Login| Sign Up| Help| Contact|

Patent Searching and Data


Title:
METHOD FOR THE PRODUCTION OF A FEED ADDITIVE FOR THE OXYGEN-INDEPENDENT, ENZYMATIC DECOMPOSITION OF MYCOTOXINS, FEED ADDITIVE, AND USE THEREOF
Document Type and Number:
WIPO Patent Application WO/2010/031100
Kind Code:
A1
Abstract:
In a method for producing a feed additive for the oxygen-independent, enzymatic decomposition of mycotoxins, in particular fumonisins, at least one nucleic acid sequence of genes corresponding to sequence ID No. 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, and 24 is provided, said at least one nucleic acid sequence is expressed in prokaryotic or eukaryotic host cells, and an enzyme that is produced thereby and corresponds to sequence ID No. 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, and 25 or a complete, recombinant host organism is used in animal feed, optionally along with a co-substrate.

Inventors:
MOLL, Wulf-Dieter (Donaustraβe 6, Stockerau, A-2000, AT)
HARTINGER, Doris (Leystraβe 8/56, Wien, A-1200, AT)
HEINL, Stefan (Naaffgasse 8/6, Wien, A-1180, AT)
GRIEβLER, Karin (Opferplatz 2, Pottenbrunn, A-3140, AT)
BINDER, Eva Maria (W.A. Mozarstraβe 8, Tulln, A-3430, AT)
SCHATZMAYR, Gerd (J. Haydngasse 1, Tulln, A-3430, AT)
GRABHERR, Reingard (Ludwig Kaiserstraβe 11, Preβbaum, A-3021, AT)
Application Number:
AT2009/000363
Publication Date:
March 25, 2010
Filing Date:
September 18, 2009
Export Citation:
Click for automatic bibliography generation   Help
Assignee:
ERBER AKTIENGESELLSCHAFT (Industriestraβe 21, Herzogenburg, A-3130, AT)
MOLL, Wulf-Dieter (Donaustraβe 6, Stockerau, A-2000, AT)
HARTINGER, Doris (Leystraβe 8/56, Wien, A-1200, AT)
HEINL, Stefan (Naaffgasse 8/6, Wien, A-1180, AT)
GRIEβLER, Karin (Opferplatz 2, Pottenbrunn, A-3140, AT)
BINDER, Eva Maria (W.A. Mozarstraβe 8, Tulln, A-3430, AT)
SCHATZMAYR, Gerd (J. Haydngasse 1, Tulln, A-3430, AT)
GRABHERR, Reingard (Ludwig Kaiserstraβe 11, Preβbaum, A-3021, AT)
International Classes:
C12N9/10; A23K1/165; C12N9/18; C12N15/52
Attorney, Agent or Firm:
CUNOW, Gerda (Miksovsky & Pollhammer OG, Währinger Straβe 3, Wien, A-1096, AT)
Download PDF:
Claims:
- 21 -

P a t e n t a n s p r ü c h e

1. Verfahren zur Herstellung eines Futtermittelzusatzes zum sauerstσffunabhängigen, enzymatischen Abbau von Mykotoxinen, insbesondere Fumonisinen, dadurch gekennzeichnet, daß wenigstens eine Nukleinsäuresequenz von Genen entsprechend Sequenz ID-Nr. 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 und 24 vorgelegt wird, die wenigstens eine Nukleinsäuresequenz in prokaryotisehen oder eukaryotischen Wirtszellen exprimiert wird und wenigstens ein dadurch hergestelltes Enzym entsprechend Sequenz ID-Nr. 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23 und 25 oder auch ein kompletter, rekombinan- ter Wirtsorganismus gewonnen werden kann, wobei das wenigstens eine Enzym gegebenenfalls gemeinsam mit einem Cosub- strat in einem Futtermittel eingesetzt wird.

2. Verfahren nach Anspruch 1, dadurch gekennzeichnet, daß vor Einsatz der Enzyme im Futtermittel diese mittels molekulargenetischer Methoden, Mutagenese oder molekularer Evolution verändert werden.

3. Verfahren nach Anspruch 1 oder 2, dadurch gekennzeichnet, daß die Enzyme isoliert werden.

4. Verfahren nach Anspruch 1, 2 oder 3, dadurch gekennzeichnet, daß die Enzyme in einer Schutzhülle verkapselt werden.

5. Verfahren nach einem der Ansprüche 1 bis 4, dadurch gekennzeichnet, daß die Enzyme aus Permease ID-Nr. 3, Car- boxylesterase ID-Nr. 9, Tricarballylat-Dehydrogenase ID-Nr. 11, Citratverwertungsprotein ID Nr. 13, Alkohol-Dehydrogenase ID-Nr. 17, Aminotransferase ID-Nr. 19 oder ID-Nr. 25 und/oder Acetolactat-Synthase ID-Nr. 23 gewählt werden.

6. Verfahren nach einem der Ansprüche 1 bis 5, dadurch gekennzeichnet, daß ein Enzym eingesetzt wird, welches wenigstens 90 % Sequenzidentität mit wenigstens einem der Enzyme ID-Nr. 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23 und 25 auf- weist.

7. Verfahren nach einem der Ansprüche 1 bis 6, dadurch gekennzeichnet, daß bei Einsatz von Aminotransferase ID-Nr. 19 oder ID-Nr. 25 als Cosubstrat ein Keton, insbesondere eine α-Ketosäure, eingesetzt wird.

8. Futtermittelzusatz zum sauerstoffunabhängigen, enzymati- schen Abbau von Mykotoxinen, insbesondere Fumonisinen, in Futtermitteln bzw. im Verdauungstrakt von Tieren, dadurch gekennzeichnet, daß wenigstens ein Enzym der Sequenz ID-Nr. 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23 und 25 oder wenigstens ein kompletter, rekombinanter Wirtsorganismus zur Produktion dieser Enzyme sowie gegebenenfalls zusätzlich wenigstens ein Cosubstrat für wenigstens eines bzw. einige der eingesetzten Enzyme und ein inerter Träger enthalten sind.

9. Futtermittelzusatz nach Anspruch 8, dadurch gekennzeichnet, daß durch molekulargenetische Methoden, Mutagenese oder molekulare Evolution veränderte Enzyme eingesetzt sind.

10. Futtermittelzusatz nach Anspruch 8 oder 9, dadurch gekennzeichnet, daß ein Enzym eingesetzt ist, welches wenigstens 90 % Sequenzidentität mit einem Enzym der ID-Nr. 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23 und 25 aufweist.

11. Futtermittelzusatz nach Anspruch 8, 9 oder 10, dadurch gekennzeichnet, daß die Enzyme, veränderten Enzyme und/oder zu wenigstens 90 % identen Enzyme mit einer Schutzhülle ummantelt eingesetzt sind.

12. Futtermittelzusatz nach einem der Ansprüche 8 bis 11, dadurch gekennzeichnet, daß die Enzyme aus einer Carboxyl- esterase ID-Nr. 9, Tricarballylat-Dehydrogenase ID-Nr. 11,

' einem Citratverwertungsprotein ID Nr. 13, Alkohol-Dehydro- genäse ID-Nr. 17, Aminotransferase ID-Nr. 19 oder ID-Nr. 25 und/oder Acetolactat-Synthase ID-Nr. 23 gewählt sind.

13. Futtermittelzusatz nach einem der Ansprüche 8 bis 12, dadurch gekennzeichnet, daß eine Carboxylesterase ID-Nr. 9, eine Aminotransferase ID-Nr. 19 oder ID-Nr. 25, eine α-Ke- tosäure als Cosubstrat und ein inerter Träger enthalten sind.

14. Verwendung von Genen, wie sie in den Sequenzen ID-Nr. 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 und 24 dargestellt sind, oder kompletten, rekombinanten Wirtsorganismen zur Expression von Enzymsequenzen ID-Nr. 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23 und 25 sowie gegebenenfalls von Co- substraten zur Herstellung eines Futtermittelzusatzes für Tiere.

15. Verwendung nach Anspruch 14, dadurch gekennzeichnet, daß ein Cosubstrat gewählt aus der Gruppe: einer Carboxyl- esterase ID-Nr. 9, einer Aminotransferase ID-Nr. 19 oder ID-Nr. 25, einer α-Ketosäure, und ein inerter Träger eingesetzt werden.

Description:
VERFAHREN ZUR HERSTELLUNG EINES FUTTERMITTELZUSATZES ZUM SAUERSTOFFUNABHÄNGIGEN, ENZYMATISCHEN ABBAU VON MYKOTOXINEN SOWIE FUTTERMITTELZUSATZ UND VERWENDUNG

DESSELBEN

Die vorliegende Erfindung bezieht sich auf ein Verfahren zur Herstellung eines Futtermittelzusatzes zum sauerstoffunabhängigen, enzymatisehen Abbau von Mykotoxinen, insbesondere Fumonisinen und einen Futtermittelzusatz zum sauer- stoffunabhängigen, enzymatisehen Abbau von Mykotoxinen, insbesondere Fumonisinen, in Futtermitteln bzw. im Verdauungstrakt von Tieren sowie die Verwendung derselben.

Verschiedenste Mykotoxine treten auf landwirtschaftlichen Produkten sehr häufig auf und verursachen je nach Art der Mykotoxine schwere wirtschaftliche Schäden, insbesondere in den aus den landwirtschaftlichen Produkten hergestellten Nahrungsmitteln und auch bei Tieren und Menschen, welche derartige Nahrungsmittel verzehren, wobei derartige Schäden äußerst vielfältig sind. Es wurden bereits zahlreiche Methoden entwickelt, um zu versuchen, derartige Mykotoxine zu entgiften bzw. abzubauen oder unschädlich zu machen, um die durch die Mykotoxine verursachten Schäden in den Bereichen von tierischer und menschlicher Ernährung, der Tierzucht, Viehwirtschaft, Verarbeitung von Futter und Lebensmittel und dgl . hintanzuhalten.

Unter den bekannten Mykotoxinen existiert eine Vielzahl von untereinander strukturell verwandten Mykotoxinen, wie bei- spielsweise die Fumonisine, von welchen Fumonisin B 1 das am häufigsten vorkommende Toxin der Gruppe ist. Jedoch sind zahlreiche Derivate und verwandte Moleküle bekannt, welche ebenfalls giftige Wirkungen bei Tieren aufweisen, wie bei- spielsweise im Zusammenhang mit der Fütterung von kontaminiertem Mais. Fumonisine sind in diesem Zusammenhang eine nahezu allgegenwärtige Kontamination auf Mais, welche aber auch auf anderen Getreiden, Nüssen und Gemüse einen stark negativen Effekt in bezug auf die Tiergesundheit und Leistung darstellen.

Der mikrobielle Abbau von Fumonisinen wurde bereits in der EP 1 860 954 beschrieben, gemäß welcher Mikroorganismen zur Entgiftung von Fumonisinen und Fumonisinderivaten eingesetzt werden, bei welchen die detoxifizierenden Bakterien oder Hefen, gewählt aus genau definierten Stämmen zur Entgiftung von Fumonisinen Futtermitteln zugesetzt werden.

Auch wurden bereits katabolische Stoffwechselwege für den biologischen Abbau von Fumonisinen und die hiefür verantwortlichen Gene und Enzyme beschrieben. So beschreibt beispielsweise die EP 0 988 383 Fumonisin entgiftende Zusammensetzungen und Verfahren, wobei die eingesetzten, Fumoni- sin abbauenden Enzyme in erster Linie in transgenen Pflanzen produziert werden, bei welchen die Entgiftung von Fumonisinen mit Hilfe einer Aminooxidase , welche für ihre enzy- matische Aktivität molekularen Sauerstoff benötigt, erfolgt.

Des weiteren beschreibt die WO 2004/085624 Transaminasen, Deaminasen und Aminomutasen und Zusammensetzungen und Verfahren zur enzymatischen Detoxifizierung, wobei insbesondere aminierte Toxine, beispielsweise Fumonisine, entgiftet werden. In diesem Zusammenhang werden Polypeptide, welche eine Deaminaseaktivität besitzen, zur Entgiftung eingesetzt. Bisher bekannten Verfahren ist jedoch gemeinsam, daß sie für eine Detoxifizierung der Mykotoxine molekularen Sauerstoff für die beschriebenen, katabolischen Stoffwechselwege benötigen, wobei die insbesondere erforderlichen Aminooxi- dasen unter sauerstoffunabhängigen Bedingungen nicht arbeiten können. Ein Einsatz von derartigen Genen und Enzymen zur Detoxifizierung von Futtermitteln, beispielsweise im Verdauungstrakt von Tieren, ist aufgrund des im wesentlichen sauerstofffreien Milieus in dem Verdauungstrakt von Tieren nicht möglich bzw. zeigen die bekannten Gene oder Enzyme keinerlei Wirkung.

Die Erfindung zielt nun darauf ab, ein Verfahren zur Herstellung eines Futtermittelzusatzes zur Verfügung zu stel- len, mit welchem es gelingt, Mykotoxine und insbesondere Fumonisine unabhängig von Sauerstoff sicher und zuverlässig zu entgiften.

Zur Lösung dieser Aufgaben ist das erfindungsgetnäße Verfah- ren im wesentlichen dadurch gekennzeichnet, daß wenigstens eine Nukleinsäuresequenz von Genen entsprechend Sequenz ID- Nr. 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 und 24 vorgelegt wird, die wenigstens eine Nukleinsäuresequenz in pro- karyotischen oder eukaryotischen Wirtszellen exprimiert wird und wenigstens ein dadurch hergestelltes Enzym entsprechend Sequenz ID-Nr. 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23 und 25 oder auch ein kompletter, rekombinanter Wirtsorganismus gewonnen werden kann, wobei das wenigstens eine Enzym gegebenenfalls gemeinsam mit einem Cosubstrat in einem Futtermittel eingesetzt wird. Dadurch, daß wenigstens eine Nukleinsäuresequenz von Genen entsprechend den nachfolgenden Sequenz ID-Nr. 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 und 24 vorgelegt wird, gelingt es, spezifische, Fu- monisine bzw. Mykotoxine abbauende Gene zu klonieren und zu produzieren, wobei beispielsweise die Expression in E. coli und Pichia pastoris unter Verwendung von Standardverfahren durchgeführt wird, bei welcher Expression Enzyme entspre- chend den Sequenz ID-Nr. 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23 und 25 oder auch ein kompletter, rekombinanter Wirtsorganismus gewonnen werden können, welcher gegebenenfalls gemeinsam mit einem Cosubstrat in einem Futtermittel eingesetzt wird. Mit einem nach einem derartigen Verfahren hergestellten Futtermittelzusatz gelingt es, Mykotoxine im Verdauungstrakt von Tieren auch in einem anaeroben oder einem sauerstoffunabhängigen Milieu vollständig und zuverlässig abzubauen, wobei die spezifischen bei diesem Verfahren exprimierten bzw. produzierten Enzyme den Abbau von Fu- monisinen und von Zwischenprodukten des Abbauweges katalysieren.

Als pflanzliche Rohstoffe werden hiebei Getreide bzw. Getreideprodukte, Gräser, Obst oder Gemüse sowie Zwischenpro- dukte, die diese Rohstoffe zur Herstellung von Nahrungsund Futtermittel enthalten, wie beispielsweise Silage, Obstmaische oder dgl . verstanden.

Als Zusatzstoffe werden vor allem Futtermittelzusätze oder Nahrungsmittelzusätze verstanden.

Mit einem derartigen Verfahren gelingt es weiterhin, den SphingolipidstoffWechsel, der durch eine Wechselwirkung der Fumonisine mit dem Enzym Ceramidsynthase behindert wird, aufrecht zu erhalten und gleichzeitig die Fumonisine biologisch zu nicht toxischen Substanzen abzubauen, welche von dem Tier ohne Schädigung ausgeschieden werden können. Schließlich können technologische Anwendungen der Detoxi- fizierung erzielt werden, da dieses Verfahren auch im größeren technischen Maßstab, entgegen den aus dem Stand der Technik bekannten Verfahren, anwendbar ist, so daß mit dem erfindungsgemäßen Verfahren sicher. und zuverlässig ein Futtermittelzusatz hergestellt werden kann, der Mykotoxine und insbesondere Fumonisine im sauerstoffunabhängigen Milieu enzymatisch abbauen kann.

Die in dem erfindungsgemäßen Verfahren eingesetzten Nuk- leinsäuresequenzen bzw. die mittels dieser Nukleinsäurese- quenzen in bakteriellen und eukaryotischen Wirtszellen ex- primierten, in sauerstoffunabhängigem Milieu sauerstoffunabhängig katalytisch wirkenden Enzyme sind nachfolgend aufgelistet.

Nukleinsäuren Sequenzen:

>Seq ID 1 {fum (Fumonisinkatabolismus) Gencluster, 15.420 bp)

TGTCGGCGATCRGTAAACTTCTACCGTGGTCCTCGTTCGCCCACAKCATACATCACA GACRTCGGGATTTCCAACTGAAC GGGTCCCGGCCTGCCGGCCCACATTΓCCCGGAACGCCATATGGGTGATTTCGACAATCC GGTTCCAGGCGAAGATGGGTG CGCCCCATTTAACCGCGGGTCGAAAGAGGTCGATCTGGTCTTGTCCCTGAAAGGTTTTTG GCGTGCAGGGATAAACGACA CCAAGTTGATGCTGGGACGTTATTGCGACGAAGGGAACCCCTTCGTGGCGTGCCGTCACG ACTCCAGGCAGAAGGTTTGC CGTACCGGGACCCGGATTCGTGACAATCGCGGCGACCTGTCCGGTGGTCTTGTAAATGCC CTCGGCCATATAGGCTGCGG CGGCCTCGTGCCGCACCGGGACGAACAATATCCCATTGTCTTCGAGCGCAGCCAGGAGCG GATCCACCTCCGGCGACATG AGGCCGAAGACATACCGGACGCCTTCGACGGCCAAACATCGTGCCAATAATTCTCCGCCC GTGAGGCGCATGACGATCTC CAGTACGAAAGGTGAGTGCCCAGGTTCCGGCACATTCGCTGTGGTTAGTTGATGCGCTGA TCGGCCAACCGACTGAGTGG

AGTTGGATGGCCGCACCTTACCCTGTCGCGCATAACTCTCAGATCCGGAAACGGACC CCGACATTAAAATAGCGGCCGAC CGGATCATAGGCAGAGCTGGTCGGGCTGGAAAAACTGCTGGGGTCGTTCGTCGCTATTGG CGGATCTCGGTCGAACAAAT

TATTGACCGATAGAAACAGCTGCTGCTTCTGGCCAAAAGCCGCGATGTCGAAGGTCA ATGTCGCGTCGGTGTACCAAACC GCCGGAGCGTGGTTCAAATTCGTATCGACGCCCTCCACATTGTCGGCATTGAACACCGAT GCTGCGATGAAGCGCTGCTG CACGAGAAGCGCCCAATCGTCGGTCGAATATCGCGCCTGGAAGTTGGCCGACCATTTTGG CGTGTCCGGTTGTCCGAGCG AACGGATGGGCGCCGAGCCGGTCGCGATGCGATAGGCAGAGGTATGGTGCGTTGCCAGCG CACGAAGACTGAACGTGCCG CCGCCGACGGGGCGTGAGTAATAGGCCTCGAAGTCAATTCCCGCCGCTTTCTGGACAGCC AGGTTGAGATTGGGACCCGT CACTGTGATGGTGCCGTCCGGATTCTCCGTTATGAGGTCGCAGAAGAAGGTGTTTCCTGC ATCGCACGCGTCGATTTCCT GCTGGGGAAGGAGGAAATCGATCGCGCCCTTCACCTTCACCACATAGCGATCGACCGAAA ACTGAAACCCCGGCACGAAG GCGGGGCGTAGCACCGCGCCGAATGTAAGGACGTCCGCCTTTTCAGGGCGCAAATCCGCG TTGCCGGCGGTAAAGAACCG CGTCTGCACAGCCTGTCCGCCATAAATTGAATTGAGCGTCGCCTGACGGCCGGGGTCGAA TAGCTCGACAAGGCTTGGCC CGCGGATATCTCGCGAACGGGTCGCGCGGAACCTGAGGCCGTCGATCGGCTCATATTCTC CGCCCAGCTTCCAGGTTGTT ACTCCACCGGACTGGCTGTAATCGGCATATCGGACGGCGCCGTTTAAGTTCAGCGAACGT CCCAGCGCGCTGTCCTTCAG AATCGGGACGCCGATTTCGACAAAACCTTCCTTGATGTCATAGCTTCCCGAGAAGGGAAG TGGGTTGTAGAGATTGAAGC CTCCAGGCCGACCTGCCTGCGCCGCCGGAGCCCCCCTGATTCCCGTGATCGAGGTCGTCG CCTGCGATATCGCGTCGGTT TCCTGCCGGGCCTTCTCCTTGCGATATTCGATACCAGCGGCGACCGAGACCGGGCCCGCG CCGAACGACAGGCTATCGCC GAGGTCGCCGGAAATCGTGAGTCCCGCCACATATTGCTCAAGCCTCAGCTGAGCGACGCC ATCAGCGGTGACATAGTCGA TGGCCGACGCGCTCGGCGAGCCTGTGCCGAAGAGATTGAGCGGCACGCAATCTTGGTCGA GGCCGGCCAGTGTTGAACGG CAGACGATATTGCCCGCGGGATCGCGGACCGCATCGACGGCGGCGTAGAGATTGCGGTTG ATGGTGAGATTGTTTTCACG AAGCTCGAGGTCCGTAAGGCCAAAGGAGGCCGAGCCATCGAGTTTCCAGCCATTGCCAAT GTCTGCCCGGAAGCCGGCAG CGCCGCGGTAGACCTTTGCGAAATTCTCGATTTCGACCAAGGGAAAGTCGCTTGAGAAGC GACCGACAACGATCGAAGCC TGGGCATTTCTGTCCATGAGCGTCGCGAGTGGAGCCGGAAGGAAGGCGTTATCACGGAAG ATCCGGAAATTATTCGAGCC ACCGACATGCGATATTACGAATGCACCCAGGTTGGTGTGGGAATAAGCATAGGTGCCCTC CGCATACACCTGCACAGTGT CGGACACATCATATGCGGCGCGTAGGAACGCGTTGTAGCGAAGCTGATCCGGGGCGAAGC CGATATTCACGCGCGGTCCA

TCGCCGCCGCTCTGGAACGACGAGCTCGTAAAATTCCCGTAGTCGAAGGTCCCTAGG ACTCCTCCGGGCAAAAACGCGAT GCCTTTCAGAGGGCCGGACGTGACAAGTCCGCCGTAGGATCCGCGAGAÄCTGCGAATAT CGGGCACGACCGTGACGCCTG

TCGTAGCGCCGGGCACGGGATATTGGCCGGCGGCGATGTCGAACCAGCGGCGACCCG TTGCTTCATCGGCCCGGATTCCG

TCCTGTCGAAAATATTCGAAGCTGCCGAGCAAGTGCAACCGGTCGTCGGCAAACGAA GTGCCGAAGGCGATCGAACCGCC GTAGGACGGGAGGTCGCCGCGGGTTGAAACACCCGACTGGAGCTCGGCCCTGATGCCTTC CAGATCTTCGTCGAGCACGA AGTTGATGACGCCCGAAACGGCATCGGAACCGTAGGCGGCCGAGGCGCCGCCCGTCACGA CATCGACGCGCTTGACCAAC GCCTGCGGCAGCACGTTGATATCGACCGAGCCTGTGAAATTGGTCGCGACGAAACGGTTG CCGTTCAGCAGGACGAGGTT CCGGTTTGACCCGAGGCCGCGCATGTTGAGCAGGTTCTGACCGCTGTTCCCCGTTCCGGG TGTCGTGCCAGGGTTGGAGG TCTTCAAGCTGTCGTTGAACACGGGCAGCTGGTTGAGTGCGTCGGCAAGGTTGGTCGGAG ATGCCTCCTTCAACTGCTCG CTGGATACGGCTGTAACCGGCGTCGGCGAATTGAAGCCGTTCTGGAGGCGGCTGCCGGTC ACGACGATTTCGCTCGTTCC CCGGTCCGTGTCCGCTTCGTCCGGCTGACCTATCGATGCGGGATCGCTATCCTGAGCACT GGCAGAGACAGGAAATGCGA GGGTGCCGAGCGCTACTGCGCCGAGCAAACTATTTGCCTTGCCGGGCTTTTCGATTCTGA ACTTCCGATACATCTGCAGT CCCTCCCGAATTGATAGGGACTCCGTTTGAGTCCCCTTGTTTCTTGACGCCGCCGTCGCT CACCACGGTCCGGTCGGAGG CTAAGCGTCGGGCCTAAGGACCCGCAATTTGAACATCAAATGCAATGATCGGAGGCTTCA TTGCACTTCGCGCATAGACC GGCGCGGTAGCTGAAAGTGCCAATAATCAGGGATTTTGCTGAACAGTTGCGGCATGACGT CCGGCATCGGCCACGCGGTT GGCGGCATCGACGTGGCTTTCGCGTCGCCGCCCCTCAAGCACCGGCGAGTTGCATTAAAA TGGGATGAGGCTGGAGAGAC GCAAAATCTCTGAGGACCGCGCTGAACGCGCGATCCGTCGCCTCGAGGGTCTCCGTTACA TCGTCAACTGTATGGGCCGC AGAGAGAAACATATTGTGATAGGGATGAACATAGACGCCGCCCTTCAGGCACGCCGCGGC CCACGCATAGCCGATCCGAA AATCGGGATCGTCCGCAAAGAATATTTGCGGCATCTGCGCCGGGCCCGTCTGCTTCAACT CAAGACCATGGCGCTGAGAC TGTGCCTCCAGGCCTGCCCGCAGGGCGGCGCCGCTGGCGATCAGCGTTTCGAGATAAGGC GTCTCTCGAATGATCCTGAG GGTTTCGATCGCGGCCGCCATCGGTACCGCAGAGAACCAGAAGGAGCCGGTCACAAATAT ATCCCGCGCCGCATCGCGCG CCTTGTTCGAGCCCAGCAGGGCGGAGATCGGATAGCCATTCGCAAAGCATTTTCCCCAGC AACTGAGATCGGGTTCGATA CCCAAATGCGTCCAGCTGCAATCGCGCGCCACCCGGAAACCTGCGCGCACATCGTCAACG ACCAGAAGCGCACCGGTCTC GTCACAACATTTTCGAGCGGTGCGCGCGAACTCAAGCTGGGCGAGGGCCTGGTCCTCAAA TACTTCGTGTCGGAAAGGTG

TCTGAAAGAGATATATCTTGTAATATACTGTATAATTATACACAATGCGCAATCGGA CGACGGGATAGCGGGGCAGGGAG

TTGGCACGGCCGCCTTGATGGTGCTTGGAATACAGCCCATCCTTCTCGGCGCCCTTG TAGAGGAGGGGCGTATTCCCGCC GAGGGGTTGGGATCGGCGGCAACGGTGGAAATACTGGCGATCGCGGCGGGAACATGCATC GGACCCGTTCTTATGAAGAC

GGGATATCTGCGGGCGAAATGCGCGGCACTCTGCTTAATGCTCGCCGCAATCAACTT CGGATTGACGTTGCCGGGTTTCG

ATTTGCCC A TCGTGGCTTGCCGAGCGGCAGCGGGAGCCCTGGAAGGTCTTTCGCTCAGCGCGG CGATCCTGATCATGACT

CATAATCGGCGGCCGGACCGGCTGAGCGGAATATTTCTGGGCGCGCAGACGATACCG CAGGTAATATCTGCTTATTTGCT

CCCGACGG A GATTATTCCGCGCTGGGGGAGCGCAGGCGGCTTCACGATCCTGGGCATTCTCGC GGCGATCGCCGCGATCG CGGC T CTG T GCCTCGTCGATCGCGTTGAGCTCGATCCGACGACCGTTAACGACGACTTGCAGT GGTCACCCGCGGCGATC

GTC A TT T CG A TGGCGGCATTCGTTCAATTCTCGGGGGTCGGTGCCGCATGGAGCTATCTGGAGC GACTGGCTGCGCAGCA

CGG AT T TT CGGGAGAAACGATCGGTATCGCCATTTCCGGGAGTTTGCTTTGCCAGGTAGGCG GGGCTTGGCTGGCCGCTT

GGATCGGTGGGCGGGTCGGATATCGCTTCGCCTTAATCGCTGGGAGCCTGCTTCAGG CGGGCAACGTGATCGCATTGGCG GTGGCCGATCAGCCAAGCTGGTTTATTTCCGCTTCCTGTGCTTTCGGCCTGTTCTGGTTG GCGATGCAGCCCTTCCAAAT CCGCTTCGCGATCGCGATAGATAACAGCCGGCAGCTTGCTGTACTGCTGACGCCGATCGC CCTCGTCGGGTTGAGCGCGG GGCCCTTGTTGCTCTCTCGCTTTGCCGGGGCGACCGACTTGCGCTGGATCTTTGTGGGGA GTTCGACCTTGTTGCTGGCC AGCGCGCTTCTGTATCTTTGCGCTTCTCTGTTTCAACCGCGCGGAAAGGTGATCGCTGAA ACGGTGGACGTATGAAAAAG ACGGATCGGGGTTCGCGATGACATCGCAGGTCAAGCTTCGTAGCGCGGCAAAGCGGCCGC GCAGTCCTAAAAGCGAGCGA GGTCTTGCTCGTTACGAGTCCTTGCTTGATGCGACCGACAGGCTGTTGGTCGATCTAGAC CCCGATCAGGTCGGTCTCTA TCAGATTGCAGAGGAAGCGGGTGCCTCACCGTCGTCCGTCTATCATTTCTTTCCGACCAA GGAAGTGGCTCATCTCGCTC TGATGCGCCGCTATCTGGAGGGGCTCCGGAATCTCGACGCGATGGAAGTCGACATCGGCC AGCTCGAAAGCTGGCAGGAC CTGATGAAGTTGGATCAGATCAGGGCGCGAGACTATTATAATAGCCACCCGCCCGCCCTC AAGCTTCTGTTCGGCGGATA TGGCGGGGTCGAGGCCAGAAAGCTTGACGAGCGATACTCCGAGGAAATCGTGAGCTCCAT GTATGGCAGATACAACGGCA TTTTCCATATGCCGCAAATGGAGAATGAGGCTCTCATGTTCACGATCTGCTTCGCAATTC TCGACGCGGTATGGGCCGTC TCCTTTCGCCGGTTCGGTGAAATTACGTCGGATTTTCTTCGGGAGGGGCAAGCGGCTTGC ATTGCCTATTGCCGACACTA TCTGCCCGAGCGAACGCCATCAGCGTGAATCCGTTCAACGATATGCAGGAATGTCCGTTG CGTTGAGTTCGGTTCTGAGT TCGGTCGGTTAGGAGGCCCCGCGATAAACCAACGCTCTTCTGTCGAAGGGATGTCGCCTG GTTCGACCAGGCCCTGCGAA GTCAGCCGCAATCAACGAGGCAGATGTCAACGTGGCCAGCAAGTTCAACTGTGAGTTACT CGATCTGCGATCATTTGTTG CGGTGTATGAAACGCGAAGTTTTAGCCACGCCGCGCGGCTTCTGAATCAATCGCAGCCCG CGCTCAGCCGGAGAATCCAG CGCCTCGAGAGTCTCGTGGGCGGTCCGTTGTTCGAGCGGACCAGTCGGTCGCTTGCCGAA ACGGCGCTCGGCAAAGAGTT GCTCCCGGTCGCCCACCGAGCGTTGGAACTTGTCGATACGTCGCTGTTTGCGTCGCCCAA TGTCCGGGAGTTCCGCTGGA CAGACATCACGATTGCCTGTGTACAGACCGCCGCCTTCCATGTTCTCCCGCGAGCTGCGC GCTTGTACATGGATCAAAAT CCGAGGGTCCGACTCCGCATCCTTGACGTGCCGGCGGTCGAGGCTGCGGACCTGGTTGCG AGCGGCGAGGCGGAGTTCGG CATCAGCATTGAGAGCCTGTTGCCATCAAGCCTGCGGTTCGATGCGCTCCACGAGGACCC GTTCGGCCTGGCATGCCACC GAAGCCATCCGCTGGCGTCGCTCGAGATCCTTGAATGGACGCAATTGAAAGGTGAAAGCC TGATCGCCGTTCACCGTGCG AGCCGGAACCGCACGTTGCTCGATGCCGAACTCGCGCGCAACAATATCGCGCTGGAATGG CGGTATGAGGTCGCGCATCT GACGACGGCGCTGGGATTGATCGATGCGCAATTGGGTGTCGCTGTTATGCCCCGCATGGT TATGCCCCGCTCGGGTCGGT CGGAGGTCGTCTGGCGCCCCGTCGTCGCGCCGGTCGTCCAACGCACGATCGGCATCGTTC AGCGCCGCACCGGCTCGATG CACCCTGCCGCACAGCAATTGCTTGCGCGGCTCCGCGCGGCCTGGTCGTCCGCCAATCTG GGCGACATCGCGTCTCGCGA AGATGGGGCATCGTGACACGCGTTCTATGCGCCTGCAGCATCGATGCTCACGATCATTGC ATTTGCTGAGAGACGAACGC GAAGATACCGCTGGGTCACAGGATATCAGTCCATCGAGGCGGGAGAGAAATGTGTGAAAG AGCACCAATGCCGTGGCGGC CGGGCGTCCCCCGCTGCGCCCGCCACGTGGCTTGCGCGGATCAGCGTTTCCCGGGGGGCC TCCGCCATCGCCTGGACCTT CATGCTTGGCGCAACTGCCATTCCCGTGGCTGCGCAAACTGACGATCCGAAGCTCGTTCG TCATACCCAGTCGGGCGCCG TCGAGGGCGTCGAGGGCGACGTCGAGACTTTTTTGGGAATACCCTTCGCGGCTCCGCCGG TCGGCGACCTGCGATGGCGG CCGCCGGCTCCGCCGAGGGCGTGGGCGGGCACCAGGGACGGCCGCCGCTTTGCGCCCGAT TGCATCGGGAACGAGCGGCT TAGAGAGGGGAGCCGGGCTGCCGGGACGAGCGAAGACTGCCTCTATCTGAATATCTGGTC TCCCAAACAGGTCGGTAAGG GGGGGCTCCCCGTCATGATCTGGGTTTACGGCGGTGGGTTTAGCGGCGGTTCTGGCGCGG TGCCATATTATGACGGCTCT GCGCTCGCGCAGAAGGGCGTGGTGGTCGTCACG 1 ^TCAACTATCGCGCCGGGATTCTGGGCTTTCTTGCCCATCCGGCGCT TTCAAAGGAAAGTCCGAATGGCGTGTCGGGCAACTATGGTCTTCTCGACATGCTCGCGGC GTTCAAATGGGTTCAGAACA ACATAAGGGAGTTCGGCGGAGACCCGAACCGTGTCACGGTCTTTGGCGAGTCCGCCGGCG CGAGCGCGCTCGGACTGCTC CTGACCTCGCCGCTCAGTGAGAGCGCCTTCAATCAGGCGATACTGCAAAGTCCGGGTCTG GCCAGGCCGCTCGCCACGCT TTCTGAAAGCGAAGCGAATGGGCTGGAGCTGGGAGCCGATATTTCTGCTCTACGGCGTGC CGATGCGGGCGAATTGACGA AGATCGCGCAATCGCGAATACCCATGTCGCGCCAGTTCACCAAGCCGCGGCCGATGGGTC CGATTCTGGACGGCTATGTT TTGCGCACCCTTGACGTCGATGCCTTCGCCAAGÖGGGCCTTCCGCAAGATACCCGTTCT GGTCGGCGGAAACGCCGACGA AGGGCGCGCTTTTACGGATCGCCTGCCGGTCAAAACGGTCCTTGAATATCGAGCCTATCT CACAGAACAATTTGGTGACG AGGCGGACGCATGGGAGCGTTGTTATCCCGCGAACTCCGACGCCGACGTCCCCGCCGCCG TTGCCCGTCTTTTTGGGGAT AGTCAGTTCAACAACGGGATCGAGCTGCTCTCGGCAGCCTTCGCGAAATGGCGAACGCCG CTTTGGAGATATCGCTTTAC GGGCATTCCAGGAGCCGGCCGTCGCCCCGCCACGCATGGAGACGAAATTCCCTATGTCTT CGCAAATCTGGGGCCGTCGT CCGTATCTATGTTTGGGTCGCTCGAAGGCGGCGCCGGGGCGTCGGACATCAAACTTGCGA CCGAAATGTCCGCGGCCTGG GTGAGCTTCGCGGTGCACGGGGTCCCCGATCAGGGCACGAAATCGCACTGGCCGCGCTTC GAGCGGCGAGGGGAGATCAT

GACTTTTGGTTCGCAGGTTGGCTCTGGGGAAGGTCTTGGAGTTTCGCCGAGCAAAGC CTGCCAACCCTCAAAATAGCGCC

CTACGACGTCGCGATAATTGGAGGTGGCAACGCTGCATTGACGGCAGCCGTGACGGC GCGTGAAGCGGGGGCCTCGGTTC

TTGTGATCGAGCATGCGCCGCGCGCCATGCGCGGCGGCAACAGTCGTCACACACGCA ATATGCGTACGATGCACGAACGT

CCTCGCTGTCGGGCACGCTGAGTTTATCGCGAACCAACGCATTCTTCCTTGGCGGCG GGAAGGCGCTTGTAAACGCATAT TACGCCACGGCCGAACGGCTAGGCGTCGATATTCTCTATGATTCTGAGGTGACCGAGATC AACCTTCAGCAAGGCGTCGT GCAGCGTCTGCAATTGCGCAGCCGGGGATTCCCTGTCGAAGTGGAAGCCAAGGCTGCCAT CGCCTCGTCCGGAGGATTCC AGGCAAATCTTGACTGGCTCTCAAGCGCATGGGGGCCTGCTGCGGCGAACTTCATCGTAC GGGGCACGCCATATGCGACT GGCACGGTGCTCAAGAACCTGTTGGAGCAAGGCGTCGCCTCGGTGGGAGATCCAACCCAA TGCCATGCTGTCGCGATCGA TGGGCGAGCGCCCAAATACGACGGCGGCATCGTCACACGACTGGACTGCGTTCCCTTCTC GATCGTCGTCAACAAGGACG CCTTGCGCTTCTACGATGAAGGCGAAGATGTGTGGCCGAAGCGTTACGCCATATGGGGTC GCTTGGTGGCACAGCAGCCT GATCAGATCGCTTTCAGCATAATCGATCGGCAGGCCGAAGACCTCTTCATGCCGTCAGTG TTCCCCCCCGTGCAAGCGGA CACGATCGCGGGTCTGGCCGAGAAACTCGGTCTGAATCCCGTAACCCTGGAACGCACGGT GGCCGAATTCAACGCCGCAT GCGTGCCCGGCGAATTCGGCGGCCAAGATCTCGACGACCTCCACACCGAGGGAATCGAAC CAAAGAAATCCAACTGGGCC CGACCGATTATTGTGCCCCCGTTCAGCGCCTATCCTCTCCGGCCCGGGATCACCTTCACC TATCTCGGCGTCAAGGTAGA CAGCCGTGCGCGGGTCATCATGGAGACAGGTGAGCCGACAAAAAACCTGTTTGCTTCGGG GGAAATAATGGCGGGCAGCA CGTCATGCAGGATTTTQATCTCGTÄAAAATGCTOTCTQACTTGCCGTCGGCGCCGGAGC TGGAAGCCAGGCGCGTTATGG AGGTGTGCAACGCGTGCCGCTATTGCGAAGGGTTCTGCGCGGTATTTCCTGCAATGACCT TGCAGCGTCATTTCGCCAGC GGCGATCTC A GCCACCTCGCCAATCTCTGCCACTCGTGCCAAGGTTGCTATTACGCCTGCCAAT ACGCCCCTCCGCATGA GTTCGGAATAAACGTTCCAAAGGCGCTGTCGGAGTTGCGGCTCGAGAGCTACGAGCAGCA TGCTTGGCCCCGGCCGGTCG CCGCTCTCTATCGCAAGAATGCGCTCATCATTTCCATCTTGTCGGCGGCATGCATAACCG GCGTCCTTCTGCTTGCCGCC A TCTTCAACGGGG A TGCACTTTTCGCGAAACACGCATCGGTGCCCGGCGGCGGGTTTTACAACGTTAT TCCTTATCAGGC GATGA T TGCCG T CGCGGCGACCACATTTCTTTATTCCGCGCTGGCGCTGGCGATCAGTCTCGTTCG CTTTTCGCGGACGA TCGGTCTGGG A A TT AAGGTTCTTTATCAGCACGTGCCGGTTCTTCGGGCGCTACGCGATGCGGCGACT CTGCGATATCTC GGCGGCAGCG A CGGCGAGGGGTGTAACGACGCGGACGAGACATTTTCGACGACCCGGCGAAAATT TCATCACGCCCTTGC C T ATGGC TT CG GACT TTG T TTCGCGGCCAC A GCCACGGGCACGATCTACGATCATATGTTCGGCTGGCCGGCGCCCRATG CGCTTTTCAGCTTGCCGGTCGTCCTAGGGACCGTTGGGGGGATCGGAATGGTCGTGGGCG CGATCGGCCTACTCTGGCTC

AÄGCTGGCCGGCGAAGACGCTCCTCGATCACCGGCACTGCTTGGGCCGGATGTTGC CCTGTTGGTGCTTCTGCTTGCCAT

AGCGGCAACGGGCCTCCTCCTTTTAGCGGTCCGCAGCACCGAAGTCATGGGCGTCGC GCTCGCCGTCCATCTCGGCGTCG TCTTGGCCTTC TTT TTGGTGATGCCATACAGCAAATTTGTCCACGGTATCTTCAGGCTCACGGCTCTC GTGCGCCATCAT GCTGACCGCGAGGCAAGTAATGGCTTCGCCTCCAGCCCTCCCACGAAAAAGGGTTAAACA ATGGAACATATGAAGTCCGT TCGCGATCGCAGTAGCGTCATGCAGATCGTGAGAGTGGCGAGTGGCAACTGTCTCGAGCA ATATGATTTCTTCGTTTACG

GCTTCTATGCGGCATATATTGCGAGAAGCTTTTTTCCGACCGGCGATAACGCGACAT CGCTCATGCTTTCATTGGCCACT TTTGGCGCTGGTTTCCTCATGAGGCCCTTGGGGGCGATTTTTCTCGGGTCCTACATCGAT CGCGTCGGGCGTCGGAAAGG CCTGATCGTGACACTCGCGATCATGGCCGTCGGAACCCTCACCATTGCGATGACTCCAAG CTATGAGGCAATTGGATTAC TCGCACCGGTTATCGTGCTCGTCGGGCGACTTTTGCAGGGTTTTTCCGCTGGAGCAGAGT CGGGTGGCGTCTCAGTGTAC TTGGCGGAAATTGCGTCGCCCAAATCGAGAGGCTTCTTCACCTCGTGGCAGTCTGCCAGC CAGCAGGTGGCCGTCATGAT CGCCGCCGCGATCGGTCTTGCGCTGCAATCAACGCTTTCACCGGAGCAAATGAACGACTG GGGATGGCGGGTGCCCTTGT TGATCGGATGCTTGATTATCCCCGTGATACTCTGGCTGCGCCGGTCTCTCCCGGAAACGA AAGCCTATCTCCACATGGAG CACAAGGCGCATTCGATCGGCGAATCCCTCCGCGAATTGCAACAGAGCTGGGGGCTGATC TTGACGGGCATGGCGATGTC GATCCTCACGACGACCACCTTTTACATGATTACCGCCTATACGCCGACATTTGGCGAGAA AGCACTCGGACTGAGCCCGC AAGATGTCCTGCTGGTTACCATCATGGTCGGCGTGTCGAACTTCCTGTGGCTTCCGATCG GGGGTGCTCTCTCGGATCGT ATCGGTAGAACCCCGATCCTACTGGTCGTGCCGGTCACCGTTCTCGCCATCGCCTTTCCC CTGATGAGCTGGCTCGTCGC GGCACCGACATTCGGAGCGCTTGCAGCTGTTCTGCTGACTTTCTCCGCATGCTTTGGACT CTATAATGGGGCGCTCATCG CGAGACTCACCGAGATTATGCCTCCCGCCATTAGAACCCTTGGCTTCTCGCTGGCGTTCA GTCTCGCGACCTCGCTGTTC GGCGGCTTCACCCCATTGGTAAGTACGGCGCTAATCCACGCGACGGGCAGCAATTCCGCG CCTGCAATCTGGCTCTGTTT TGCGGCTTTCATCAGCTTCGTCGGTGTGGCCGCATCGACCCGGCTGAGCCGGCCAATCGC CGAAGGCGCCAGATAGGACA ATCAGAGAATGCCCGTGCGGCAATGAAGCGAGATTCGGGCGGTAGGTGCGCTGGCGGCAC TTCGCGAAGAGCCGTTGCGG ACGGCTGAAACGATGATGGTATGAATGGGCTAAGACATGAGAGCAGTAGTTTACCGAAAT GGCGAACTTGTCCTGGGGGC CTATGCTGATCCGATACCCGCCGCCGGGCAGGTGCTCGTCAAGACCAGAGCATGCGGCAT CTGCGGATCTGACCTTCATT TTTGCGATCATGCGCAGGCGTTTACGAACCTTGCATCGCGGGCGGGTATCGCCTCTATGG AAGTTGATTTGTGTCGAGAC ATCGTTCTGGGGCATGAATTCTGTGGCGAGATTATGGAGTTCGGGCCCTCTGCGGATCGT CGCTTCAAACCCGGACAGCT TGTGTGCTCGCTGCCGCTGGCGATCGGTCCGACCGGAGCGCGGACGATTGGCTACTCGGA TGAGTATCCCGGCGGGCTCG GCGAATATATGGTCCTCACGGAAGCGCTCTTGCTGCCTGTTCCGAACGGCCTTCCGGCGA CCTGCGCGGCGTTGACGGAG CCGATGGCGGTGGGATGGCATGCCGTCGAGATCGCGCAGGTTCAACCACATCACATCCCT GTGGTGATCGGGTGCGGACC GGTCGGGTTGGCAGTCGTCGCTGCCCTGAAACATAAGCAAGTTGCTCCGATTATTGCGTC GGATCCATCGCCCGATCGGC GTGCTCTTGCTCTGCGGATGGGCGCCGACGCCGTTGTCGATCCGCGCGAAGAATCACCCT TTCGCCAGGCCGAGAAGATC GCACGCCCGGTCGGACAAGGTGGGGCCCTGTCCAGCTCATTGCTGTCAAAGTCTCAAATG ATATTCGAATGCGTAGGGGT GCCGGGCATGCTTCGGCATGCGATGGACGGCGCGTCCGACGGGTCCGAGATCATGGTCGT TGGCGCATGCATGCAGCCGG ACGCGATCGAGCCCATGATCGGGATGTTTAAAGCGCTCACGATCAAATTCTCGCGAACTT ACACGGGTGAGGAATTCGCC GCGGTGCTTCACATGATAGGTGAGGGCGCACTCGACGTATCTCCGCTCGTTACCGATGTG ATTGGCCTGTCCGATGTCCC GTCCGCGTTTGAGGCTCTACGGAGTCCAGGCGCCCAAGCAAAAGTGATTGTGGACCCTTG GCGCTGAGCCTGAGGATGCC AAGGGTGCGACGTTGGGCATCGTCAAAGAAGGCGACGTTGACCCGGTATGTGAACATCCC CATATTCTTCCGCAGCTGAA GCAGTTGGTAAACATGCCAAAATATGAACTGTAGTATTGCGTCGGGGTTCTCATTGTGGG GTTTGCCATTGTCATCGCTC GCACCCGGCGACAAAGATTAGATGTACTTCCGATAATCCGTGCTCTCGACCTGGCCTTCC TTCATATATTTCAGGACCTC TCCGACCATGCGTGCGGCGCGGATCGGGATCGGCAGGCGTTGGTTCATCTGGGTCGAGTT CCAGTTGATCTTCGTAAGAG AGAACACCTCCTCGGCTAACTGCGCCGCGGTACTATCGCAGGATCGTCTCGAGCGTYCGC

>Seq ID 2 (fuzπA)

ATGCGGAACGTCAGCGACAAGGCGCCGCCCCACGAGACGCTCACCGTAGTCGTCGCG GCAATGATCGTTGGCACGGCCGC CTTGATGGTGCTTGGAATACAGCCCATCCTTCTCGGCGCCCTTGTAGAGGAGGGGCGTAT TCCCGCCGAGGGGTTGGGAT CGGCGGCAACGGTGGAAATACTGGCGATCGCGGCGGGAACATGCATCGGACCCGTTCTTA TGAAGACGGGATATCTGCGG GCGAAATGCGCGGCACTCTGCTTAATGCTCGCCGCAATCAACTTCGGATTGACGTTGCCG GGTTTCGATTTGCCCATCGT GGCTTGCCGAGCGGCAGCGGGAGCCCTGGAAGGTCTTTCGCTCAGCGCGGCGATCCTGAT CATGACTCATAATCGGCGGC CGGACCGGCTGAGCGGAATATTTCTGGGCGCGCAGACGATACCGCAGGTAATATCTGCTT ATTTGCTCCCGACGGAGATT CGTCGATCGCGTTGAGCTCGATCCGACGACCGTTAACGACGACTTGCAGTGGTCACCCGC GGCGATCGTCATTTCGATGG

GGTCGGATATCGCTTCGCCTTAATCGCTGGGAGCCTGCTTCAGGCGGGCÄACGTGA TCGCATTGGCGGTGGCCGATCAGC CAAGCTGGTTTATTTCCGCTTCCTGTGCTTTCGGCCTGTTCTGGTTGGCGATGCAGCCCT TCCAAATCCGCTTCGCGATC GCGATAGATAACAGCCGGCAGCTTGCTGTACTGCTGACGCCGATCGCCCTCGTCGGGTTG AGCGCGGGGCCCTTGTTGCT CTCTCGCTTTGCCGGGGCGACCGACTTGCGCTGGATCTTTGTGGGGAGTTCGACCTTGTT GCTGGCCAGCGCGCTTCTGT ATCTTTGCGCTTCTCTGTTTCAACCGCGCGGAAAGGTGATCGCTGAAACGGTGGACGTA

>Seq ID 4 (fumB) ATGACATCGCAGGTCAAGCTTCGTAGCGCGGCAAAGCGGCCGCGCAGTCCTAAAAGCGAG CGAGGTCTTGCTCGTTACGA

GTCCTTGCTTGATGCGACCGACAGGCTGTTGGTCGATCTAGACCCCGATCAGGTCGG TCTCTATCAGATTGCAGAGGAAG CGGGTGCCTCACCGTCGTCCGTCTATCATTTCTTTCCGACCAAGGAAGTGGCTCATCTCG CTCTGATGCGCCGCTATCTG GAGGGGCTCCGGAATCTCGACGCGATGGAAGTCGACATCGGCCAGCTCGAAAGCTGGCAG GACCTGATGAAGTTGGATCA GATCAGGGCGCGAGACTATTATAATAGCCACCCGCCCGCCCTCAAGCTTCTGTTCGGCGG ATATGGCGGGGTCGAGGCCA GAAAGCTTGACGAGCGATACTCCGAGGAAATCGTGAGCTCCATGTATGGCAGATACAACG GCATTTTCCATATGCCGCAA ATGGAGAATGAGGCTCTCATGTTCACGATCTGCTTCGCAATTCTCGACGCGGTATGGGCC GTCTCCTTTCGCCGGTTCGG TGA A ATTACGTCGGATTTTCTTCGGGAGGGGCAAGCGGCTTGCATTGCCTATTGCCGA CACTATCTGCCCGAGCGAACGC CATCAGCGTGA >Seq ID 6 {fumC)

GΥGGCCAGCPAGτTCRACTGTGAGTTRCTCGΑTCTGCGATCΑTTTβTTGCQG TGTATGΑAΑCβCGΑAGTTTTΑGCCACGC CGCGCGGCTTCTGAATCAATCGCAGCCCGCGCTCAGCCGGAGAATCCAGCGCCTCGAGAG TCTCGTGGGCGGTCCGTTGT TCGAGCGGACCAGTCGGTCGCTTGCCGAAACGGCGCTCGGCAAAGAGTTGCTCCCGGTCG CCCACCGAGCGTTGGAACTT GTCGATACGTCGCTGTTTGCGTCGCCCAATGTCCGGGAGTTCCGCTGGACAGACATCACG ATTGCCTGTGTACAGACCGC CGCCTTCCATGTTCTCCCGCGAGCTGCGCGCTTGTACATGGATCAAAATCCGAGGGTCCG ACTCCGCATCCTTGACGTGC CGGCGGTCGAGGCTGCGGACCTGGTTGCGAGCGGCGAGGCGGAGTTCGGCATCAGCATTG AGAGCCTGTTGCCATCAAGC

CTGCGGTTCGATGCGCTCCACGAGGACCCGTTCGGCCTGGCATGCCACCGAAGCCAT CCGCTGGCGTCGCTCGAGATCCT

TGAARTGGACGCAATTGAAAGGTGARAGCCTGATCGCCGTTCACCGTGCGAGCCGGA ACCGCACGTTGCTCGATGCCGAAC

TCGCGCGCAACAATATCGCGCTGGAATGGCGGTATGAGGTCGCGCATCTGACGACGG CGCTGGGATTGATCGATGCGCAA TTGGGTGTCGCTGTTATGCCCCGCATGGTTATGCCCCGCTCGGGTCGGTCGGAGGTCGTC TGGCGCCCCGTCGTCGCGCC

13GTCGTCCAACGCACGATCGGCATCGTTCAGCGCCGCACCGGCTCGATGCACCCTG CCGCACAGCAATTGCTTGCGCGGC

TCCGCGCGGCCTGGTCGTCCGCCAATCTGGGCGACATCGCGTCTCGCGAAGATGGGG CATCGTGA >Seq ID 8 i fuinD) GTGAAAGAGCACCAATGCCGTGGCGGCCGGGCGTCCCCCGCTGCGCCCGCCACGTGGCTT GCGCGGATCAGCGTTTCCCG GGGGGCCTCCGCCATCGCCTGGACCTTCATGCTTGGCGCAACTGCCATTCCCGTGGCTGC GCAAACTGACGATCCGAAGC

TCGTTCGTCATACCCAGTCGGGCGCCGTCGAGGGCGTCGAGGGCGACGTCGAGACTT TTTTGGGAATACCCTTCGCGGCT CCGCCGGTCGGCGACCTGCGATGGCGGCCGCCGGCTCCGCCGAGGGCGTGGGCGGGCACC AGGGACGGCCGCCGCTTTGC GCCCGATTGCATCGGGAACGAGCGGCTTAGAGAGGGGAGCCGGGCTGCCGGGACGAGCGA AGACTGCCTCTATCTGAATA TCTGGTCTCCCAAACAGGTCGGTAAGGGGGGGCTCCCCGTCATGATCTGGGTTTACGGCG GTGGGTTTAGCGGCGGTTCT

GGCGCGGTGCCATATTATGACGGCTCTGCGCTCGCGCAGAAGGGCGTGGTGGTCGTC ACGTTCAACTATCGCGCCGGGAT TCTGGGCTTTCTTGCCCATCCGGCGCTTTCAAAGGAAAGTCCGAATGGCGTGTCGGGCAA CTATGGTCTTCTCGACATGC TCGCGGCGTTCAAATGGGTTCAGAACAACATAAGGGAGTTCGGCGGAGACCCGAACCGTG TCACGGTCTTTGECGAGTCC GCCGGCGCGAGCGCGCTCGGACTGCTCCTGACCTCGCCGCTCAGTGAGAGCGCCTTCAAT CAGGCGATACTGCAAAGTCC GGGTCTGGCCAGGCCGCTCGCCACGCTTTCTGAAAGCGAAGCGAATGGGCTGGAGCTGGG AGCCGATATTTCTGCTCTAC GGCGTGCCGATGCGGGCGAATTGACGAAGATCGCGCAATCGCGAATACCCATGTCGCGCC AGTTCACCAAGCCGCGGCCG ATGGGTCCGATTCTGGACGGCTATGTTTTGCGCACCCTTGACGTCGATGCCTTCGCCAAG GGGGCCTTCCGCAAGATACC CGTTCTGGTCGGCGGAAACGCCGACGAAGGGCGCGCTTTTACGGATCGCCTGCCGGTCAA AACGGTCCTTGAATATCGAG CCTATCTCACAGAACAATTTGGTGACGAGGCGGACGCATGGGAGCGTTGTTATCCCGCGA ACTCCGACGCCGACGTCCCC GCCGCCGTTGCCCGTCTTTTTGGGGATAGTCAGTTCAACAACGGGATCGAGCTGCTCTCG GCAGCCTTCGCGAAATGGCG AACGCCGCTTTGGAGATATCGCTTTACGGGCATTCCAGGAGCCGGCCGTCGCCCCGCCAC GCATGGAGACGAAATTCCCT ATGTCTTCGCAAATCTGGGGCCGTCGTCCGTATCTATGTTTGGGTCGCTCGAAGGCGGCG CCGGGGCGTCGGACATCAAA CTTGCGACCGAAATGTCCGCGGCCTGGGTGAGCTTCGCGGTGCACGGGGTCCCCGATCAG GGCACGAAATCGCACTGGCC GCGCTTCGAGCGGCGAGGGGAGATCATGACTTTTGGTTCGCAGGTTGGCTCTGGGGAAGG TCTTGGAGTTTCGCCGAGCA AAGCCTGCCAACCCTCAAAATAG

>Seq ID 10 {fumE}

TTGGAGTTTCGCCGAGCAAAGCCTGCCAACCCTCAAAATAGCGCCCGGCCTGTGCGT GCTTCAGCACGCCGTCCCGCTTT GCGGGCGACGGGCTGTGCCCTCTGCCTAGAAGGAAGTAAGTTGCGCTACGACGTCGCGAT AATTGGAGGTGGCAACGCTG CATTGACGGCAGCCGTGACGGCGCGTGAAGCGGGGGCCTCGGTTCTTGTGATCGAGCATG CGCCGCGCGCCATGCGCGGC

CGAATATTGGAATGATCTTGTCCGCGTCACGGGGGGGCGCACCGACGAAGAΆCTCG CGCGGCTCGTTATCCGCAACACCA CCGACGCTATTCCCTTCATGACGCGCTGCGGTGTGCGTTTCCAGCCCTCGCTGTCGGGCA CGCTGAGTTTATCGCGAACC AACGCATTCTTCCTTGGCGGCGGGAAGGCGCTTGTAAACGCATATTACGCCACGGCCGAA CGGCTAGGCGTCGATATTCT CTATGATTCTGAGGTGACCGAGATCAACCTTCAGCAAGGCGTCGTGCAGCGTCTGCAATT GCGCAGCCGGGGATTCCCTG TCGAAGTGGAAGCCAAGGCTGCCATCGCCTCGTCCGGAGGATTCCAGGCAAATCTTGACT GGCTCTCAAGCGCATGGGGG CCTGCTGCGGCGAACTTCATCGTACGGGGCACGCCATATGCGACTGGCACGGTGCTCAAG AACCTGTTGGAGCAAGGCGT CGCCTCGGTGGGAGATCCAACCCAATGCCATGCTGTCGCGATCGATGGGCGAGCGCCCAA ATACGACGGCGGCATCGTCA CACGACTGGACTGCGTTCCCTTCTCGATCGTCGTCAACAAGGACGCCTTGCGCTTCTACG ATGAAGGCGAAGATGTGTGG CCGAAGCGTTACGCCATATGGGGTCGCTTGGTGGCACAGCAGCCTGATCAGATCGCTTTC AGCATAATCGATCGGCAGGC CGAAGACCTCTTCATGCCGTCAGTGTTCCCCCCCGTGCAAGCGGACACGATCGCGGGTCT GGCCGAGAAACTCGGTCTGA ATCCCGTAACCCTGGAACGCACGGTGGCCGAATTCAACGCCGCATGCGTGCCCGGCGAAT TCGGCGGCCAAGATCTCGAC GACCTCCACACCGAGGGAATCGAACCAAAGAAATCCAACTGGGCCCGACCGATTATTGTG CCCCCGTTCAGCGCCTATCC TCTCCGGCCCGGGATCACCTTCACCTATCTCGGCGTCAAGGTAGACAGCCGTGCGCGGGT CATCATGGAGACAGGTGAGC CGACAAAAAACCTGTTTGCTTCGGGGGAAATAATGGCGGGCAGCATTCTCGGCCAAGGTT ATCTCGCTGGATTTGGAATG GCGATTGGTACCGTATTCGGCCGCATCGCGGGTTC-GGAGGCCGCACGTCATGCAGGATT TTGA

>Seg ID 12 (fumF)

ATGCAGGATTTTGATCTCGTAAAAATGCTGTCTGACTTGCCGTCGGCGCCGGAGCTG GAAGCCAGGCGCGTTATGGAGGT

GTGCAACGCGTGCCGCTATTGCGAAGGGTTCTGCGCGGTATTTCCTGCAATGACCTT GCAGCGTCATTTCGCCAGCGGCG ATCTCAGCCACCTCGCCAATCTCTGCCACTCGTGCCAAGGTTGCTATTACGCCTGCCAAT ACGCCCCTCCGCATGAGTTC

GGAATAAACGTTCCAAAGGCGCTGTCGGAGTTGCGGCTCGAGAGCTACGAGCAGCAT GCTTGGCCCCGGCCGGTCGCCGC

TCAACGGGGATGCACTTTTCGCGAAACACGCÄTCGGTGCCCGGCGGCGGGTTTTAC AACGTTATTCCTTATCAGGCGATG

ATTGCCGTCGCGGCGACCACATTTCTTTATTCCGCGCTGGCGCTGGCGATCAGTCTC GTTCGCTTTTCGCGGACGATCGG TCTGGGAATTAAGGTTCTTTATCAGCACGTGCCGGTTCTTCGGGCGCTACGCGATGCGGC GACTCTGCGATATCTCGGCG

GCAGCGACGGCGAGGGGTGTAACGACGCGGACGAGACATTTTCGACGACCCGGCGAA AATTTCATCACGCCCTTGCCTAT

GGCTTCGGACTTTGTTTCGCGGCCACAGCCACGGGCACGATCTACGATCATATGTTC GGCTGGCCGGCGCCCTATGCGCT

TTTCAGCTTGCCGGTCGTCCTAGGGACCGTTGGGGGGATCGGAATGGTCGTGGGCGC GATCGGCCTACTCTGGCTCAAGC

TGGCCGGCGAAGACGCTCCTCGATCACCGGCACTGCTTGGGCCGGATGTTGCCCTGT TGGTGCTTCTGCTTGCCATAGCG GCAACGGGCCTCCTCCTTTTAGCGGTCCGCAGCACCGAAGTCATGGGCGTCGCGCTCGCC GTCCATCTCGGCGTCGTCTT GGCCTTCTTTTTGGTGATGCCATACAGCAAATTTGTCCACGGTATCTTCAGGCTCACGGC TCTCGTGCGCCATCATGCTG ACCGCGAGGCAAGTAATGGCTTCGCCTCCAGCCCTCCCACGAAAÄAGGGTRAA

>Seg ID 14 (fumG) ATGGAACATATGAAGTCCGTTCGCGATCGCAGTAGCGTCATGCAGATCGTGAGAGTGGCG AGTGGCAACTGTCTCGAGCA ATATGATTTCTTCGTTTACGGCTTCTATGCGGCATATATTGCGAGAAGCTTTTTTCCGAC CGGCGATAACGCGACATCGC

TCATGCTTTCATTGGCCACTTTTGGCGCTGGTTTCCTCATGAGGCCCTTGGGGGCGA TTTTTCTCGGGTCCTACATCGAT

CTATGAGGCAATTGGATTACTCGCACCGGTTATCGTGCTCGTCGGGCGACTTTTGCA GGGTTTTTCCGCTGGAGCAGAGT CGGGTGGCGTCTCAGTGTACTTGGCGGAAATTGCGTCGCCCAAATCGAGAGGCTTCTTCA CCTCGTGGCAGTCTGCCAGC

CAGCAGGTGGCCGTCATGATCGCCGCCGCGATCGGTCTTGCGCTGCAATCAACGCTT TCACCGGAGCAAATGAACGACTG

GGGATGGCGGGTGCCCTTGTTGATCGGATGCTTGATTATCCCCGTGATACTCTGGCT GCGCCGGTCTCTCCCGGAAACGA

TTGACGGGCATGGCGATGTCGATCCTCACGACGACCACCTTTTACATGATTACCGCC TATACGCCGACATTTGGCGAGAA AGCACTCGGACTGAGCCCGCAAGATGTCCTGCTGGTTACCATCATGGTCGGCGTGTCGAA CTTCCTGTGGCTTCCGATCG

GGGGTGCTCTCTCGGATCGTATCGGTAGAACCCCGATCCTACTGGTCGTGCCGGTCA CCGTTCTCGCCATCGCCTTTCCC

CTGATGAGCTGGCTCGTCGCGGCACCGACATTCGGAGCGCTTGCAGCTGTTCTGCTG ACTTTCTCCGCATGCTTTGGACT

CTATAATGGGGCGCTCATCGCGAGACTCACCGAGATTATGCCTCCCGCCATTAGAAC CCTTGGCTTCTCGCTGGCGTTCA

GTCTCGCGACCTCGCTGTTCGGCGGCTTCACCCCATTGGTAAGTACGGCGCTAATCC ACGCGACGGGCAGCAATTCCGCG CCTGCAATCTGGCTCTGTTTTGCGGCTTTCATCAGCTTCGTCGGTGTGGCCGCATCGACC CGGCTGAGCCGGCCAATCGC

CGAAGGCGCCAGATAG

>Seq ID 16 (fumH)

ATGAGAGCAGTAGTTTACCGAAATGGCGAACTTGTCCTGGGGGCCTATGCTGATCCG ATACCCGCCGCCGGGCAGGTGCT CGTCAAGACCAGAGCATGCGGCATCTGCGGATCTGACCTTCATTTTTGCGATCATGCGCA GGCGTTTACGAACCTTGCAT

CGCGGGCGGGTATCGCCTCTATGGAAGTTGATTTGTGTCGAGACATCGTTCTGGGGC ATGAATTCTGTGGCGAGATTATG

GAGTTCGGGCCCTCTGCGGATCGTCGCTTCAAACCCGGACAGCTTGTGTGCTCGCTG CCGCTGGCGATCGGTCCGACCGG

AGCGCGGACGATTGGCTACTCGGATGAGTATCCCGGCGGGCTCGGCGAATATATGGT CCTCACGGAAGCGCTCTTGCTGC

CTGTTCCGAACGGCCTTCCGGCGACCTGCGCGGCGTTGACGGAGCCGATGGCGGTGG GATGGCATGCCGTCGAGATCGCG CAGGTTCAACCACATCACATCCCTGTGGTGATCGGGTGCGGACCGGTCGGGTTGGCAGTC GTCGCTGCCCTGAAACATAA

GCAAGTTGCTCCGATTATTGCGTCGGATCCATCGCCCGATCGGCGTGCTCTTGCTCT GCGGATGGGCGCCGACGCCGTTG TCGATCCGCGCGAAGAATCACCCTTTCGCCAGGCCGAGAAGATCGCACGCCCGGTCGGAC AAGGTGGGGCCCTGTCCAGC TCATTGCTGTCAAAGTCTCAAATGATATTCGAATGCGTAGGGGTGCCGGGCATGCTTCGG CATGCGATGGACGGCGCGTC CGACGGGTCCGAGATCATGGTCGTTGGCGCATGCATGCAGCCGGACGCGATCGAGCCCAT GATCGGGATGTTTAAAGCGC TCACGATCAAATTCTCGCGAACTTACACGGGTGAGGAATTCGCCGCGGTGCTTCACATGA TAGGTGAGGGCGCACTCGAC GTATCTCCGCTCGTTACCGATGTGATTGGCCTGTCCGATGTCCCGTCCGCGTTTGAGGCT CTACGGAGTCCAGGCGCCCA AGCAAAAGTGATTGTGGACCCTTGGCGCTGA

>Seq ID 18 (fuml)

ATGGCGAACGGAACAAGGCAGAAAGATCTCAGAGAACGCGCCGAACGGGTCATTCCG GGCGGGATGTACGGCCACGAG TCGACACGGTTGCTGCCGCCAGAATTCCCCCAGTTCTTCAGGCGCGCGCTGGGGGCACGA ATTTGGGACGCCGACGAG CAGCCCTATATCGACTATATGTGCGCGTATGGGCCAAATTTGCTCGGTTACCGGCAATCC GAAATCGAAGCCGCGGCT GATGCGCAGCGACTTCTCGGCGACACCATGACCGGTCCTTCGGAGATCATGGTCAACCTC GCCGAAGCCTTTGTGGGC ATGGTCCGTCATGCGGATTGGGCGATGTTCTGCAAAAATGGCAGCGATGCCACCTCAACG GCGATGGTTCTCGCGCGT GCCCATACGGGGCGCAAAACCATATTATGCΣCCAAAGGCGCCTATCATGGCGCTTCCCC GTGGAACACTCCGCATACT

AAGGCGCACGATGGCGATATTGCGGCTGTCTTTGCCACACCTTTCCGACACGAAGTA TTTGAGGACCAGGCCCTCGCC

GCGAATGGCTATCCGATCTCCGCCCTGCTGGGCTCGAACAAGGCGCGCGATGCGGCG CGGGATATATTTGTGACCGGC TCCTTCTGGTTCTCTGCGGTACCGATGGCGGCCGCGATCGAAACCCTCAGGATCATTCGA GAGACGCCTTATCTCGAA ACGCTGATCGCCAGCGGCGCCGCCCTGCGGGCAGGCCTGGAGGCACAGTCTCAGCGCCAT GGTCTTGAGTTGAAGCAG ACGGGCCCGGCGCAGATGCCGCAAATATTCTTTGCGGACGATCCCGATTTTCGGATCGGC TATGCGTGGGCCGCGGCG TGCCTGAAGGGCGGCGTCTATGTTCATCCCTATCACAATATGTTTCTCTCTGCGGCCCAT ACAGTTGACGATGTAACG GAGACCCTCGAGGCGACGGATCGCGCGTTCAGCGCGGTCCTCAGAGATTTTGCGTCTCTC CAGCCTCATCCCATTTTA ATGCAACTCGCCGGTGCTTGA

>Seq ID 20 (fumJ)

ATGTATCGGAAGTTCAGAATCGAAAAGCCCGGCAAGGCAAATAGTTTGCTCGGCGCA GTAGCGCTCGGCACCCTCGCA TTTCCTGTCTCTGCCAGTGCTCAGGATAGCGATCCCGCATCGATAGGTCAGCCGGACGAA GCGGACACGGACCGGGGA ACGAGCGAAATCGTCGTGACCGGCAGCCGCCTCCAGAACGGCTTCAATTCGCCGACGCCG GTTACAGCCGTATCCAGC

GAGC Ä GTTGAAGGAGGCATCTCCGACO^CCTTGCCGACGCÄ.CTCAACCAGCTGCCCG TGT'RCAACGACAGCTTGAAG ACCTCCAACCCTGGCACGACACCCGGAACGGGGAACAGCGGTCAGAACCTGCTCAACATG CGCGGCCTCGGGTCAAAC CGGAACCTCGTCCTGCTGAACGGCAACCGTTTCGTCGCGACCAATTTCACAGGCTCGGTC GATATCAACGTGCTGCCG CAGGCGTTGGTCAAGCGCGTCGATGTCGTGACGGGCGGCGCCTCGGCCGCCTACGGTTCC GATGCCGTTTCGGGCGTC A T CAA C T T CGTGCTCGACGAAGATCTGGAAGGCATCAGGGCCGAGCTCCAGTCGGGTGTTTC AACCCGCGGCGACCTC CCGTCCTA C G G CGGTTCGATCGCCTTCGGCACTTCGTTTGCCGACGACCGGTTGCACTTGCTCGG CAGCTTCGAATAT TTTCG A CA G GACGGAATCCGGGCCGATGAAGCAACGGGTCGCCGCTGGTTCGACATCGCCGCC GGCCAATATCCCGTG CCCGG C GCTACGACAGGCGTCACGGTCGTGCCCGATATTCGCAGTTCTCGCGGATCCTAC GGCGGACTTGTCACGTCC

GGCCCTCTGAAAGGCATCGCGTTTTTGCCCGGAGGAGTCCTAGGGACCTTCGACTAC GGGAATTTTACGAGCTCGTCG TTCCAGAGCGGCGGCGATGGACCGCGCGTGAATATCGGCTTCGCCCCGGATCAGCTTCGC TACAACGCGTTCCTACGC GCCGCATATGATGTGTCCGACACTGTGCAGGTGTATGCGGAGGGCACCTATGCTTATTCC CACACCAACCTGGGTGCA TTCGTAATATCGCATGTCGGTGGCTCGAATAATTTCCGGATCTTCCGTGATAACGCCTTC CTTCCGGCTCCACTCGCG ACGCTCATGGACAGAAATGCCCAGGCTTCGATCGTTGTCGGTCGCTTCTCAAGCGACTTT CCCTTGGTCGAAATCGAG AATTTCGCAAAGGTCTACCGCGGCGCTGCCGGCTTCCGGGCAGACATTGGCAATGGCTGG AAACTCGATGGCTCGGCC TCCTTTGGCCTTACGGACCTCGAGCTTCGTGAAAACAATCTCACCATCAACCGCAATCTC TACGCCGCCGTCGATGCG GTCCGCGATCCCGCGGGCAATATCGTCTGCCGTTCAACACTGGCCGGCCTCGACCAAGAT TGCGTGCCGCTCAATCTC TTCGGCACAGGCTCGCCGAGCGCGTCGGCCATCGACTATGTCACCGCTGATGGCGTCGCT CAGCTGAGGCTTGAGCAA

TATGTGGCGGGACTCACGATTTCCGGCGACCTCGGCGATAGCCTGTCGTTCGGCGCG GGCCCGGTCTCGGTCGCCGCT GGTATCGAATATCGCAAGGAGAAGGCCCGGCAGGAAACCGACGCGATATCGCAGGCGACG ACCTCGATCACGGGAATC AGGGGGGCTCCGGCGGCGCAGGCAGGTCGGCCTGGAGGCTTCAATCTCTACAACCCACTT CCCTTCTCGGGAAGCTAT GACATCAAGGAAGGTTTTGTCGAAATCGGCGTCCCGATTCTGAAGGACAGCGCGCTGGGA CGTTCGCTGAACTTAAAC GGCGCCGTCCGATATGCCGATTACAGCCAGTCCGGTGGAGTAACAACCTGGAAGCTGGGC GGAGAATATGAGCCGATC GACGGCCTCAGGTTCCGCGCGACCCGTTCGCGAGATATCCGCGGGCCAAGCCTTGTCGAG CTATTCGACCCCGGCCGT CAGGCGACGCTCAATTCAATTTATGGCGGACAGGCTGTGCAGACGCGGTTCTTTACCGCC GGCAACGCGGATTTGCGC CCTGAAAAGGCGGACGTCCTTACATTCGGCGCGGTGCTACGCCCCGCCTTCGTGCCGGGG TTTCAGTTTTCGGTCGAT CGCTATGTGGTGAAGGTGAAGGGCGCGATCGATTTCCTCCTTCCCCAGCAGGAAATCGAC GCGTGCGATGCAGGAAAC ACCTTCTTCTGCGACCTCATAACGGAGAATCCGGACGGCACCATCACAGTGACGGGTCCC AATCTCAACCTGGCTGTC CAGAAAGCGGCGGGAATTGACTTCGAGGCCTATTACTCACGCCCCGTCGGCGGCGGCACG TTCAGTCTTCGTGCGCTG GCAACGCACCATACCTCTGCCTATCGCATCGCGACCGGCTCGGCαcCCATCCGTTCGCT CGGACAACCGGACACGCCA AAATGGTCGGCCAACTTCCAGGCGCGATATTCGACCGACGATTGGGCGCTTCTCGTGCA CAGCGCTTCATCGCAGCA TCGGTGTTCAATGCCGACAATGTGGAGGGCGTCGATACGAATTTGAACCACGCTCCGGCG GTTTGGTACACCGACGCG ACATTGACCTTCGACATCGCGGCTTTTGGCCAGAAGCAGCAGCTGTTTCTATCGGTCAAT AATTTGTTCGACCGAGAT CCGCCAATAGCGACGAACGACCCCAGCAGTTTTTCCAGCCCGACCAGCTCTGCCTATGAT CCGGTCGGCCGCTATTTT AATGTCGGGGTCCGTTTCCGGATCTGA >Seq ID 22 (fumK) nicht vollständig

ATGCGCCTCACGGGCGGAGAATTATTGGCACGATGTTTGGCCGTCGAAGGCGTCCGG TATGTCTTCGGCCTCATGTCG CCGGAGGTGGATCCGCTCCTGGCTGCGCTCGAAGACAATGGGATATTGTTCGTCCCGGTG CGGCACGAGGCCGCCGCA AACCTTCTGCCTGGAGTCGTGACGGCÄCGCCACGAAGGGGTTCCCTTCGTCGCAATAAC GTCCCÄGCATCAACTTGGT GTCGTTTATCCCTGCÄCGCCAAA&ACCTTTCÄGGGACAAGACCAGATCGACCTC TTTCGACCCGCGGTTAAATGGGGC GCACCCATCTTCGCCTGGAACCGGATTGTCGAAATCACCCÄTATGGCGTTCCGGGAAAT GTGGGCCGGCAGGCCGGGA CCCGTTCAGTTGGAAATCCCGARGTCTGTGATGTATGKTGTGGGCGAACGAGGACCACGG TAGAAGTTTACRGATCGC CGACA...

>Seq ID 24

ATGGAATTGAGCCGCCAACGAGACCAGGCCTTGAGGGAGCGCGCCCAAGCGGTGATC CCGGGCGGGATGTACGGTCAC GAGTCGACCTATCTGATGCCCGAGGGCACGCCACAGTTCTTCAGTCGCGGCAAAGGCGCC CGACTTTGGGACGCCGAC GGCAACGAGTATGTCGATTACATGTGCGCCTATGGCCCCAACCTGCTGGGTTACGGCTTC GAACCCGTCGAAGCGGCC

TTCGAGGCCCATCAGGACGACGTCGCGGCGATCTTCGCCACCCCTCACCGTCACGAG GTGTTCAGCGACCAGATCGAT CCTGATCCGGAATATGCGGCCAGCGTGCGGGCGCTCTGCGACAAGAGCGGCGCCCTGCTC GTCGTCGACGAAGTTCGA

GCCGGGTTCAGGATCGCGCGCGACTGCAGCTGGGCCAAGATCGGCGTCGCTCCGGAT CTGAGCACCTGGGGCAAGTGC TΓCGCCAACGGCTATCCGATCΓCGGCGGTCCTAGGGGGCGAAAAGGTGCGCAGCGCGG CAAAGGCCGTCTACGTCACC GGCTCGTTCTGGTTCTCGGCCACGCCCATGGCCGCAGCCGTCGAAACCCTGAAGCAAATC CGCGAGACCGACTATCTC GAGCGGATCAACGCGGCCGGGACCCGCCTGCGCGAGGGCCTGCAGCAGCAGGCTGCTCAC AACGGCTTTACGTTGCGC CAΆACGGGGCCCGTCTCCATGCCCCAAGTCCTCTTCGAGGAAGATCCCGATTTTCGGGT CGGCTACGGCTGGGTTCGC GAATGCCTGAAGCGAGGGGTGTACTTCAGCCCCTACCATAACATGTTCCTGTCGGCGGCC CATAGCGAGGCGGACCTG GCCAAGACCCTTGCGGCTACCGGCGACGCCTTCGTCGAGCTACGCGCCAAGCTTCCGAGC CTAGAAATCCACCAACCC CTCCTCGCCCTGAGAGCGGCCTAA

Enzyme

Sequenzen :

>Seq ID 3 (FumA)

MRNVSDKAPPHETLTVWAÄMIVGTAALMVLGIQPILLGALVEEGRIPAEGLGSAAT VEI lAIÄAGTCIGPVLMKTGYLI^KCAALCLMIΛAIWFGLTLPGFDLPIVACRAÄAGALE GLS LSAAILIMTHNRRPDRLSGIFLGAQTIPQVISAYLLPTEIIPRWGSAGGFTILGILAΑI A AIAALCLVDRVELDPTTVWDDLQWSPAAIVISMAAFVQFSGVGAAWSYLERLAAQHGFSG ETIGIAISGSLLCQVGGAWLAAWIGGRVGYRFALIAGSLLQAGNVIALAVADQPSWFISA SCAFGLFWLAMQPFQIRFAIAIDNSRQLAVLLTPIALVGLSAGPLLLSRFAGATDLRWIF VGSSTLLLASALLYLCASLFQPRGKVIAETVDV

>Seq ID 5 ( FumB)

MTSQVKLRSAAKRPRSPKSERGLARYESLLDATDRLLVDLDPDQVGLYQIAEEAGAS PSS VYHFFPTKEVAHLALMRRYLEGLRHLDAMEVDIGQLESWQDLMKLDQIRARDYYNSHPPA LKLLFGGYGGVEARKLDERYSEEIVSSMYGRYNGIFHMPQMENEALMFTICFAILDAVWA VSFRRFGEITSDFLREGQAACIAYCRHYLPERTPSA

>Seq ID 7 (PumC)

VASKFNCELLDLRSFVAVYETRSFSHAARLLNQSQPALSRRIQRLESLVGGPLFERT SRS LAETALGKELLPVAHRALELVDTSLFASPNVREFRWTDITIACVQTAAFHVLPRAARLYM DQNPRVRLRILDVPAVEAADLVASGEAEFGISIESLLPSSLRFDALHEDPFGLACHRSHP

LASLEILEWTQLKGESLIAVHRASRNRTLLDAELARNNIALEWRYEVAHLTTALGLI DAQ LGVAVMPRMVMPRSGRSEWWRPWAPWQRTIGIVQRRTGSMHPAAQQLLARLRAAWSS ANLGDIASREDGAS >Seq ID 9 (FumD)

VKEHQCRGGRASPAAPATWLARISVSRGASAIAWTFMLGATAIPVAAQTDDPKLVRH TQS GAVEGVEGDVETFLGIPFAAPPVGDLRWRPPAPPRAWAGTRDGRRFAPDCIGNERLREGS RAAGTSEDCLYLNIWSPKQVGKGGLPVMIWVYGGGFSGGSGAVPYYDGSALAQKGWWT FL^RAGILGFLAHPALS]^SPNGVSGNYGLLDMLAAFKWVQNLSRIREFGGDPNRVTVFG ES AGASALGLLLTSPLSESAFNQAILQSPGLARPLATLSESEANGLELGADISALRRADAGE LTKIAQSRIPMSRQFTKPRPMGPILDGYVLRTLDVDAFAKGAFRKIPVLVGGNADEGRAF TDRLPVKTVLEYRAYLTEQFGDEADAWERCYPANSDADVPAAVARLFGDSQFNNGIELLS AAFAKWRTPLWRYRFTGIPGAGRRPATHGDEIPYVFANLGPSSVSMFGSLEGGAGASDIK LATEMSAAWVSFAVHGVPDQGTKSHWPRFERRGEIMTFGSQVGSGEGLGVSPSKACQPSK >Seq ID 11 (FuraE)

LEFRRAKPANPQNSARPVRASARRPALRATGCALCLEGSKLRYDVAIIGGGNAALTA AVT AREAGASVLVIEHAPRAMRGGNSRHTRNMRTMHERPLSPLTGEYSADEYWNDLVRVTGGR TDEELARLVIRNTTDAIPFMTRCGVRFQPSLSGTLSLSRTNAFFLGGGKALVNAYYATAE RLGVDILYDSEVTEINLQQGWQRLQLRSRGFPVEVEAKAAIASSGGFQANLDWLSSAWG PAAANFIVRGTPYATGTVLKNLLEQGVASVGDPTQCHAVAIDGRAPKYDGGIVTRLDCVP FSIWNKDALRFYDEGEDVWPKRYAIWGRLVAQQPDQIAFSIIDRQAEDLFMPSVFPPVQ ADTIAGLAEKLGLNPVTLERTVAEFNAACVPGEFGGQDLDDLHTEGIEPKKSNWARPIIV PPFSAYPLRPGITFTYLGVKVDSRARVIMETGEPTKNLFASGEIMAGSILGQGYLAGFGM AIGTVFGRIAGWEAARHAGF

>Seq ID 13 (FumF)

MQDFDLVKMLSDLPSAPELEARRVMEVCNACRYCEGFCAVFPAMTLQRHFASGDLSH LAN LCHSCQGCYYACQYAPPHEFGINVPKALSELRLESYEQHAWPRPVAALYRKNALIISILS AACITGVLLLAAIFNGDALFAKHASVPGGGFYNVIPYQAMIAVAATTFLYSALALAISLV RFSRTIGLGIKVLYQHVPVLRALRDAATLRYLGGSDGEGCNDADETFSTTRRKFHHALAY

GFGLCFAΆTATGTIYDHMFGWPAPYALFSLPWLGTVGGIGMWGAIGLLWLKLAGED AT? RSPALLGPDVALLVLLLAIAATGLLLLAVRSTEVMGVALAVHLGWLAFFLVMPYSKFVH GIFRLTALVRHHADREASNGFAS S PPTKKG >Seq ID 15 (FumG)

MEHMKSVRDRSSVMQIVRVASGNCLEQYDFFVYGFYAAYIARSFFPTGDNATSLMLS LAT FGAGFLMRPLGAIFLGSYIDRVGRRKGLIVTLAIMAVGTLTIAMTPSYEAIGLLAPVIVL VGRLLQGFSAGAESGGVSVYLAEIASPKSRGFFTSWQSASQQVAVMIAAAIGLALQSTLS PEQMNDWGWRVPLLIGCLIIPVILWLRRSLPETKAYLHMEHKAHSIGESLRELQQSWGLI LTGMAMSILTTTTFYMITAYTPTFGEKALGLSPQDVLLVTIMVGVSNFLWLPIGGALSDR

IGRTPILLWPVTVLAIAFPLMSWLVAAPTFGALAAVLLTFSACFGLYNGALIARLTE IM

PPAIRTLGFSLAFSLATSLFGGFTPLVSTALIHATGSNSAPAIWLCFAAFISFVGVA AST

RLSRPIABGAR >Seq ID 17 (FumH)

MRAWYRNGELVLGAYADPIPAAGQVL VKTRACGI CGSDLHFCDHAQAFTNLASRAGIAS MEVDLCRDIVLGHEFCGEIMEFGPSADRRFKPGQLVCSLPLAIGPTGARTIGYSDEYPGG LGEYMVLTEALLLPVPNGLPATCAALTEPMAVGWHAVEIAQVQPHHIPWIGCGPVGLAV VAALKHKQVAPIIASDPSPDRRALALRMGADAWDPREESPFRQAEKIARPVGQGGALSS SLLSKSQMIFECVGVPGMLRHAMDGASDGSEIMWGACMQPDAIEPMIGMFKALTIKFSR

TYTGEEFAAVLHMIGEGALDVSPLVTDVIGLSDVPSAFEALRSPGAQAKVIVDPWR

>Seg ID 19 (Futnl)

MANGTRQKDLRERAERVIPGGMYGHESTRLLPPEFPQFFRRALGARIWDADEQPYID YMC AYGPNLLGYRQSEIEAAADAQRLLGDTMTGPSEIMVNLAEAFVGMVRHADWAMFCKNGSD

ATSTAMVLARAHTGRKTILCAKGAYHGASPWNTPHTAGILASDRVHVAYYTYNDAQS LSD AFKAHDGDIAAVFATPFRHEVFEDQALAQLEFARTARKCCDETGALLWDDVRAGFRVAR DCSWTHLGIEPDLSCWGKCFANGYPISALLGSNKARDAARDIFVTGSFWFSÄVPMAAAI E TLRIIRETPYLETLIASGAALRAGLEAQSQRHGLELKQTGPAQMPQIFFADDPDFRIGYA WAAACLKGGVYVHPYHNMFLSAAHTVDDVTETLEATDRAFSAVLRDFASLQPHPILMQLA

GA >Seq ID 21 (FumJ)

MYRKFRIEKPGKAMSLLGAVALGTLAFPVSASAQDSDPASIGQPDEADTDRGTSEIW TG SRLQNGFNSPTPVTAVSSEQLKEASPTNLADALNQLPVFNDSLKTSNPGTTPGTGNSGQN LLNMRGLGSNRNLVLLNGNRFVATNFTGSVDINVLPQALVKRVDWTGGASAAYGSDAVS GVINFVLDEDLEGIRAELQSGVSTRGDLPSYGGSIAFGTSFADDRLHLLGSFEYFRQDGI RADEATGRRWFDIAAGQYPVPGATTGVTWPDIRSSRGSYGGLVTSGPLKGIAFLPGGVL GTFDYGNFTSSSFQSGGDGPRVNIGFAPDQLRYNAFLRAAYDVSDTVQVYAEGTYAYSHT NLGAFVISHVGGSNNFRIFRDNAFLPAPLATLMDRNAQASIWGRFSSDFPLVEIENFAK VYRGAAGFRADIGNGWKLDGSASFGLTDLELRENNLTINRNLYAAVDAVRDPAGNIVCRS TLAGLDQDCVPLNLFGTGSPSASAIDYVTADGVAQLRLEQYVAGLTISGDLGDSLSFGAG PVSVAAGIEYRKEKARQETDAISQATTSITGIRGAPAAQAGRPGGFNLYWPLPFSGSYDI

KEGFVEIGVPILKDSALGRSLNLNGAVRYADYSQSGGVTTWKLGGEYEPIDGLRFRA TRS RDIRGPSLVELFDPGRQATLNSIYGGQAVQTRFFTAGNADLRPEKADVLTFGAVLRPAFV PGFQFSVDRYWKVKGAIDFLLPQQEIDACDAGNTFFCDLITENPDGTITVTGPNLNLAV QKAAGIDFEAYYSRPVGGGTFSLRALATHHTSAYRIATGSAPIRSLGQPDTPKWSANFQA RYSTDDWALLVQQRFIAASVFNADNVEGVDTNLNHAPAVWYTDATLTFDIAAFGQKQQLF LSVNNLFDRDPPIATNDPSSFSSPTSSAYDPVGRYFNVGVRFRI

>Seq ID 23 (FumK) nicht vollständig

MRLTGGELLARCLAVEGVRYVFGLMSPEVDPLLAALEDNGILFVPVRHEAAAAYMAE GIY KTTGQVAAIVTNPGPGTANLLPGWTARHEGVPFVAITSQHQLGWYPCTPKTFQGQDQI DLFRPAVKWGAPIFAWNRIVEITHMAFREMWAGRPGPVQLEIPXSVMYWGERGPR-KFX DRR ....

>Seg ID 25 MELSRQRDQALRERAQAVIPGGMYGHESTYLMPEGTPQFFSRGKGARLWDADGNEYVDYM CÄYGPNLLGYGFEPVEAAAAAQQARGDTLTGPSEVMVQIAEDFVAQISHADWAMFCKNG T DATSMAMVIARAHTGRKTILCAKGAYHGAAPWCTPILAGTLPEDRAFWYYDYNDAQSLV DAFEAHQDDVAAIFATPHRHEVFSDQIDPDPEYAASVRALCDKSGALLWDEVRAGFRIA RDCSWAKIGVAPDLSTWGKCFANGYPISAVLGGEKVRSAAKAVYVTGSFWFSATPMAAAV ETLKQIRETDYLERINAAGTRLREGLQQQAAHNGFTLRQTGPVSMPQVLFEEDPDFRVGY

GWVRECLKRGVYFSPYHNMFLSAAHSEADLAKTLAATGDAFVELRAKLPSLEIHQPL LAL RAA-

Gemäß einer bevorzugten Weiterbildung des erfindungsgemäßen Verfahrens wird das Verfahren so geführt, daß vor Einsatz der Enzyme im Futtermittel diese mittels molekulargenetischer Methoden, Mutagenese oder molekularer Evolution verändert werden. Indem das Verfahren so geführt wird, daß die Enzyme vor ihrem Einsatz im Futtermittel mittels molekular- genetischer Methoden, Mutagenese oder molekularer Evolution verändert werden, gelingt es, die Enzyme in noch stabilerer und an den späteren Einsatzzweck angepaßter Form herzustel- len, wodurch der sauerstoffunabhängige Abbau von Mykotoxinen, insbesondere Fumonisinen, im Futter noch weiter verbessert bzw. vervollständigt werden kann.

Gemäß einer bevorzugten Weiterbildung des Verfahrens wird das Verfahren so geführt, daß die Enzyme vor ihrem Einsatz in dem Futtermittelzusatz isoliert werden. Durch Isolation der Enzyme kann ein gezielter Einsatz einzelner Enzyme in dem Futtermittel und somit dem Verdauungstrakt von Tieren durchgeführt werden, wodurch ein noch gezielterer Abbau von Mykotoxinen möglich wird.

Gemäß einer weiteren bevorzugten Weiterbildung des Verfahrens wird das Verfahren so geführt, daß die Enzyme in einer Schutzhülle verkapselt werden. Durch Verkapseln der Enzyme in einer Schutzhülle gelingt es, die Enzyme ohne Veränderung, insbesondere ohne Abbau und Schädigung an ihren Einsatzort, insbesondere in den Verdauungstrakt von Tieren, zu transportieren, so daß erst nach Auflösung der Schutzhülle, beispielsweise im Magen-Darm-Trakt von Tieren, die Enzyme 2u wirken beginnen, wodurch ein noch gezielterer, rascherer und vollständiger Abbau der Mykotoxine im sauerstoffunabhängigen bzw. anaeroben Milieu des Magen-Darm-Trakts von Tieren erzielt werden kann.

Gemäß einer bevorzugten Weiterbildung wird das erfindungsgemäße Verfahren so geführt, daß die Enzyme aus Permease ID-Nr. 3, Carboxylesterase ID-Nr. 9, Tricarballylat-Dehydrogenase ID-Nr. 11, Citratverwertungsprotein ID Nr. 13, Alkohol-Dehydrogenase ID-Nr. 17, Aminotransferase ID-Nr. 19 oder ID-Nr. 25 und/oder Acetolactat-Synthase ID-Nr. 23 gewählt werden. Durch eine derartige Verfahrensführung können insbesondere Fumonisine vollständig und sauerstoffunabhän- gig abgebaut werden. In diesem Fall werden aus dem Genclu- ster der Nukleinsäuresequenz mit der ID-Nr. l ausgewählte offene Leserahmen in prokaryotisehen oder eukaryotischen Wirtszellen zur Expression gebracht. Im bakteriellen Stamm mit der Hinterlegungsnummer DSM16254 erfolgt die Transkription der im Gencluster mit der ID-Nr 1 enthaltenen offenen Leserahmen gesteuert bzw. geregelt durch einen bidirektionalen Promotor, der zwischen fumA und fuml, wie dies Abb. 1 entnehmbar ist, angeordnet ist. Die Gene codieren für Pro- teine, welche in der Regulierung der Genexpression, wie beispielsweise FumB und FumC, bei der Substraterkennung und dem Transport, wie beispielsweise FumA, FumJ, FumG und im Substratkatabolismus, wie beispielsweise FumD, FumE, FumF, FumH, Fuml und FumK involviert sind. Aus den entsprechenden Nukleinsäuresequenzen, welche für spezielle Proteine codieren, wurden gemäß einer bevorzugten Weiterbildung des Verfahrens gemäß der Erfindung die Gene ausgewählt, welche für den Substratkatabolismus verantwortlich sind, wodurch die entsprechenden gebildeten Enzyme das Substrat, nämlich Fu- monisine vollständig katabolisieren können.

In der nachfolgenden Tabelle 1 ist die Bezeichnung der Gene des fumonisinkatabolischen Genclusters aufgeführt, wobei O die Orientierung, nämlich f forward und r reverse bedeuten.

Indem das erfindungsgemäße Verfahren bevorzugt so geführt wird, daß ein Enzym eingesetzt wird, welches wenigstens 90 % Sequenzidentität mit wenigstens einem der Enzyme ID-Nr. 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23 und 25 aufweist, kann ein noch vollständigerer Abbau der Fumonisine im Magen-Darm-Trakt von Tieren sichergestellt werden, wobei gleichzeitig nicht nur Fumonisine, sondern auch verwandte bzw. strukturell ähnliche Mykotoxine im anaeroben Milieu entgiftet werden können, wie zum Beispiel das AAL Toxin.

Indem das Verfahren bevorzugt so geführt wird, daß bei Einsatz von Aminotransferase ID-Nr. 19 oder ID-Nr. 25 als Co- substrat ein Keton, insbesondere eine α-Ketosäure, einge- setzt wird, kann insbesondere beim Abbau der Aminogruppe von Fumonisin und gleichzeitigem Einsatz von einer α-Ketosäure, wie beispielsweise Brenztraubensäure, die Aminogruppe an dem Fumonisinmolekül durch eine Ketogruppe ersetzt werden, wobei als Nebenprodukt dieser Reaktion Alanin ent- steht, welches vollständig unschädlich ist, so daß ein vollständiger Abbau von Fumosinen zu unschädlichen Substanzen sichergestellt ist.

Die Erfindung zielt weiterhin auf einen Futtermittelzusatz ab, mit welchem es sicher und zuverlässig gelingt, Mykotoxine, insbesondere Fumonisine im Futtermittel und/oder dem Verdauungstrakt von Tieren Sauerstoffunabhängig abzubauen bzw. zu detoxifizieren. Zur Lösung dieser Aufgaben ist ein derartiger Futtermittel- zusatz im wesentlichen dadurch gekennzeichnet, daß wenigstens ein Enzym der Sequenz ID-Nr. 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23 und 25 oder wenigstens ein kompletter, re- kombinanter Wirtsorganismus zur Produktion dieser Enzyme sowie gegebenenfalls zusätzlich wenigstens ein Cosubstrat für wenigstens eines bzw. einige der eingesetzten Enzyme und ein inerter Träger enthalten sind. Ein derartiger Futtermittelzusatz, in dem wenigstens ein Enzym oder ein kom- pletter, rekombinanter Wirtsorganismus zur Produktion dieses Enzyms sowie gegebenenfalls zusätzlich wenigstens ein Cosubstrat für wenigstens eines bzw. einige der eingesetzten Enzyme und ein inerter Träger enthalten sind, zeichnet sich dadurch aus, daß er zielgerichtet Mykotoxine, insbe- sondere Fumonisine im Verdauungstrakt von Tieren abbaut und somit detoxifiziert. Durch den Einsatz eines erfindungsgemäßen Futtermittelzusatzes, welcher im wesentlichen aus isolierten Enzymen sowie gegebenenfalls deren Cosubstraten und Trägern bestehen, ergibt sich der Vorteil, daß diese ihre katalytische Aktivität in einer Umgebung und unter Bedingungen beibehalten, in welchem beispielsweise komplette Mikroorganismen nicht oder nur wenig aktiv wären, wobei gleichzeitig eine bedeutend höhere, spezifische Aktivität erzielt werden kann, sowie definierte Reaktionen unter Ver- meidung von unerwünschten Nebenreaktionen katalysiert werden können. Darüber hinaus können Probleme, welche gemäß dem Stand der Technik durch den Einsatz vermehrungsfähiger Keime in den Futtermitteln entstanden sind, mit Sicherheit hintangehalten werden und überdies weisen Futtermittelzu- sätze, welche nur isolierte Enzyme enthalten, sowohl eine bessere Eignung zur Formulierung für gezielte und kontrollierte Aktivierung, d.h. beispielsweise an einer bestimmten Stelle des Verdauungstrakts , als auch die Vermeidung von unerwünschtem, erhöhtem Substratverbrauch auf. Um die Spezifität noch weiter zu erhöhen, ist der Futtermittelzusatz gemäß der vorliegenden Erfindung dahingehend bevorzugt weitergebildet, daß durch molekulargenetische Methoden, Muta- genese oder molekulare Evolution veränderte Enzyme eingesetzt sind.

Gemäß einer bevorzugten Weiterbildung ist äer Futtermittelzusatz so ausgebildet, daß ein Enzym eingesetzt ist, wel- ches wenigstens 90 % Sequenzidentität mit einem Enzym der ID-Nr. 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23 und 25 aufweist. Wenn ein Enzym eingesetzt ist bzw. wird, welches wenigstens 90 % Sequenzidentität mit einem Enzym mit der ID- Nr. 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23 und 25 aufweist, gelingt es, neben den bevorzugt abzubauenden Fumonisinen auch weitere Mykotoxine sicher und zuverlässig im Magen- Darm-Trakt von Tieren sauerstoffunabhängig abzubauen, wodurch eine weitgehende Entgiftung der aufgenommenen Futtermittel erzielt werden kann.

Indem der Futtermittelzusatz so ausgebildet ist, wie dies einer bevorzugten Weiterbildung der Erfindung entspricht, daß die Enzyme, veränderten Enzyme und/oder zu wenigstens 90 % identen Enzyme mit einer Schutzhülle ummantelt einge- setzt sind, kann sichergestellt werden, daß die Enzyme, die zu wenigstens 90 % identen Enzyme oder veränderten Enzyme vor einem vorzeitigen Aktivitätsverlust gesichert sind und sicher und zuverlässig an der vorgesehenen Stelle des Magen-Darm-Trakts ihre Wirkung entfalten.

Indem der Futtermittelzusatz bevorzugt so weitergebildet ist, daß die Enzyme aus einer Carboxylesterase ID-Nr. 9, Tricarballylat-Dehydrogenase ID-Nr. 11, einem Citratverwer- tungsprotein ID Nr. 13, Alkohol-Dehydrogenase ID-Nr. 17, Aminotransferase ID-Nr. 19 oder ID-Nr. 25 und/oder Ace- tolactat-Synthase ID-Nr. 23 gewählt sind, werden im wesentlichen die zum Substratkatabolismus befähigten Enzyme zum Einsatz gebracht, so daß neben einer geringeren Menge an einzusetzenden Enzymen auch sichergestellt werden kann, daß keine unerwünschten Nebenreaktionen im Magen-Darm-Trakt von Tieren auftreten.

Gemäß einer bevorzugten Weiterbildung der Erfindung ist der Puttermittelzusatz so ausgebildet, daß eine Carboxylestera- se ID-Nr. 9, eine Aminotransferase ID-Nr. 19 oder ID-Nr. 25, eine α-Ketosäure als Cosubstrat und ein inerter Träger enthalten sind. Indem der Futtermittelzusatz eine Carboxyl- esterase, eine Aminotransferase und eine α-Ketosäure als Cosubstrat neben einem inerten Träger aufweist, gelingt es insbesondere, Fumonisine, welche in den Futtermitteln enthalten sind, zuerst zu hydrolysieren, indem von den Fumoni- sinen Tricarballylsäurereste mit Hilfe einer Carboxyl- esterase abgespalten werden, und das so gebildete hydroly- sierte Fumonisin in weiterer Folge unter Einwirkung der Aminotransferase und der α-Ketosäure als Cosubstrat, im vorliegenden Fall bevorzugt Brenztraubensäure , weiter umzusetzen, indem eine Aminogruppe von dem hydrolysierten Fumo- nisinmolekül durch eine Ketogruppe ersetzt wird, so daß ein für Tiere völlig ungefährliches 2-Keto-hydrolysiertes Fumonisin entsteht, welches unverändert ausgeschieden werden kann, und als Nebenprodukt Alanin gebildet wird, welches ebenfalls keinerlei negative Eigenschaften auf den Organis- mus ausübt .

Schließlich zielt die vorliegende Erfindung auf die Verwendung von Genen, wie sie in den Sequenzen ID-Nr. 1, 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 und 24 dargestellt sind, oder kompletten, rekombinanten Wirtsorganistnen zur Expression von Enzymsequenzen ID-Nr. 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23 und 25 sowie gegebenenfalls von Cosubstraten zur Herstellung eines Futtermittelzusatzes für Tiere ab. Mit derartig hergestellten Futtermittelzusätzen gelingt ein vollständiger und zuverlässiger Abbau von Mykotoxinen, insbesondere Fumonisinen im Verdauungstrakt von Tieren, wobei für einen derartigen Abbau im Gegensatz zu aus dem Stand der Technik bekannten Genen keinerlei molekularer Sauerstoff erforderlich ist.

In bevorzugter Weise werden gemäß der vorliegenden Erfindung ein Cosubstrat aus der Gruppe: einer Carboxylesterase ID-Nr. 9, einer Aminotransferase ID-Nr. 19 oder ID-Nr. 25 oder einer α-Ketosäure, und ein inerter Träger eingesetzt, mit welcher Verwendung insbesondere Fumonisine sicher und zuverlässig im Verdauungstrakt von Tieren zur Gänze zu unschädlichen Bestandteilen abgebaut werden können.

Die Erfindung wird nachfolgend anhand von Ausführungsbeispielen sowie Figuren näher dargestellt. In diesen zeigt: Fig. 1 den Fumonisin-katabolischen Gencluster, Fig. 2 die Michaelis-Menten-Kurve für Fumonisin-Carboxyle- sterase FumD, und

Fig. 3 eine Abbaukurve von hydrolysiertem Fumonisin B 1 ,

In Fig. 1 ist ein Fumonisin katabolischer Gencluster als Teilseguenz von 15420 Basenpaaren eines mikrobiellen Stam- tnes mit der Hinterlegungsnummer DSM 16254 dargestellt. In dem fuxπ-Gencluster des bakteriellen Stammes DSM 16254 wird die Transkription der offenen Leserahmen durch einen bidirektionalen Promotor gesteuert bzw. geregelt, welcher zwi- sehen fumA und fuml angeordnet ist. Der Cluster codiert Proteine, welche in der Regulierung der Genexpression, wie beispielsweise FumB und FumC, in der Substraterkennung und dem Transport, wie beispielsweise FuraJ, FumA und FumG und in einem Substratkatabolismus, wie beispielsweise FumD, FumE, FumF, FumH, Fuml und FumK involviert sind.

Beispiele

Beispiel 1: Die Enzymkinetik von Fumonisin-Carboxylesterase

Das fuiciD Gen (Sequenz ID-Nr. 8) , welches eine Fumonisin- Carboxylesterase codiert, wurde kloniert und in Pichia pa- storis unter Verwendung von Standardverfahren exprimiert . Das his-getaggte Enzym wurde rückgewonnen und aus der über- stehenden Lösung der Kultur durch Affinitätschromatographie gereinigt. Die Enzymkonzentration wurde bestimmt und die enzymkinetischen Parameter wurden mit sieben unterschiedlichen Substratkonzentrationen im Bereich zwischen 50 μg bis 25 mg FB 1 pro Liter und einer Enzymkonzentration von 0,33 ng/ml bestimmt. Die Reaktionen wurden in 20 mM Tris-Cl (pH 8,0) Puffer mit 0,1 mg/ml Rinderserumalbumin gepuffert und bei 30 0 C inkubiert. Proben wurden nach 0, 30, 60 120 und 240 Minuten Inkubation genommen und durch HPLC-MS/MS analysiert. Fumonisin B x (FBi) und hydrolysiertes Fumonisin Bi wurden quantifiziert basierend auf einer Kalibrierung mit den gereinigten Referenzsubstanzen und einem vollständig 13 C markierten, internen FBl Standard.

Fig. 2 zeigt die Michaelis-Menten-Kurve für die Transforma- tion von Fumonisin Bl (FBl) durch Fumonisin-Carboxylesterase FumD, welche bei einer Enzymkonzentration von 0,33 ng/ml in Tris-Cl-Puffer (pH 8,0) bestimmt wurde, wobei anfängliche Enzymgeschwindigkeiten gegen die Substratkonzen- tration aufgetragen wurden. Die Michaelis-Menten-Kurve zeigt einen Abfall bei höheren Substratkonzentrationen, da die Enzymgeschwindigkeit basierend auf dem Produkt, d.h. hydrolysierter FBi-Bildung berechnet wurde. Da hydrolysier- tes FBi aus FBi in einer zweistufigen Reaktion über partiell hydrolysiertes FB 1 mit lediglich einer Tricarballyl- säure-Seitenkette, die zurückbehalten wurde, und einer Seitenkette ausgebildet wird, die abgespalten wurde, war die Endproduktbildung bei hohen Substratkonzentrationen verzö- gert. Die Michaelis-Menten-Konstante K M wurde als 0,90 μmol/1 berechnet, was 650 ppb äquivalent ist, und die Um- wandlungszahl war 900 pro Sekunde.

Aus Fig. 2 ergibt sich, daß Fumonisine mit der Carboxyl- esterase in den relevanten Konzentrationsbereichen rasch und vollständig hydrolysiert werden können.

Beispiel 2: Die katalytische Aktivität von hydrolysierter Fumonisinaminotransferase

Sequenz ID-Nr. 18 wurde unter Verwendung von Standardverfahren kloniert und in E. coli exprimierfc unter Steuerung bzw. Regelung eines Bakteriophagen T7 Promotors. Die Bakterienzellen wurden gesammelt in 50 mM Natriumphosphatpuffer, neuerlich suspendiert und durch Ultraschall lysiert. Hydrolysiertes Fumonisin wurde hinzugefügt und die Proben wurden bei 25 0 C inkubiert. Proben wurden in Zeitintervallen genommen und durch HPLC-MS/MS analysiert. Es wurde keine Reduktion der hydrolysierten FB 1 Konzentration beobachtet. Wenn ein Cosubstrat, wie beispielsweise eine α-Ketosäure, wie Brenztraubensäure oder Oxalacetat zu der Reaktion hinzugefügt wurde, konnte ein vollständiger Abbau des hydrolysierten Fumonisins zu 2-Keto-HFB x beobachtet werden, wie dies in Fig. 3 dargestellt ist. Diese Substanz ist für Tiere vollständig unschädlich.

Beispiel 3 : Enzymaktivität in Darmmilieu

Zur Überprüfung der enzymatisehen Aktivität von FUM-Carbo- xylesterase im Verdauungstrakt wurden schlachtfrische Schweinedärme verwendet und unter Ausschluß von Sauerstoff ins Labor transportiert und in einer anaeroben Sterilwerk- bank untersucht. Etwa 10cm lange Stücke von Duodenum und Jejunum wurden abgebunden und herausgeschnitten. Mit Kanülen wurde Fumonisin Bl in konzentrierter wäßriger Lösung auf eine Endkonzentration von etwa 10 ppm eingespritzt und mit Darminhalt vermischt. Anschließend wurden 5 μg Fumoni- sin-Carboxylesterase in wäßriger Lösung, bzw. dasselbe Volumen Wasser in den Negativkontrollen, eingespritzt und eingemischt. Die Darmabschnitte wurden bei 39 0 C inkubiert. Mit Hilfe von Kanülen wurden Proben gezogen und durch HPLC- MS/MS analysiert. Dabei zeigte sich, daß Fumonisin Bl im Duodenum und Jejunum zum Zeitpunkt der ersten Probenahme nach zwei Stunden bereits vollständig hydrolysiert war.

Beispiel 4: Ermittlung des Temperaturbereichs der Aktivität von Fumonisin-Carboxylesterase

Zur Ermittlung des Temperaturbereichs, in dem Fumonisin- Carboxylesterase aktiv ist, wurden 1,6 ng/ml FUM-Carboxyl- esterase in 20 mM Tris-Cl Puffer, pH 7,0, mit 0,1 mg/ml BSA und 10 ppm Fumonisin Bl bei unterschiedlichen Temperaturen inkubiert. Dabei zeigte sich, daß das Temperaturoptimum für das Enzym bei 30 0 C lag. Auch bei 40 0 C und sogar 50 0 C wurde enzymatische Aktivität noch eindeutig festgestellt. Somit ist diese FUM-Carboxylesterase zur Anwendung unter den Temperaturbedingungen wie im Verdauungstrakt, oder im Zuge von Prozeßschritten der Lebens- oder Futtermittelherstellung, die bei erhöhter Temperatur stattfinden, geeignet .

Beispiel 5 : Bestimmung des pH-Bereichs der Aktivität von Fumonisin-Carboxylesterase

Zur Bestimmung des pH-Bereichs, in dem Fumonisin-Carboxyl- esterase aktiv ist, wurde Teorell-Stenhagen-Puffer verwendet. Dieser Puffer läßt sich durch die Kombination von Ci- trat, Phosphat und Borat über einen Bereich von 10 pH Einheiten mit gleicher Pufferkapazität einstellen. FUM-Car- boxylesterase wurde in einer Konzentration von 3 , 3 ng/ml mit 10 ppm Fumonisin Bl bei verschiedenen pH-Werten in diesem Puffer bei 25 0 C inkubiert. Die höchste Aktivität zeigte sich bei pH 8,0, aber es konnte im gesamten Bereich von pH 5 bis pH 10 Aktivität festgestellt werden. Durch die Aktivität in diesem breiten pH-Bereich wird die technologi- sehe Anwendung des Enzyms als Futtermittelzusatz bzw. in Zuge der Verarbeitung von Lebens- und Futtermitteln ermöglicht.

Beispiel 6: Fütterungsversuch mit Ferkeln

Der Versuch wurde in einem Versuchsstall mit 12 Buchten für jeweils 10 Tiere durchgeführt. Der Stall war ausgestattet mit Spaltenboden, Schalentränkern und einem computergesteuerten Fütterungssystem. Die Automaten waren entlang der Buchtenwände angeordnet. Das Stallklima wurde täglich automatisch aufgezeichnet und die Temperatur nach den Standardempfehlungen zur Ferkelaufzucht eingestellt. 120 gemischt-geschlechtliche Absetzferkel (Alter: ca. 4 Wochen, durchschnittliches Einstellgewicht 8,21 kg) wurden für diesen Versuch eingesetzt. Jedes Ferkel wurde mit einer Ohrmarke versehen und einzeln gewogen. Die 120 Ferkel wur- den auf 12 Buchten zufällig verteilt. Alle Ferkel entstammten dem österreichischen Zuchtprogramm ÖHYB (= (Edelschwein x. Landrasse) x Pietrain) .

Direkt nach dem Absetzen wurden die Ferkel für 2 Tage mit einem Starterfutter gefüttert, nach dieser Eingewöhnungs- phase erfolgte die Umstellung auf das Versuchsfutter. Die Fütterung erfolgte 2-phasig: Absetzphase Tag 1 - 14, Auf- suchtphase Tag 15 - 42. Das Versuchsfutter wurde buchtenindividuell über die Spotmix-Fütterungsanlage gemischt und je nach Anzahl der Ferkel, Gewichtsentwicklung und Futterverzehr zweimal täglich trocken zugeteilt. Wasser stand zur Aufnahme ad libitum zur Verfügung. Die 12 Buchten wurden in vier verschiedene Applikationsgruppen zu je drei Wiederholungen geteilt und erhielten die folgenden Einmischungen ins oben beschriebene Putter:

In der Positiv-Kontrolle wurden bei fast der Hälfte der Tiere respiratorische Probleme beobachtet, wobei es auch zu einem Ausfall kam. Alle anderen Gruppen erschienen gesund. Leistungsdaten