peptids folgender Sequenz:

MMNLVKSNKKSFILFGAALAAATLVYALLLTGTELNVAAAHAFSANAE LASTLGISTAAA

KKAIDIIDAASTIASIISLIGIVTGAGAISYAIVATAKTMIKKYGKKYAAAW

Die Sequenz der unterstrichenen 64 C-terminalen Aminosäuren weist Ähnlichkeit zu cycltschen Bacteriocinen, insbesondere dem Uberolysin (Wirawan et al. 2007) auf und stellt das reife, prozessierte Peptid dar. Die N-terminalen 48 Aminosäuren stellen wahrscheinlich das Leader Peptid dar. Durch den Vergleich mit dem Uberolysin- Präkursor und Bestimmung des vermutlichen Leader-Peptids ergibt sich ein Molekulargewicht von 6399,62 für das acnA-Produkt. Eine Verbindung mit diesem Molekulargewicht konnte allerdings nicht in dem methanolischen Extrakt des

Ammoniumsulfat-gefällten Überstandes von ABI01 und anderen Vertretern von B. amyloliquefaciens plantarum, z.B. FZB42 und dessen Mutanten nachgewiesen werden. Allerdings wurde im MALDI-TOF Massenspektrum ein Peak mit der Masse von m/z 6382 Da [M+H] + detektiert (Abb. 7a). Beim Vergleich der MALDI-TOF MS Spektren (90) des Methanolextraktes der acnA Mutante war dieser Peak nicht vorhanden; eine experimentelle Bestätigung dafür, dass es sich hier um das gesuchte, prozessierte Genprodukt von acnA handelt. Die um 18 Da (16 + 2) reduzierte Masse bestätigt den erfolgten Ringschluss, der wie bei anderen Repräsentanten der zyklischen Bacteriocine der Gruppe 1 zwischen der N-terminalen und der C-terminalen Aminosäure des prozessierten Peptids erfolgt:

Das prozessierte, reife Peptid besteht aus 64 Aminosäuren und weist eine„head to tail" Cyclisierung, d.h. eine kovalente Bindung zwischen L1 und W64, auf:

Sequenzen

LASTLGISTAAAKKAIDI IDAASTIASIISLIGIVTGAGAISYAIVATAKTMIKKYG KYAAAW

Amylocyclizin

Sequenzen mit Homologie zum acnA-? Gencluster von ABI01 finden sich auch in anderen Stämmen von Bacillus amyloliquefaciens (z.B. FZB42, DSM7) und Bacillus subtilis subsp. spizizenii, sowie Bacillus coagulans und Paenibacillus larvae. Zusammensetzung des Diabrot Mediums für die Produktion von Amylocyclizin 40 g Soja Pepton, 40 g Dextrin 10, 1 .8 g KH 2 PO , 4.5 g K 2 HPO 4 , 0.3 g MgSO x 7 H 2 O, und 0.2 ml KellyT Spurenelement-Lösung per L. KellyT Spurenelement-Lösung: 25 mg EDTA Dinatrium dihydrat, 0.5 g ZnSO 4 x 7 H 2 O, 3.67 g CaCI 2 x 2 H 2 O, 1.25 g MnCI 2 x 4 H 2 O, 0.25 g CoCI 2 x 6 H 2 O, 0.25 g Ammoniummolybdat, 2,5 g FeSO 4 x 7H 2 O, 0, 1 g CuSO 4 x 5 H 2 O; eingestellt auf pH 6 mit NaOH, 500 ml H 2 O. Überstand: 50ml des Diabrot-Produktionsmediums in einem 500ml Rundkolben wurden mit 0,5 ml einer LB-Übernachtkultur beimpft und für 6,5 Stunden bis zu einer OD 8,5 unter Schütteln weiter inkubiert. Der Zellüberstand wurde durch zweifache Zentrifugation bei 14 000 U/min. (jeweils 10 min.) erhalten.

Bioassav. LB-Agar (20 ml) wurde mit 0.5 ml des Indikator Stammes (OD 6 oo ~1.0) gemischt. 20 μΙ des Kultur-Überstandes wurden auf die Platte aufgetragen und für 16 h bei 22 C C inkubiert. Die Aktivität von Amylocyclicin A wurde als Klarzone beobachtet.

Ammonsulfatfällunq des Überstandes: 50ml Überstand wurden mit 200ml H2O dest. verdünnt und mit 80% Ammoniumsulfat Sättigung gefällt. Nach Zentrifugation (5min 14000 rpm) wurde das Sediment mit 250 μΙ Methanol aufgenommen und der methanolische Überstand nach erneuter Zentrifugation für die MALDI-TOF-MS Messung eingesetzt.

MALDI-TOF Massen Spektrometrie. MALDI-TOF Massen Spektren wurden mit einem Bruker Autoflex MALDI-TOF Gerät mit einem 337 nm Stickstoff Laser für Desorption und Ionisation aufgenommen. 2 μΙ Proben wurden mit gleichem Volumen Matrix-Lösung (gesättigte Lösung von a-Cyano-4-hydroxycinnamic Säure in 50% wässrigem Acetonitril mit 0.1 % v/v Trifluoressigsäure) gemischt, aufgetragen, luftgetrocknet, und wie vorher beschrieben aufgetragen (Koumoutsi et al. 2006). Die Spektren wurden durch Detektion positiver Ionen im linearen Massenspektrum erhalten.

Referenzen

1. Koumoutsi, A., X. H. Chen, A. Henne, H. Liesegang, G. Hitzeroth, P. Franke, J. Vater, and R. Borriss. 2004. Structural and functional characterization of gene Clusters directing nonribosomal synthesis of bioactive cyclic lipopeptides in Bacillus amyloliquefaciens strain FZB42. J Bacteriol. 186:1084-96.

2. Le Breton, Υ,, N. P. Mohapatra, and W. G. Haldenwang. 2006. In vivo random mutagenesis of Bacillus subtilis by use of TnYLB-1 , a mariner-based transposon. Appl Environ Microbiol 72:327-33.

3. Wirawan, R. E., K. M. Swanson, T. Kleffmann, R. W. Jack, and J. R. Tagg. 2007. Uberolysin: a novel cyclic bacteriocin produced by Streptococcus uberis.

Microbiology. 153:1619-30. Beispiel 5: Bildung von Sekundärmetaboliten mit antimikrobieller Aktivität durch Bacillus amyloliquefaciens plantarum ABI01 (DSM 10-1092)

Durch ausgedehnte Untersuchungen mit B. amyloliquefaciens plantarum FZB42 und anderen Repräsentanten der BAP Gruppe ist bekannt, dass Vertreter dieser Gruppe bis zu neun verschiedene Sekundärmetaboliten mit antagonistischer Wirkung gegen die mikrobielle Mikroflora im Bereich der Pflanze nwurzel ribosomal bzw. nicht- ribosomal synthetisieren können (2-12). In der rechten Spalte der Tabelle 3 sind die Verbindungen im Fettdruck hervorgehoben, die durch Anwendung von MALDI-TOF MS („matrix assisted laser desorption/ionisation mass spectrometry") und HPLC („High pressure liquid chromatography") im Kulturfiltrat bzw. in Oberflächenextrakten von ABI01 nachgewiesen werden konnten. Die Ergebnisse sind in den Abbildungen 6 - 11 dokumentiert. Im Falle von Bacillomycin D wurden Isoformen mit unterschiedlicher Kettenlänge der mit dem Peptid verbundenen Fettsäurereste nachgewiesen (Abb. 7). Im Einzelnen handelt es sich um die Formen C14, C15, C16 und C17 (Abb 8). Es wird angenommen, dass die Länge der Fettsäuren einen Einfluss auf die antifungale Wirkung von Bacillomycin D ausübt. Bacillomcin D weist ebenso wie andere Mitglieder der Iturin-Familie (z.B. Iturin A) neben einer starken antifungalen Wirkung auch hämolytische Aktivität auf (Thimon et al. 1995). Im Bereich des Bacillomycin D Clusters sind auch Massen-Peaks des Lipopeptids Surfactin mit den Fettsäureketten längen C14 und C 5 sichtbar (Abb. 8). Surfactin weist nur eine schwache antifungale Wirkung auf, ist aber für seine antivirale und oberflächenaktive Wirkung bekannt Peypoux et al. 1999). ABI01 bildet mit Fengycin eine zweites, antifungal wirkendes Lipopeptid, das ebenfalls durch MALDI-TOF MS von Oberflächenextrakten nachgewiesen werden konnte (Abb. 7). Durch das gleiche Gencluster von Peptid-Synthetasen werden in der Position 6 des Lipopeptids zwei unterschiedliche Aminosäuren, Alanin bzw. Valin eingebaut. Daneben existieren wie im Falle von Bacillomycin D und Surfactin Isoformen von Fengycin mit den Fettsäure- Kettenlängen von C 5, C16 und C 7 (Abb. 9). Fengycin A enthält Ala in Position 6 während bei Fengycin B Ala durch Val ersetzt ist. Die antifungale Wirkung von Fengycin beruht wahrscheinlich auf der Hemmung von Phospholipase A 2 (Nishikori et al. 1986). Unter Eisenmangelbedingungen wird in ABI01 die Synthese des Eisen- Siderophors Bacillibactin induziert, das im Massenspektrum (Abb. 10) mit Peaks bei 905,5 [M + Na] und 921 ,5 [M + K] repräsentiert ist. Im Massenbereich um 1337, 1351 und 1371 war ein hoch-modifizierte Thiazol/Oxazol Mikrocin sichtbar, das als Plantazolicin beschrieben wurde, nachweisbar. Das konventionell (ribosomal) synthetisierte und prozessierte Peptid konnte kürzlich in Bacillus amyloliquefaciens plantarum nachgewiesen werden und weist antibakterielle Aktivität gegenüber nahe verwandten Gram-positiven Bakterien auf und wird durch ein 12-Gen Cluster kodiert (Scholz et al. 2011 , Abb. 1a). Bacilysin [L-alanyl-[2,3-epoxycyclohexanone-4]-L- Alanin ist ein Dipeptid mit einem L-Alanin-Rest am N-Terminus und einer nicht- proteinogenen Aminosäure, L-Anticapsin, am C-Terminus. Das Dipeptid supprimiert eine Vielzahl von Bakterien und die Hefe Candida albicans (Steinborn et al. 2005). Bacilysin wurde im Kulturfiltrat von ABI01 , gewachsen in Glutamat-freiem Landy- Medium - durch HPLC nachgewiesen (Abb. 1 1 ). Die in ABI01 nicht-ribosomal synthetisierten Polyketide zeichnen sich durch eine hohe antibakterielle Aktivität aus. Sie wurden im Kulturfiltrat nach Wachstum von ABI01 in Landy-Medium durch HPLC nachgewiesen. Bacillaen besteht aus einer Vielzahl extrem-labiler, offenkettiger Isomere, darunter Bacillaen und Dihydrobacillaen als Hauptprodukte (Chen et al. 2009), die durch Oxidation schnell abbaubar sind. Repräsentanten dieser Stoffgruppe werden nach 7 - 7,5 min von der HPLC-Säule eluiert (Abb. 6). Difficidin und Oxydifficidin sind hochgradig ungesättigte makrozyklische Polyen Laktonphosphat Ester mit antibakterieller Breitband-Wirkung (Zimmermann et al. 1987). Sie werden nach 8,5 min. von der HPLC-Säule eluiert (Abb. 6). Dagegen erfolgt die Elution von Makrolaktin bereits nach 6 min. (Abb. 6). Makrolaktine enthalten drei getrennte Dien-Strukturelemente innerhalb eines Laktonringes, der aus 24 Elementen zusammengesetzt ist (Gustafson et al. 1989).

Probenvorbereitung: Die Probenvorbereitung für die HPLC der Lipopeptide und Polyketide erfolgte durch Behandlung mit dem Ionenaustauscher Amberlit (AD16) in folgender Weise:

1. 3 g AD16 werden in 20 ml Plastiksäulen eingefüllt und 3 x mit dest. Wasser gespült.

2. 5 ml Probe (Kulturüberstand der Bacillus-Kultur) werden auf die Säule gegeben und nachfolgend mit 3 x 10 ml dest. Wasser gespült.

3. Die an AD16 gebundenen Sekundärmetaboliten werden mit 3 x 2,5 ml Methanol eluiert.

4. Die Proben werden im Vakuum-Rotationsverdampfer bei 40°C bis zur Trocknung verdampft. Anschließend in 0,5 ml 90%igem Methanol unter Vortexen aufgenommen. Die Proben stehen jetzt für anschließende Bioautographie oder HPLC zur Verfügung.

HPLC der Lipppeptide und Polyketide

Die Auftrennung der Proben durch HPLC („high pressure liquid chromatography") wurde mit einem Agilent 1100 HPLC System (Agilent, Waldbronn, Deutschland) bei einer Flussrate von 1 ,5 ml/min. und einem Gradient von 0% Acetonitril + 0,1% Ameisensäure zu 100% Acetonitril + 0,1 % Ameisensäure durchgeführt (Chen et al. 2006). 5 ml Probe wurden über eine MERCK LiChrolut RP- 0 (500 mg) Säule nach Konditionierung der Säule mit 3 ml Methanol und 2 x 3 ml dest. Wasser aufgetragen. Dann wird mit 2 x 3 ml dest. Wasser und mit 2 x 3ml 50 %igem Methanol gewaschen. Die Säule wird 5 min. im Vakuum getrocknet, bevor die Eluierung mit 3 x 1 ,5 ml Methanol erfolgt.

Massenspektroskopie der Lipppeptide und von Plantazolicin

Für den Nachweis von Lipopeptiden von ganzen Zellen, B. amyloliquefaciens plantarum wurde auf Agar-Platten mit Landy-Medium (Landy et al. 1948) drei Tage bei 30°C angezogen. Zur Erstellung der Oberflächenextrakte für die Massenspektroskopie (MALDI TOF MS, Leenders et al. 999) wurde Zellmaterial von den Agarplatten entnommen, in 0,5 ml Eppendorf-Tubes überführt und mit 100 mikroLiter Matrix-Medium (50% Acetonitril/ 0,1%Trifluor-Essigsäure) extrahiert.

Referenzen

Chen, X.-H et al. 2006. Structural and functional characterization of three polyketide synthase gene Clusters in Bacillus amyloliquefaciens FZB42. J. Bacteriol. 188:4024- 4036

Chen, X-H., Koumoutsi, A., Scholz, R., Borriss, R. 2009. More than anticipated- Production of antibiotics and other secondary metabolites by Bacillus amyloliquefaciens FZB42. J. Mol. Microbiol. Biotechnol 16:14-24

Gustafson, K., M. Roman, W. finical 1989. The macrolactins, a novel class of antiviral J and cytotoxic macrolides from a deep-sea marine bacterium. J. Am. Chem. Soc.

111 :7519-7524

Landy, M. et al. 1948. Bacillomycin, an antibiotic from Bacillus subtilis active against pathogenic fungi. Proc. Soc. Exp. Biol. Med. 67:539-541

Leenders, F., T. H. Stein, B. Kablitz, P. Franke, J. Vater. 1999. Rapid typing of Bacillus subtilis strains by their secondary metabolites using matrix assisted laser desorption/ionization mass spectrometry of intact cells. Rapid Commun. Mass Spectrom. 13. 943-949

Nishikori T., H. Naganawa, Y. Muraoka, T. Aoyagi, H. Umezawa. 1986. Piipastatins: new Inhibitors of phospholipase A2, produced by Bacillus cereus BMG302-fF67. III. Structural elucidation of piipastatins. J. Antibiot. 39:755-761

Peypoux, F., J. M. Bonmatin, J. Wallach 1999. Recent trends in the biochemistry of surfactin. Appl. Microbiol. Biotechnol. 51 :553-563

Scholz et al. 201 1 . Plantazolicin, a novel microcin B17/streptolysin S-like natural product from Bacillus amyloliquefaciens FZB42. J. Bacteriol. 193: 215-224

Steinborn, G., Hajirezaei, M-R, Hofemeister, J. 2005. Bac genes for recombinant bacilysin and anticapsin production in Bacillus host strains. Arch Microbiol 183:71 -79 Thimon, L, Peypoux, F., Wallach, J., Michel, G. 1995. Effect of the lipopeptide antibiotic, iturin A on morphoiogy and membrane structure of yeast cells. FEMS Microbiol. Lett. 128: 101-106

Zimmerman, S.B., C. D. Schwartz, R. L. Monaghan, B. A. Belak, et al. 1987. Difficidin and oxydifficidin: novel broad spectrum antibacterial antibiotics produceed by Bacillus subtilis. 1. Production, taxonomy and antibacterial activity. J. Antibiot. 40:1677-1681

Beispiel 6 : Herstellung einer Sporensuspension

Im Detail wird Bacillus amyloliquefaciens plantarum ABI01 auf ein herkömmliches Medium geimpft, das eine geeignete Kohlenstoffquelle, Stickstoffquelle und anorganische Verbindungen aufweist, und bei bestimmter Temperatur und pH unter aeroben Bedingungen kultiviert. Beispiele der Kohlenstoffquelle beinhalten Glucose, Melasse, Lactose, Sucrose, Maltose, Dextrin, Stärke, Mannitol, Sorbitol und Glycerin. Bevorzugt werden Glucose und Stärke verwendet. Beispiele der Stickstoffquelle beinhalten eine anorganische Quelle wie Ammoniak, Ammoniumchlorid und Ammoniumsulfat und eine organische Quelle wie Magermilchpulver, Casein, Pepton, NZ-Amin, Rindfleischextrakt, Hefeextrakt, Maisquellwasser (com steep liquor), Caseinhydrolysat, Fisch oder Fischmehl und entfettete Sojabohne oder Sojamehl. Bevorzugt werden Hefeextrakt oder Maislauge gewählt. Beispiele der anorganischen Verbindungen beinhalten Kaliummonohydrogenphosphat,

Kaliumdihydrogenphosphat, Magnesiumsulfat, Eisensulfat, Mangansulfat und Calciumcarbonat. Für die Kultur kann Schüttelkultur oder Rührkultur mit Belüftung verwendet werden. Die Kulturtemperatur liegt im Bereich von 25 bis 45 °C, und bevorzugt 28° bis 35 °C. Bei der Kultur wird der pH bevorzugt auf einen ziemlich neutralen Wert eingestellt. Die Kulturdauer beträgt 1 bis 2 Tage bis mehr als 90% der vegetativen Zellen zu hitzeresistenten Endosporen umgewandelt sind. Anschließend werden die Sporen im Durchlaufseparator isoliert und mit ca. 10% des gesamten Kulturvolumens aufgenommen. Der Zelltiter des Sporenkonzentrats beträgt mehr als 10 10 cfu/ml.

Gemäß einer Ausführungsform der vorliegenden Erfindung wird der Bacillus amyloliquefaciens plantarum ABI01 auf ein Vorkulturmedium geimpft und bei einer Belüftungsströmungsrate von 1 vvm, 37 °C und 800 Upm 20 Stunden lang kultiviert. Die Vorkultur wird auf ein Fermentationsmedium überimpft und einer Schüttelkultur bei einer Belüftungsströmungsrate von 1 vvm, 40 °C, 800 Upm und pH 7,0 über 60 bis 70 Stunden unterzogen. Bei der Schüttelkultur wird die Fermentierungskultur mit einem Glucosezusatzmedium versorgt, das die restliche Glucose in der Kultur auf einem Wert von 0,5 bis 1 % hält, bis der Gesamtgehalt an Glucose in der Fermentierungskultur 20 % erreicht.

Beispiel 7: Anwendung einer Sporensuspension von ABI01 bei mit Rhizoctonia solani infizierten Kartoffeln

Die Versuche wurden mit Kartoffelpflanzen, die durch Rhizoctonia solani infiziert waren, in Groß-Lüsewitz (Mecklenburg-Vorpommern) durch Agro-Nord (Dr.

Kürtzinger) 2010 (Mai bis August) durchgeführt. Die Untersuchung erfolgte in einem randomisiert parzellierten Versuchsfeld (Abb. 13). Unmittelbar vor der Behandlung

(30.04. 2010) ergab eine Bonitur der Kartoffelknollen, dass 36% frei von Befall waren, 30% eine geringe Befallsdichte (Klassen 1-5) aufwiesen, 14% mittel (Klassen

6-10), 13 % stark (Klassen 11-15) und 14% sehr stark (>Klasse 15) mit Rhizoctonia

Sklerotien infiziert waren. Zum Einsatz kamen die folgenden Varianten: 1 (Kontrolle ohne Applikation), 2 {FZB42 Sporensuspension „Sana Terra", 0,5 L/ha), 3

(Chemisches Fungizid Cuprozin, 0,4 L/ha), 4 („Sana Terra 0,5 L/ha + Cuprozin 0,4

L/ha), 6 (ABI01 Sporensuspension 0,5 L/ha). Die Konzentration der

Sporensuspensionen von ABI01 und FZB42 betrug 2,5 x 10 10 Sporen/g. Die

Behandlung der Knollen erfolgt bei der Abgabe vom Doppelbecherband in die

Pflanzenfurche. Bei einer Pflanzgutmenge von z.B. 25 dt/ha wurden 0,5 L der

Sporensuspension /ha in ca. 80 I Wasser/ha verdünnt und mittels Vollkegeldüsen auf die in die Furche fallenden Kartoffeln gesprüht. Es wurden 100 Knollen/Parzelle gelegt. Die 2. Bonitur wurde am 30. 06. 2010 (2 Monate nach Pflanzung) durchgeführt und zeigte, dass bei den Varianten 2, 3, 4, und 6 mindestens 100% im Vergleich zur Kontrolle (1) aufgelaufen waren. Das entspricht einer Anzahl von ca. 75 Knollen/Parzelle. Die 4. Bonitur wurde am 13. 10. 2010 (Ernte, ca. 5,5 Monate nach dem Legen der Kartoffeln) durchgeführt.

Die in der Tabelle 8 dokumentierten Ergebnisse belegen eine etwa gleichartige fungizide Wirkung des chemischen Fungizids Cuprozin (Variante 3) und des biologischen Pflanzenschutzmittels FZB42 (Variante 2), die zu einer Reduktion der durch Rhizoctonia solani verursachten Wurzeltöterkrankheit („black scurf") von 24,33% (Kontrolle) auf 15,00 % (Variante 3) bzw. 14,08% (Variante 2) führten. Die beste Wirkung wurde mit der Sporensuspension von ABI01 (Variante 4) erzielt. Hier konnte eine Reduktion des Befalls durch Rhizoctonia solani auf 10,58% aller untersuchten Knollen erreicht werden.

Beispiel 8: Anwendung einer Sporensuspension von B. amyloliquefaciens subsp. plantarum bei Tabakpflanzen

Das Experiment wurde in der Zeit vom 15. Mai bis zum 26. September 2010 auf dem Feld von Chen Dibin bei two village Shunzhou town Yongsheng county Lijiang city durchgeführt. Höhe war 2207m, N26.61555 nördlicher Breite und E100.5561 Länge. Der Boden wies eine mittlere Fruchtbarkeit auf und bestand aus lehmigen Ton (25,6% Ton, 48,2 % Sand und 26,2% Schluff). Weitere Boden parameter: Pflugtiefe 21 cm, pH 5,4, organische Bestandteile: 40.60g/kg, verfügbarer Stickstoff (N) 152, 10 mg/kg, verfügbarer Phosphor (P): 12,23 mg/kg, Kalium (K) 485.41mg/kg. Vorhergehende Bepflanzung: Brache, verschiedene Tabakvarietäten. Pflanzgröße: 20 cm * 50 cm (1100 Tabakpflanzen per Mu). Die Bepflanzung wurde am 19. Mai 2010 vorgenommen.

Es wurden 5 Varianten mit jeweils drei Wiederholungen auf insgesamt 15 Parzellen durchgeführt. Jede Versuchsparzelle (8,5 m x 3,6 m = 30,6 m 2 ) wurde mit 60 Pflanzen bepflanzt. Die Gesamtfläche des Versuchsfeldes war 1 ,2 Mu. Der Einsatz von FZB42 Sporensuspension (2,5 x 1010 Sporen/ml) in einer Konzentration von 33 mL /Mu (0,5 L/ha) erfolgte durch Angießen während der Bepflanzung der Versuchsflächen (Variante 4), bzw. Besprühen nach dem Anwachsen der Pflanzen (Variante 5). Vor Anwendung wurden die Sporensuspensionen mit Leitungswasser 1 : 10000 bzw. 1 : 2000 verdünnt. Anschließend wurde ausreichend mit Wasser gegossen. Die Kontrollen wurden mit Wasser (Variante 1 ) bzw. mit chinesischem Biodünger (40-60 g/Mu) zur Pflanzungszeit (Variante 2) bzw. nach dem Anwachsen der Pflanze als„topdressing" (60-100 g/Mu, Variante 3) durchgeführt. Drei Bonituren, die nach 46, 65 und 81 Tagen nach Bepflanzung durchgeführt wurden, ergaben, dass durch die Anwendung von FZB42 der Krankheitsbefall der Tabakpflanzen deutlich vermindert werden konnte (nicht nur gegenüber der Kontrolle, sondern auch gegenüber den Varianten 2 und 3, die mit einem chinesischen Biodünger behandelt worden waren. Als besonders vorteilhaft erwies sich die Variante 4, bei der die Behandlung mit der Sporensuspension unmittelbar bei der Pflanzung erfolgte (Tabelle 9). Im Einzelnen kam es zur statistisch signifikanten Unterdrückung der folgenden Krankheiten, die bei allen drei durchgeführten Bonituren gleichermaßen festgestellt werden konnte:

1. Tabakmosaikvirus (TMV): 1. Bonitur: 3,27 % (FZB42) /27,78 (Kontrolle); 2.

Bonitur: 9,80 % (FZB42)/ 42,48% (Kontrolle); 3. Bonitur: 16,34 % (FZB42)/ 84,97 (Kontrolle)

2. Bakterielle Tabakwelke (Ralstonia solanaceum): 1 . Bonitur: 0,00 % (FZB42) /9,80 (Kontrolle); 2. Bonitur: 3,27 % (FZB42)/ 19,61 % (Kontrolle); 3. Bonitur: 9,8 % (FZB42)/ 29,41 (Kontrolle)

3. Braunfleckenkrankheit (Alternaria alternata): 1. Bonitur: 0,00 % (FZB42) /23,53 % (Kontrolle); 2. Bonitur: 15,69 % (FZB42)/ 62,75 % (Kontrolle); 3. Bonitur: 31 ,37 % (FZB42)/ 105,88 (Kontrolle)

4. Echter Mehltau (Erisyphe cichoracearum) : 1. Bonitur: 6,54 % (FZB42) /43,14 % (Kontrolle); 2. Bonitur: 27,45 % (FZB42)/ 94,12 % (Kontrolle); 3. Bonitur: 52,94 % (FZB42)/ 117,65 % (Kontrolle)

5. „Climatic Spot" (Fleckenkrankheit durch abiotischer Stress): 1. Bonitur: 0,00

% (FZB42) /7,84 % (Kontrolle); 2. Bonitur: 27,45 % (FZB42)/ 43,14 %

(Kontrolle); 3. Bonitur: 52,94 % (FZB42)/ 117,65 % (Kontrolle)

Neben verbesserter Krankheitsresistenz, einschließlich viraler und bakterieller

Erkrankungen, zeigten die Ergebnisse, dass der Zusatz von Stämmen der

Subspecies ß. amyloliquefaciens plantarum zu verbessertem Wachstum und erhöhten Erträgen bei den Tabakpflanzen führt. So konnte bei Anwendung von

FZB42 (Variante 4) eine Ertragssteigerung von 10,88% gegenüber der Kontrolle erzielt werden. Insgesamt wurde eine Wertsteigerung der geernteten Tabakblätter per u von 15,68% erzielt. Eigene Patentanmeldungen:

1. Europäische Patentanmeldung EP 0 8015 973.4

Antibakterielles Mittel zur Behandlung von Feuerbrand bei Obstgehölzen und anderen bakteriell verursachten Pflanzenkrankheiten

Anmelder: ABITEP GmbH

2. Deutsche Patentanmeldung DE 11 2004 001 054.3

„Sequenz für die BacillomycinD Synthese in Bacillus amyloliquefacienFZB42

Anmelder Prof. Dr. Rainer Borriss

3. Deutsche Patentanmeldung DE 10 20040 273 35.9

„Sequenzen für die Synthese antibakteriell wirkender Polyketide"

Anmelder Prof. Dr. Rainer Borriss

In der Patentschrift angeführte Literatur:

l Borriss R, Chen X, Rueckert C, Blom J, Becker A, Baumgarth B, Fan B, Pukall R, Schumann P, Spröer C, Junge H, Vater J, Pühler A, Klenk HP. Relationship of Bacillus amyloliquefaciens clades associated with strains DSM7T and FZB42: a proposal for Bacillus amyloliquefaciens subsp. amyloliquefaciens subsp. nov. and Bacillus amyloliquefaciens subsp. plantarum subsp. nov. based on their discriminating complete genome sequences. Int J Syst Evol Microbiol. 2010 Sep 3. [Epub ahead ofprint]

2. Rückert C, Blom J, Chen X, Reva O, Borriss R. J Biotechnol. 2011 Genome sequence of B. amyloliquefaciens type strain DSM7 (T) reveals differences to plant-associated B. amyloliquefaciens FZB42. J Biotechnol. Jan 22. [Epub ahead of print]

3. Fan B, Chen XH, Budiharjo A, Bleiss W, Vater J, Borriss R. Efficient colonization of plant roots by the plant growth promoting bacterium Bacillus amyloliquefaciens FZB42, engineered to express green fluorescent protein J Biotechnol. 2011 Jan 13. [Epub ahead of print]

4. Scholz R, Molohon KJ, Nachtigall J, Vater J, Markley AL, Süssmuth RD, Mitchell DA, Borriss R. Plantazolicin, a novel microcin B17/streptolysin S-like natural product from Bacillus amyloliquefaciens FZB42. J Bacteriol. 2011 Jan;193(1 ):215-24 Chen XH, Scholz R, Borriss M, Junge H, Mögel G, Kunz S, Borriss R. Difficidin and bacilysin produced by plant-associated Bacillus amyloliquefaciens are efficient in Controlling fire blight disease. J Biotechnol. 2009 Mar 10;140(1-2):38-44.

Chen XH, Koumoutsi A, Scholz R, Schneider K, Vater J, Süssmuth R, Piel J, Borriss R. Genome analysis of Bacillus amyloliquefaciens FZB42 reveals its Potential for biocontrol of plant pathogens J Biotechnol. 2009 Mar 10; 140(1 - 2):27-37

Chen XH, Koumoutsi A, Scholz R, Borriss R. More than anticipated - production of antibiotics and other secondary metabolites by Bacillus amyloliquefaciens FZB42. J Mol Microbiol Biotechnol. 2009; 16(1 -2):14-24. Chen XH, Koumoutsi A, Scholz R, Eisenreich A, Schneider K, Heinemeyer I, Morgenstern B, Voss B, Hess WR, Reva O, Junge H, Voigt B, Jungblut PR, Vater J, Süssmuth R, Liesegang H, Strittmatter A, Gottschalk G, Borriss R. Comparative analysis of the complete genome sequence of the plant growth-promoting bacterium Bacillus amyloliquefaciens FZB42. Nat Biotechnol. 2007 Sep;25(9): 1007-14.

Idris EE, Iglesias DJ, Talon M, Borriss R. Tryptophan-dependent production of indole-3-acetic acid (IAA) affects level of plant growth promotion by Bacillus amyloliquefaciens FZB42. Mol Plant Microbe Interact. 2007 Jun;20(6):6 9-26

Chen XH, Vater J, Piel J, Franke P, Scholz R, Schneider K, Koumoutsi A, Hitzeroth G, Grammel N, Strittmatter AW, Gottschalk G, Süssmuth RD, Borriss R. Structural and functional characterization of three polyketide synthase gene Clusters in Bacillus amyloliquefaciens FZB 42. J Bacteriol. 2006 Jun;188(11):4024-36.

Koumoutsi A, Chen XH, Henne A, Liesegang H, Hitzeroth G, Franke P, Vater J, Borriss R. Structural and functional characterization of gene Clusters directing nonribosomal synthesis of bioactive cyclic lipopeptides in Bacillus amyloliquefaciens strain FZB42. J Bacteriol. 2004 Feb;186(4): 1084-96.

Idriss EE, Makarewicz O, Farouk A, Rosner K, Greiner R, Bochow H, Richter T, Borriss R. Extracellular phytase activity of Bacillus amyloliquefaciens FZB45 contributes to its plant-growth-promoting effect. Microbiology. 2002 Jul;148(Pt 7):2097-109. Sambrook, J., Fritsch, E.F., Maniatis, T. Molecular cloning a laboratory manual (2th ed.) CSHLP, New York 1989

Tabellen

Tabelle 1 : Gencluster von ABIOl involviert in die Synthese antimikrobieller Verbindungen

Die fettgedruckten Verbindungen wurden durch HPLC bzw. MALDI TOF MS direkt im Kulturfiltrat oder zellgebunden bei ABIO l nachgewiesen.

Tabelle 2: Beispiel für die Charakterisierung von Isolaten aus Bodenproben - entnommen fünf Monate nach Anwendung von FZB42 zu Antirhinwn major Kulturen, Chengong County, Kunming. Für die PCR wurde eine Hybnsierungstemperatur von 55°C benutzt.

Strain Lactose Cellulose RM Nrs Pzn Morphologie (Nähragar)

MM (785 bp) (839 bp) (821 bp)

FZB42 + + 785 bp 839 bp 821 bp Rauh, flach, dendritisch, weiss bis durchscheinend

KM 1-1 + + 785 bp 839 bp 821 bp wie FZB42

KM 1-2 + + 785 bp 839 bp 821 bp wie FZB42

KM 1-3 + + 785 bp 839 bp 821 bp wie FZB42

KM 2A + + 785 bp 839 bp 821 bp wie FZB42

KM 2B + + 785 bp 839 bp 821 bp wie FZB42

KM3 + + 785 bp 839 bp 821 bp wie FZB42

KM 4-1 + + 785 bp 839 bp 821 bp wie FZB42

KM 4-2 + + 785 bp 839 bp 821 bp wie FZB42

KM 5-1 + + 785 bp 839 bp 821 bp wie FZB42

KM 5-2 + 785 bp 839 bp 821 bp wie FZB42

KM 6-1 + + 785 bp 839 bp 821 bp wie FZB42

KM 6-2 + + 785 bp 839 bp 821 bp wie FZB42

DSM7 T + - - - - rauh, weiß

B. subtilis - + - - - kremig

DSM10 T

Tabelle 3: Eigenschaften von B. amyloliquefaciens plantarum ABIOl (DSM 10-1092)

Tabelle 4: Vergleichende Charakterisierung der Genome von FZB42 und AB 101

Tabelle 5: Unikale Gene in ABIOl . Keine Annotation in FZB42

Tabelle 6: Statistisch gesicherte Sequenzunterschiede von AbiOl und FZB42 innerhalb von CDS

1 Vermutlich Sequenzierungsfehler FZB42

2 „Stille" Mutation Tabelle 7 Activitätsspektrum von Amylocyclicin A

Indikator Stamm Ergebnis 3 Quelle oder

reference b

Bacillus brevis ATCC8246 + ATCC

Bacillus subtilis 168 + Stammsammlung

Bacillus cereus ATCC 14579 + ATCC

Clavibacter michiganensis ++ Stammsammlung

NCPPB382

Bacillus licheniformis ATCC9789 + ATCC

Micrococcus luteus ++ Stammsammlung

Bacillus pumilus + Stammsammlung

Bacillus subtilis CU1065 + Stammsammlung

Bacillus subtilis HB0042 ++ Stammsammlung

Bacillus sphaericus ATCC 14577 ++ ATCC

Paenibacillus polymyxa + Stammsammlung

Paenibacillus granivorans ++ Stammsammlung

Bacillus megaterium 7 AI + Stammsammlung

Arthrobacter spez. - Stammsammlung

Staphylococcus aureus - Stammsammlung

E. coli ll - Stammsammlung

Klebsiella terrigena - Stammsammlung

Pseudomonas - Stammsammlung

Erwinia caratovora - Stammsammlung

a Grad der Hemmung im Biotest: ++: Starke Hemmung; +: Hemmung; -: keine Hemmung ATCC: American Type Culture Collection Tabelle 8: Biokontrollwirkung chemischer Fungizide (Cuprozin, Variante 3) und von Biofungiziden (FZB42, Variante 2 und ABIOl, Variante 6) bei Rhizoctonia solani infizierten Kartoffeln. Die Variante 4 ist eine Kombination von FZB42 und Cuprozin). Die Anwendung 6 (ABIOl) zeigt die beste Wirkung gegen Rhizoctonia solani.

* von 100 Knollen aus der Fraktion 35 - 55 mm

Tabelle 9. Befall von Tabakpflanzen mit TMV (Tabak-Mosaik- Virus), bakterieller Welke (Ralstonia solanacearum), Braunfleckenkrankheit (Alternaria alternatä) und echter Mehltau (Erysiphe cichoracearum). Varianten: 1 (Kontrolle, Wasser), 2 , 3 (Bodenverbesserer), 4, 5 (FZB42)

TMV (Tabakmosaikvirus) Tabak bakterielle Welke Braunfleckenkrankheit Echter Mehltau Tabak„Climatic spot"

Zeit Variante

Rrank eitsindex Inzidenz Krankheitsindex Inzidenz Rrankheitsindex Inzidenz Krankheitsindex Inzidenz Krankheitsindex Inziden

1 27.78a 4.57a 9.80 1.96 23.53 1.31 43.14 3.27 7.84 0.65

2 6.53b 1.31 b 3.27 0.65 11.76 0.65 31.37 1 .96 0.00 0.00

Jun.

3 8.17b 1.31 3.27 0.65 11.76 0.65 15.69 1 .31 0.00 0.00

29

4 3.27b 0.65b 0.00 0.00 0.00 0.00 6.54 0.65 0.00 0.00

5 6.53b 1.31 b 0.00 0.00 11.76 0.65 9.15 0.65 0.00 0.00

1 42.48b 6.53b 19.61 a 3 92a 62.75 2.61 94.12 5.23 43.14 2.61

2 22.87ab 4.57ab 3.27b 0.65b 47.06 1 .96 66.67 3.92 23.53 1 96

July

3 22.88ab 3.27ab 9.80ab 1.96ab 47.06 1 .96 47.06 2.61 15.69 1.31

4 9.80a 1 .96a 3.27b 0.65b 15.69 0.65 27.45 1.96 27.45 1 96

5 19.61 ab 3.92ab 3.27b 0.65b 31 .37 1.31 27.45 1.31 32.68 1.96

1 84.97a 8.49a 29.41a 5.88a 105.88 4.57 117.65 6.53 117.65 6.53

2 45.75ab 5.23ab 9.80b 1.96b 78.43 3.27 66.67 3.92 82.35 4.57

Aug.

3 52.29ab 5.23ab 13.07ab 2.61 ab 43.14 1.96 70.59 3.92 62.75 3.92

4 16.34b 3.27b 9.80b 1.96b 31.37 1.31 52.94 3.27 52.94 3.27

5 35.95ab 5.23b 9.80b 1.96b 45.10 1.96 56.86 3.27 72.55 3.92