DEATON JOHN (US)
ADAMS BROCK (US)
MAYFIELD MICHAEL (US)
LONGO AMANDA (US)
GONZALEZ OSCAR (US)
HANSEN JON (US)
WANG XUN (US)
SCHROEDER DAVID (US)
WO2014018423A2 | 2014-01-30 | |||
WO2012170125A2 | 2012-12-13 |
US20160340661A1 | 2016-11-24 | |||
US20160340662A1 | 2016-11-24 | |||
US20160354487A1 | 2016-12-08 | |||
US20160355796A1 | 2016-12-08 | |||
US20160355797A1 | 2016-12-08 | |||
US5356802A | 1994-10-18 | |||
US5436150A | 1995-07-25 | |||
US5487994A | 1996-01-30 | |||
US20120309939A1 | 2012-12-06 | |||
US20100129394A1 | 2010-05-27 |
JINEK ET AL., SCIENCE, vol. 337, no. 6096, 2012, pages 816 - 21
LI ET AL., PROC., NATL. ACAD. SCI. USA, vol. 89, 1992, pages 4275 - 4279
LI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 2764 - 2768
KIM ET AL., PROC. NATL. ACAD. SCI. USA., vol. 91, 1994, pages 883 - 887
KIM ET AL., J. BIOL. CHEM., vol. 269, 1994, pages 31,978 - 31,982
RASALAMAYFIELD, BIOENG BUGS., vol. 2, no. 1, 2011, pages 50 - 4
RASALA ET AL., PLANT BIOTECHNOL J., 2 May 2011 (2011-05-02)
CORAGLIOTTI ET AL., MOL BIOTECHNOL, vol. 48, no. 1, 2011, pages 60 - 75
SPECHT ET AL., BIOTECHNOL LETT., vol. 32, no. 10, 2010, pages 1373 - 83
RASALA ET AL., PLANT BIOTECHNOL J., vol. 8, no. 6, 2010, pages 719 - 33
MULO ET AL., BIOCHIM BIOPHYS ACTA, 2 May 2011 (2011-05-02)
BONENTE ET AL., PHOTOSYNTH RES., 6 May 2011 (2011-05-06)
FYRESTAMOSTMAN: "Determination of heme in microorganisms using HPLC-MS/MS and cobalt(III) protoporphyrin IX inhibition of heme acquisition in Escherichia coli", ANAL BIOANAL CHEM, vol. 409, 2017, pages 6999 - 7010, XP036377566, DOI: 10.1007/s00216-017-0610-5
What is claimed is: 1. A composition comprising a preparation from an algae strain, wherein the algae strain overexpresses or accumulates protoporphyrin IX (PPIX). 2. The composition of claim 1, wherein the preparation is a biomass from the algae strain. 3. The composition of claim 2, wherein the preparation is a fractionated biomass from the algae strain. 4. The composition of claim 3, wherein the fractionated biomass comprises a PPIX- enriched fraction. 5. The composition of claim 4, wherein the PPIX-enriched fraction further comprises a protein-enriched fraction. 6. The composition of claim 1, wherein the preparation is an extracellular fraction of the algae culture. 7. The composition according to any of claims 1-6, wherein the preparation is red or red- like in color. 8. The composition according to any of claims 1-7, wherein the preparation contains a greater amount of PPIX than of heme. 9. The composition according to any of claims 1-8, wherein the preparation contains less than about 1%, 0.5%, 0.1%, 0.05%, 0.01%, 0.005% or 0.001% heme. 10. The composition according to any of claims 1-9, wherein the preparation contains less than about 1%, 0.5%, 0.1%, 0.05%, 0.01%, 0.005% or 0.001% heme-protein. 11. The composition according to any of claims 1-10, wherein the preparation does not contain a detectable amount of heme-protein. 12. The composition according to any of claims 1-11, wherein the preparation does not contain a detectable amount of heme. 13. The composition according to any of claims 1-4, wherein the preparation does not contain a detectable amount of protein. 14. The composition according to any of claims 1-13, wherein the preparation has a protoporphyrin IX content greater than chlorophyll content. 15. The composition according to any of claims 1-4 or 6, wherein the preparation provides at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or 100% of the total protein content to the edible composition. 16. The composition according to any of claims 1-15, wherein the preparation provides vitamin A, beta carotene or a combination thereof to the composition. 17. The composition of claim 16, wherein the vitamin A, the beta carotene or the combination thereof is at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or 100% of the daily recommended requirement. 18. The composition according to any of claims 1-17, wherein the preparation provides less than about 0.01%, 0.05%, 0.1%, 0.2%, 0.3%, 0.4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, 1.0%, 1.2%, 1.5%, 2%, 5% or 10% of total saturated fat present in the composition. 19. The composition according to any of claims 1-18, wherein the preparation provides at least about 5 mg, 10 mg, 15 mg, 20 mg, 25 mg, 30 mg, 35 mg, 40 mg, 45 mg, 50 mg, 55 mg, 60 mg, 65 mg, 70 mg, 75 mg, 80 mg, 85 mg, 90 mg, 95 mg, 100 mg, 125 mg, 150 mg, 175 mg, 200 mg, 250 mg, 300 mg, 350 mg, 400 mg, 450 mg or 500 mg of omega-3 fatty acids to the composition. 20. The composition according to any of claims 1-19, wherein the composition has a red or red-like color derived from the preparation. 21. The composition according to any of claims 1-20, wherein the composition has a meat or meat-like flavor derived from the preparation. 22. The composition according to any of claims 1-21, wherein the composition has a meat or meat-like texture derived from the preparation. 23. The composition according to any of claims 1-22, wherein the algae is a Chlamydomonas sp. 24. The composition of claim 23, wherein the algae is Chlamydomonas reinhardtii. 25. The composition of claim 23, wherein the Chlamydomonas sp. is strain CC-125 deposited to the University of Minnesota Chlamydomonas collection center or a derivative thereof. 26. The composition of claim 23, wherein the algae has reduced or an absence of ferrocheletase activity or expression of ferrocheletase. 27. A food product comprising the composition according to any of claims 1-26. 28. The food product of claim 27, wherein the food product comprises a clean meat, a cultured meat, a synthetic meat, a plant-based meat or a non-animal cell-based meat. 29. The food product of any of claims 27-28, wherein the food product is selected from the group consisting of a beef-like food product, a fish-like product, a chicken-like product, a pork-like product and a meat replica. 30. The food product of any of claims 27-29, wherein the food product is vegan, vegetarian or gluten-free. 31. An edible ingredient comprising the composition according to any of claims 1-26. 32. The edible ingredient of claim 31, wherein the edible ingredient is part of a finished product, and wherein the finished product has a red or red-like color derived from the ingredient. 33. The edible ingredient of claim 31, wherein the edible ingredient is part of a finished product, and wherein the finished product has a meat or meat-like flavor derived from the ingredient. 34. The edible ingredient of claim 31, wherein the edible ingredient is part of a finished product, and wherein the finished product has an appearance of blood derived from the ingredient. 35. The edible ingredient according to any of claims 31-34, wherein the finished product is an ingredient for a burger, a sausage, a kebab, a filet, a ground meat-like product or a meatball. 36. The edible ingredient according to any of claims 31-34, wherein the edible composition is part of a finished product and wherein the finished product is an animal feed. 37. The edible ingredient according to any of claims 31-36, wherein the edible ingredient is combined with a protein source, a fat source, a carbohydrate, a starch, a thickener, a vitamin, a mineral, or any combination thereof. 38. The edible ingredient of claim 35, wherein the protein source is textured wheat protein, textured soy protein, fungal protein or algal protein. 39. The edible ingredient according to any of claims 37 or 38, wherein the finished product is free of animal proteins. 40. The edible composition of any of claims 37-39, wherein the fat source comprises at least one of refined coconut oil or sunflower oil. 41. The edible composition of any of claims 37-40, further comprising at least one of potato starch, methylcellulose, water, or a flavor, wherein the flavor is selected at least one of yeast extract, garlic powder, onion powder, and salt. 42. A meat substitute comprising the composition according to any of claims 1-26 or the edible ingredient according to any of claims 31-41. 43. The meat substitute of claim 42, further comprising: (a) 0.0l%-5% (by weight of the meat replica matrix) of a non-animal protoporphyrin IX; (b) a compound selected from the group consisting of glucose, ribose, fructose, lactose, xylose, arabinose, glucose-6-phosphate, maltose, and galactose, and any combination thereof; (c) at least 1.5 mM of a compound selected from the group consisting of cysteine, cystine, thiamine, methionine, and any combination thereof; and (d) one or more proteins selected from the group consisting of plant proteins, fungal proteins and algal proteins, wherein the meat substitute is a ground beef-like food product that contains no animal product, and wherein cooking the ground beef-like food product results in the production of at least two volatile compounds which have a beef-associated aroma. 44. A method of producing a protoporphyrin IX composition, comprising: (a) growing an algae population comprising an algae that is a protoporphyrin IX over-producer in a culture; and (b) isolating a protoporphyrin IX composition from the culture. 45. The method of claim 44, wherein the step of growing comprises culturing the algae in an aerobic fermentation condition. 46. The method of claim 44 or claim 45, wherein the algae contains a chloroplast. 47. The method of claim 46, wherein biosynthesis of the protoporphyrin IX occurs in the chloroplast. 48. The method according to any of claims 44-47, wherein the algae is deficient for its ability to produce chlorophyll. 49. The method according to any of claims 44-48, wherein the algae is deficient for the ability to produce a functional Mg-chelatase enzyme. 50. The method according to any of claims 44-49, wherein the algae is reduced in or lacks one or more of CHLD, CHLI1, CHLI2 or CHLH1. 51. The method according to any of claims 44-50, wherein the algae is reduced in or lacks a functional light dependent protochlorophyllide. 52. The method according to any of claims 44-51, wherein the algae is reduced in or lacks a functional light independent protochlorophyllide. 53. The method according to any of claims 44-52, wherein the algae is reduced in or lacks ChlB, ChlL, or ChlN. 54. The method according to any of claims 44-53, wherein the algae overexpresses one or more of glutamyl-tRNA reductase, glutamate- 1 -semialdehyde aminotransferase, ALA dehydratase, porphobilinogen deaminase, UPG III synthase, UPG III decarboxylase, CPG oxidase, or PPG oxidase. 55. The method according to any of claims 44-54, wherein the algae is generated by mating to produce a generated strain, and wherein the generated strain is red or red- like in color. 56. The method according to any of claims 44-54, wherein the algae is generated by mutagenesis. 57. The method according to any of claims 44-56, wherein the algae is red or red-like in color. 58. The method according to any of claims 44-57, wherein the isolated protoporphyrin IX composition is an algae biomass. 59. The method of claim 58, wherein the algae biomass is fractionated. 60. The method of claim 59, wherein the algae biomass is fractionated to produce a protein-enriched fraction comprising protoporphyrin IX . 61. The method according to any of claims 44-57, wherein the isolated protoporphyrin IX composition is isolated from extracellular media of the algae culture. 62. The method according to any of claims 44-61, wherein the isolated protopophyrin IX composition is isolated away from algae protein. 63. The method according to any of claims 44-62, wherein the algae is deficient for carotenoids. 64. The method according to any of claims 44-63, wherein the algae is a Chlamydomonas sp. 65. The method according to any of claims 44-64, wherein the algae is a Chlamydomonas reinhardtii. 66. The method of claim 64, wherein the Chlamydomonas sp. is strain CC-125 deposited to the University of Minnesota Chlamydomonas collection center or a derivative thereof. 67. The method according to any of claims 44-66, wherein progeny of a protoporphyrin IX overexpressing algae strain grows faster than its parental strain following a mating with another algae. 68. The method according to any of claims 44-66, wherein the protoporphyrin IX overexpressing algae is a strain produced by mating a strain deficient for carotenoids with a strain exhibiting a red or red-like color. 69. The method according to any of claims 44-66, wherein the protoporphyrin IX overexpressing algae is generated by mutagenesis of a first starting strain and selection of a second strain that grows faster in the dark than the first starting strain. 70. The method according to any of claims 44-66, wherein the protoporphyrin IX overexpressing algae is generated by mutagenesis of a first strain and selection of a second strain that lacks one or more carotenoids from the mutated first strain. 71. The method according to any of claims 44-70, wherein the algae lacks a functional ferrocheletase enzyme. 72. The method according to any of claims 44-70, wherein the algae is reduced in the amount of, or activity of, a ferrocheletase enzyme. 73. The method according to any of claims 44-70, wherein the algae is reduced in the amount of or lacks heme as compared to a wildtype strain. 74. A protoporphyrin IX-containing composition produced by the method according to any of claims 43-70. 75. The composition of claim 74, wherein the composition does not contain a detectable level of heme, heme-binding protein or a combination thereof. 76. The method according to any of claims 44-73, further comprising the steps of: (a) culturing the algae strain under a dark condition, wherein the strain does not produce or is reduced in the production of chlorophyll, and (b) collecting a portion of the algae culture that is red or red-like in color to produce the protoporphyrin IX composition. 77. The method of claim 76, wherein the algae is a Chlamydomonas sp. 78. The method of claim 77, wherein the algae is a Chlamydomonas reinhardtii. 79. The method according to claim 76, wherein the algae exhibits a red or red-like color when grown in the dark condition. 80. The method of claim 76, wherein the collected portion is extracellular media from the algae culture. 81. The method of claim 76, wherein the collected portion is a biomass or fractionated biomass from the algae culture. 82. The method of claim 76, wherein the algae is grown in an aerobic fermentation condition. 83. The method of claim 76, wherein the algae is grown to a density greater than about lOg/L, 20 g/L, 30 g/L, 40g/L, 50g, L, 75 g/L, lOOg/L, 125 g/L, or l50g/L. 84. The method of claim 76, wherein the algae is grown with acetate as a reduced carbon source. 85. The method of claim 76, wherein the algae is grown with sugar as a reduced carbon source. 86. The method of claim 76, wherein the algae culture is supplemented with iron during the culturing step. 87. The method of claim 76, wherein the algae culture is inoculated at a density greater than about 0.1 g/L, 1.0 g/L, 5.0 g/L, 10 g/L, 20 g/L, 50 g/L, 80 g/L, or 100 g/L. 88. The method of claim 76, further comprising fractionating the collected portion, wherein the fractionating removes from the collected portion substantially all or most of a component selected from the group consisting of carotenoids, starch, and protein. 89. The method of claim 76, further comprising fractionating the collected portion, wherein the fractionating removes from the collected portion substantially all or most of heme, heme-binding protein or a combination thereof. 90. The method of claim 76, further comprising fractionating the collected portion, wherein the fractionating produces a protein-enriched fraction. 91. The method of claim 76, wherein the algae lacks or is reduced in one or more of magnesium chelatase, magnesium protoporphyrinogen IX, protochlorophyllide, chlorophyllide, and chlorophyll. 92. The method of claim 76, wherein the algae lacks or is reduced in ferrocheletase. 93. The method according to any of claims 44-73 or 76-92, wherein the algae is not a transgenic strain. 94. A clean meat product produced by the method according to any of claims 76-93, wherein the method further comprises combining the collected portion with a clean meat manufacturing composition, wherein the collected portion provides a red or red- like color to the clean meat product. 95. The clean meat product of claim 94, wherein the collected portion is a PPIX-enriched fraction or purified PPIX. 96. An edible ingredient produced by the method according to any of claims 44-73 or 76- 93, wherein the protoporphyrin IX composition confers a meat or meat-like flavor, texture, odor or any combination thereof to the edible ingredient. 97. The edible ingredient of claim 96, wherein the edible ingredient is incorporated in a finished product selected from the group consisting of a beef-like food product, a fish- like product, a chicken-like product, a pork-like product and a meat replica. 98. The edible ingredient of any of claims 96-97, wherein the edible ingredient is vegan, vegetarian or gluten-free. 99. The edible ingredient of any of claims 96-98, wherein the edible ingredient is free of animal proteins. 100. The edible ingredient of any of claims 96-99, wherein the edible ingredient does not contain any genetically modified components. |
IN ALGAE AND COMPOSITIONS THEREFROM
CROSS-REFERENCE TO RELATED APPLICATION(S)
[0001] This application claims the benefit of priority under 35 U.S.C. § 119(e) of US Provisional Application No. 62/865,800, filed June 24, 2019, of US Provisional Application No. 62/850,227, filed May 20, 2019, and of US Provisional Application No. 62/757,534, filed November 8, 2018, the entire content of each of which is hereby incorporated by reference.
SEQUENCE LISTING
[0002] The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on November 7, 2019, is named 20498-202380_SL.txt and is 208 kilobytes in size.
BACKGROUND
[0003] With the advent of industrialized animal agriculture, the consumption of animal meat has continued to rise. Accounting for more than 18% of the greenhouse gases generated to date, animal agriculture is one of the leading causes of climate change. In addition to land use, animal agriculture also requires a significant amount of fresh water, a finite resource that is becoming increasingly difficult to access. It is estimated that to produce one pound of beef it takes 1,799 gallons of fresh water and to produce one pound of pork it takes 576 gallons of water. This is compared to 216 gallons of fresh water to produce 1 pound of soybean or 108 gallons to produce one pound of com. The intensity of fresh water needed to produce animal meat is a result of the water needed to grow the plants that the animals consume and the animal’s inefficiency at turning the food that it consumes into actual meat.
[0004] To address the sustainability and ethical concerns over animal meat consumption, the food industry has been aggressively trying to develop plant-based alternatives that taste, touch and smell like meat products. However, many of the current plant-based alternatives have not been able to penetrate the larger food and consumer markets. Typically these alternatives are composed of plant based materials that are extruded to generate a firm texture to improve mouth feel and subsequently mixed with various flavors and aroma forming compounds to improve the taste and smell of these products. Unfortunately, these alternatives have largely appealed to consumers who have already committed to a vegan/vegetarian lifestyle as opposed to consumers who are more accustomed to eating meat. To improve the sustainability of the food ecosystem it is imperative that products are developed that appeal to consumers who currently prefer meat. By producing the next generation of plant-based products the contribution of greenhouse gases and the demand for water resulting from the animal agriculture industry can be drastically reduced.
[0005] Recent advances have demonstrated the potential of using heme-containing proteins, purified from a host organism, to make the flavor and aroma profile of a product closer to that of meat. It is thought that the heme from heme-containing proteins are responsible for imparting a“meaty” flavor and aroma to meat products. However, the available sources of heme-containing proteins are expensive and technically intensive limiting their utility. For example, the heme binding protein, leghemoglobin, has been extracted from soy roots, but this process is proving to be expensive making its incorporation into meat alternatives less economically viable. The yeast, Pichia pastoris has been engineered to express heme binding proteins, for instance with an additional 8 enzyme pathways for producing the heme molecule. This process still requires the heme binding protein to be purified away from the expression host before it is incorporated into a finished product, a process that limits the potential positive impacts due to economic constraints. In addition to poor economics, the product is genetically modified making it less appealing to many consumers who have chosen to consume foods that are not a result of genetic engineering. Thus, a need exists for edible products incorporating heme-containing proteins as set forth herein.
SUMMARY OF THE INVENTION
[0006] Provided herein are compositions and processes for producing such compositions that provide new sources for flavor, color, mouth feel, taste, odor, texture and nutrition for food products and food ingredients, as well as other uses such as animal feed. Provided herein are compositions and processes for producing such compositions from an algae that overproduces protoporphyrin IX. Accordingly, in an exemplary aspect, the present invention provides a composition comprising a preparation from an algae strain, wherein the strain overexpresses or accumulates protoporphyrin IX (PPIX). In some embodiments, the preparation is a biomass from the algae strain. In some embodiments, the preparation is a fractionated biomass from the algae strain. In such embodiments, it is contemplated that the fractionated biomass comprises a PPIX-enriched fraction. Further, in such embodiments, it is also contemplated that the PPIX-enriched fraction further comprises a protein-enriched fraction. In some embodiments, wherein the preparation is an extracellular fraction of the algae culture.
[0007] In some embodiments, the preparation is red or red-like in color. Alternatively and/or additionally, the preparation contains a greater amount of PPIX than of heme.
Alternatively and/or additionally, the preparation contains less than about 1%, about 0.5%, about 0.1%, about 0.05%, about 0.01%, about 0.005% or about 0.001% heme. Alternatively and/or additionally, the preparation contains less than about 1%, about 0.5%, about 0.1%, about 0.05%, about 0.01%, about 0.005% or about 0.001% heme-protein.
[0008] In some embodiments, the preparation does not contain a detectable amount of a heme-protein. Alternatively and/or additionally, the preparation does not contain a detectable amount of heme. Alternatively and/or additionally, the preparation does not contain a detectable amount of protein. In some embodiments, the preparation has a protoporphyrin IX content greater than chlorophyll content.
[0009] In some embodiments, the preparation provides at least about 5%, 10%, 15%,
20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%,
99% or 100% of the total protein content to the edible composition. Alternatively and/or additionally, the preparation provides vitamin A, beta carotene or a combination thereof to the composition. In such embodiments, it is preferred that the vitamin A, the beta carotene or the combination thereof is at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or 100% of the daily recommended requirement. In some embodiments, the preparation provides less than about 0.01%, 0.05%, 0.1%, 0.2%, 0.3%, 0.4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, 1.0%, 1.2%, 1.5%,
2%, 5% or 10% of total saturated fat present in the composition. Alternatively and/or additionally, the preparation provides at least about 5 mg, 10 mg, 15 mg, 20 mg, 25 mg, 30 mg, 35 mg, 40 mg, 45 mg, 50 mg, 55 mg, 60 mg, 65 mg, 70 mg, 75 mg, 80 mg, 85 mg, 90 mg, 95 mg, 100 mg, 125 mg, 150 mg, 175 mg, 200 mg, 250 mg, 300 mg, 350 mg, 400 mg, 450 mg or 500 mg of omega-3 fatty acids to the composition.
[0010] In some embodiments, the composition has a red or red-like color derived from the preparation. Alternatively and/or additionally, the composition has a meat or meat-like flavor derived from the preparation. Alternatively and/or additionally, the composition has a meat or meat-like texture derived from the preparation.
[0011] In some embodiments, the algae is a Chlamydomonas sp. Optionally, the algae is Chlamydomonas reinhardtii. In some embodiments, the Chlamydomonas sp. is strain CC-125 deposited to the University of Minnesota Chlamydomonas collection center or a derivative thereof. In some embodiments, the algae has reduced or absence of ferrocheletase activity or expression of ferrocheletase.
[0012] Another aspect of the disclosure includes a food product comprising the composition as described herein. In some embodiments, the food product comprises a clean meat, a cultured meat, a synthetic meat, a plant-based meat or a non-animal cell-based meat. Alternatively and/or additionally, the food product is selected from the group consisting of a beef-like food product, a fish-like product, a chicken-like product, a pork-like product and a meat replica. Alternatively and/or additionally, the food product is vegan, vegetarian or gluten-free.
[0013] Another aspect of the disclosure includes an edible ingredient comprising the composition as described herein. In some embodiments, the ingredient is part of a finished product, wherein the finished product has a red or red-like color derived from the ingredient. Alternatively and/or additionally, the ingredient is part of a finished product, wherein the finished product has a meat or meat-like flavor derived from the ingredient. Alternatively and/or additionally, the ingredient is part of a finished product, wherein the finished product Hasan appearance of blood derived from the ingredient. In some embodiments, the finished product is an ingredient for a burger, a fish-altemative, a sausage, a kebab, a filet, a ground meat-like product or a meatball. In some embodiments, the edible composition is part of a finished product and wherein the finished product is an animal feed.
[0014] In some embodiments, the edible ingredient is combined with a protein source, a fat source, a carbohydrate, a starch, a thickener, a vitamin, a mineral, or any combination thereof. In some embodiments, the protein source is textured wheat protein, textured soy protein, fungal protein or algal protein. In such embodiments, it is contemplated that the finished product is free of animal proteins. In some embodiments, the fat source comprises at least one of refined coconut oil or sunflower oil. In some embodiments, the edible composition further comprises at least one of potato starch, methylcellulose, water, and a flavor, wherein the flavor is selected at least one of yeast extract, garlic powder, onion powder, and salt.
[0015] Another aspect of the disclosure includes a meat substitute comprising the composition or the edible ingredient as described herein. In some embodiments, the meat substitute further comprises (a) 0.0l%-5% (by weight of the meat replica matrix) of a non- animal protoporphyrin IX, (b) a compound selected from glucose, ribose, fructose, lactose, xylose, arabinose, glucose-6-phosphate, maltose, and galactose, and any combination thereof, (c) at least 1.5 mM of a compound selected from cysteine, cystine, thiamine, methionine, and any combination thereof, and (d) one or more proteins selected from the group consisting of plant proteins, fungal proteins and algal proteins. Preferably, the meat substitute is a ground beef-like food product that contains no animal product; wherein cooking the ground beef-like food product results in the production of at least two volatile compounds which have a beef- associated aroma.
[0016] Another aspect of the disclosure includes a method of producing a protoporphyrin IX composition. The method includes steps of growing an algae population comprising an algae that is a protoporphyrin IX over-producer; and isolating a protoporphyrin IX composition from the culture. In some embodiments, the step of growing comprises culturing the algae culture in an aerobic fermentation condition. In some embodiments, the algae contains a chloroplast. In such embodiment, biosynthesis of the protoporphyrin IX occurs in the chloroplast.
[0017] In some embodiments, the algae is deficient for its ability to produce chlorophyll. Alternatively and/or additionally, the algae is deficient for the ability to produce a functional Mg-chelatase enzyme. Alternatively and/or additionally, the algae is reduced in or lacks ChlDl, ChlD2 or ChlDH. Alternatively and/or additionally, the algae is reduced in or lacks a functional light dependent protochlorophyllide. Alternatively and/or additionally, the algae is reduced in or lacks a functional light independent protochlorophyllide. Alternatively and/or additionally, the algae is reduced in or lacks ChlB, ChlL, or ChlN. Alternatively and/or additionally, the algae overexpresses one or more of glutamyl-tRNA reductase, glutamate- 1- semialdehyde aminotransferase, ALA dehydratase, porphobilinogen deaminase, UPG III synthase, UPG III decarboxylase, CPG oxidase, and PPG oxidase. [0018] In some embodiments, the algae is generated by mating and wherein the generated strain is red or red-like in color. Alternatively and/or additionally, the algae is generated by mutagenesis. In some embodiments, the algae is red or red-like in color. In some
embodiments, the isolated protoporphyrin IX composition is an algae biomass. In such embodiment, it is contemplated that the algae biomass is fractionated. Alternatively and/or additionally, the algae biomass is fractionated to produce a protein-enriched fraction comprising protoporphyrin IX.
[0019] In some embodiments, the isolated protoporphyrin IX composition is isolated from extracellular media of the algae culture. Alternatively and/or additionally, the isolated protopophyrin IX composition is isolated away from algae protein. In some embodiments, the algae is deficient for carotenoids. In some embodiments, the algae is a Chlamydomonas sp. In some embodiments, the algae is a Chlamydomonas reinhardtii. In some embodiments, the Chlamydomonas sp. is strain CC-125 deposited to the University of Minnesota
Chlamydomonas collection center or a derivative thereof.
[0020] In some embodiments, progeny of a protoporphyrin IX overexpressing algae strain grows faster than its parental strain following a mating with another algae. Alternatively and/or additionally, the protoporphyrin IX algae is a strain produced by mating a strain deficient for carotenoids with a strain exhibiting a red or red-like color. Alternatively and/or additionally, the protoporphyrin IX overexpressing algae is generated by mutagenesis of a first starting strain and selection of a second strain that grows faster in the dark than the first starting strain. Alternatively and/or additionally, the protoporphyrin IX algae is generated by mutagenesis of a first strain and selection of a second strain that lacks one or more carotenoids from the mutated first strain.
[0021] In some embodiments, the algae lacks a functional ferrocheletase enzyme.
Alternatively and/or additionally, the algae is reduced in the amount of, or activity of, a ferrocheletase enzyme. Alternatively and/or additionally, the algae is reduced in the amount of or lacks heme as compared to a wildtype strain.
[0022] In some embodiments, the method further comprises steps of a) culturing the algae strain under a dark condition, wherein the strain does not produce or is reduced in the production of chlorophyll, and (b) collecting a portion of the algae culture that is red or red- like in color to produce the protoporphyrin IX composition. Preferably, the algae is a Chlamydomonas sp. In some embodiments, the algae is a Chlamydomonas reinhardtii. In some embodiments, the algae exhibits a red or red-like color when grown in the dark condition.
[0023] In some embodiments, the collected portion is extracellular media from the algae culture. Alternatively and/or additionally, the collected portion is a biomass or fractionated biomass from the algae culture. In some embodiments, the algae is grown in an aerobic fermentation condition. Alternatively and/or additionally, the algae is grown to a density greater than about lOg/L, 20 g/L, 30 g/L, 40g/L, 50g, L, 75 g/L, lOOg/L, 125 g/L, or l50g/L. Alternatively and/or additionally, the algae is grown with acetate as a reduced carbon source. Alternatively and/or additionally, wherein the algae is grown with sugar as a reduced carbon source. Alternatively and/or additionally, the algae culture is supplemented with iron during the culturing step. In some embodiments, the algae culture is inoculated at a density greater than about 0.1 g/L, 1.0 g/L, 5.0 g/L, 10 g/L, 20 g/L, 50 g/L, 80 g/L, or 100 g/L.
[0024] In some embodiments, the method further comprises fractionating the collected portion, wherein the fractionating removes from the collected portion substantially all or most of a component selected from the group consisting of carotenoids, starch, and protein.
Alternatively and/or additionally, the method further comprises fractionating the collected portion, wherein the fractionating removes from the collected portion substantially all or most of heme, heme-binding protein or a combination thereof. Alternatively and/or additionally, the method further comprises fractionating the collected portion, wherein the fractionating produces a protein-enriched fraction.
[0025] In some embodiments, the algae lacks or is reduced in one or more of magnesium chelatase, magnesium protoporphyrinogen IX, protochlorophyllide, chlorophyllide, and chlorophyll. Alternatively and/or additionally, the algae lacks or is reduced in ferrocheletase. In some embodiments, the algae is not a transgenic strain.
[0026] Another aspect of the disclosure includes a clean meat product produced by the method described herein, and the process further comprises combining the collected portion with a clean meat manufacturing composition, wherein the collected portion provides a red or red-like color to the clean meat product. In some embodiments, the collected portion is a PPIX-enriched fraction or purified PPIX. [0027] Another aspect of the disclosure includes an edible ingredient produced by the method described herein, and the protoporphyrin IX composition confers a meat or meat-like flavor, texture, odor or any combination thereof to the edible ingredient. In some embodiments, the edible ingredient is incorporated in a finished product selected from the group consisting of a beef-like food product, a fish-like product, a chicken-like product, a pork-like product and a meat replica. Alternatively and/or additionally, the edible ingredient is vegan, vegetarian or gluten-free. Alternatively and/or additionally, the edible ingredient is free of animal proteins. Alternatively and/or additionally, the edible ingredient does not contain any genetically modified components.
[0028] Another aspect of the disclosure includes a protoporphyrin IX-containing composition produced by the method as described herein. In some embodiments, the composition does not contain a detectable level of heme, heme-binding protein or a combination thereof.
BRIEF DESCRIPTION OF THE DRAWINGS
[0029] FIG. 1 is a pictorial diagram showing an exemplary pathway for the production of heme in algae. This exemplary pathway can be used by wildtype algae to produce chlorophyll, but it can also be used to generate protoporphyrin IX (PPIX).
[0030] FIG. 2 is a pictorial diagram showing an exemplary fractionation of algae overexpressing PPIX, showing the rich red color of the extract.
[0031] FIG. 3 is a pictorial diagram showing burgers created with O.Olg, 0.1 g, 1 0g, and 5.0g of the PPIX enriched algae.
[0032] FIG. 4 is a pictorial diagram showing ingredient mixes of the plant-based burger ingredients with no heme-enriched algae, with the addition of PPIX-enriched algae, or the ingredients with the addition of heme-enriched algae shaped into a burger before and after cooking.
[0033] FIG. 5 is a pictorial diagram showing an example of PPIX-enriched meatless “tuna”.
[0034] FIG. 6 shows a portion of sequence alignments of a wild type green algae and a red-algae with a mutation in CHLH gene (upper sequence (Seq l) is a partial nucleic acid sequence (residues 1621-1679 of SEQ ID NO: 27) and a partial amino acid sequence (residues 451-460 of SEQ ID NO: 28) of CHLH gene of green algae, and lower sequence (Seq_2) is a partial nucleic acid sequence (residues 1621-1680 of SEQ ID NO: 129) and partial amino acid sequence (residues 451-460 of SEQ ID NO: 152) of CHLH gene of red algae has a mutation (asterisk)). As shown, the wild-type CHLH nucleic acid sequence (SEQ ID NO: 27) has an insertion of a thiamine at position 1678 resulting in a change of the wild- type CHLH amino acid sequence of SEQ ID NO: 28 of a proline to a serine at amino acid position 560.
DETAILED DESCRIPTION
[0035] Before the present compositions and methods are described, it is to be understood that this invention is not limited to particular compositions, methods, and experimental conditions described, as such compositions, methods, and conditions may vary. It is also to be understood that the terminology used herein is for purposes of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention will be limited only in the appended claims. As used in this specification and the appended claims, the singular forms“a”,“an”, and“the” include plural references unless the context clearly dictates otherwise. Thus, for example, references to“the method” includes one or more methods, and/or steps of the type described herein which will become apparent to those persons skilled in the art upon reading this disclosure and so forth. Furthermore, to the extent that the terms“including”,“includes”,“having”,“has”, with”, or variants thereof are used in either the detailed description and/or the claims, such terms are intended to be inclusive in a manner similar to the term“comprising.”
[0036] The term“about” or“approximately” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, e.g., the limitations of the measurement system. For example,“about” can mean within 1 or more than 1 standard deviation, per the practice in the given value. Where particular values are described in the application and claims, unless otherwise stated the term“about” should be assumed to mean an acceptable error range for the particular value.
[0037] As used herein,“a deficiency in” or the“lack of’, or“reduction of’, one or more genes and/or enzymes include, for example, mutation or deletion of the gene sequence, a reduction in or lack in the expression from a gene (RNA and/or protein) and/or a lack of accumulation or stability of a gene product (RNA and/or protein).
[0038] As used herein,“overexpresses” and“overexpression” of an enzyme or gene include, for example, an increase in expression from a gene (RNA and/or protein) and/or an increase in accumulation or stability of a gene product (RNA and/or protein). Such overexpression can include alterations to the regulatory region(s) and/or to the gene sequence, as well as copy number, genomic position and post-translational modifications.
[0039] As used herein, the term“engineered algae” is used to refer to an algae that contains one or more genetic modifications. In some cases, an engineered algae is also a recombinantly modified organism when it incorporates heterologous nucleic acid into its genome through recombinant technology. In other cases, an engineered algae is not a recombinantly modified organism (for example when it is modified through UV, chemical or radiation mutagenesis). In some cases an algae that is not a recombinantly modified organism is referred to as non-GMO, and components from such algae can be referred to as non-GMO components.
[0040] As used herein, the term“genetic modification” is used to refer to any
manipulation of an organism’s genetic material in a way that does not occur under natural conditions. A genetic modification can include modifications that are made through mutagenesis (such as with UV light, X-rays, gamma irradiation and chemical exposure). A genetic modification can include gene editing. In some cases, genetic modifications can be made through recombinant technology. As used herein,“recombinantly modified organism” is used to refer to an organism that incorporates heterologous nucleic acid (e.g., recombinant nucleic acid) into its genome through recombinant technology. Methods of performing such manipulations are known to those of ordinary skill in the art and include, but are not limited to, techniques that make use of vectors for transforming cells with a nucleic acid sequence of interest. Included in the definition are various forms of gene editing in which DNA is inserted, deleted or replaced in the genome of a living organism using engineered nucleases, or“molecular scissors.” These nucleases create site-specific double-strand breaks (DSBs) at desired locations in the genome. The induced double-strand breaks are repaired through nonhomologous end-joining (NHEJ) or homologous recombination (HR), resulting in targeted mutations (i.e.. edits). [0041] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the invention, the preferred methods and materials are now described.
[0042] Provided herein are methods to select, grow and to incorporate algae
overexpressing the molecule, protoporphyrin IX (PPIX), into food and animal feed ingredients and products. Such products can include non-genetically modified and plant- based alternative foods. Algae are known for producing many compounds that result in these aquatic organisms being various colors. These compounds include, but are not limited to, chlorophyll which makes algae green, beta-carotene which makes algae appear yellow or orange, astaxanthin which makes algae appear red or other various pigments such as phycocyanin which make algae blue. While each of these previously mentioned compounds has been added to food products, there are to date no products that incorporate an algae over producing PPIX to impart a red color and/or a meaty taste and smell.
[0043] Provided herein are strains, methods and compositions that employ algae overproducing PPIX. In some embodiments, the algae strain when grown is red or red-like in color. As used herein, in some embodiments, red-like color can be any color with a wavelength between 590 nm to 750 nm or any mixture of the color. Alternatively and/or additionally, in some embodiments, red-like color can be defined as any color in RGB (r.g.b) having r value between 255 and 80 with g or b values between 0 and 80. In some
embodiments, a preparation made from the algae culture overproducing PPIX, imparts a pink or red color when incorporated into food and other edible products. In some embodiments, a preparation made from the algae culture overproducing PPIX, imparts a“meaty” flavor, smell and/or texture when incorporated into food and other edible products.
[0044] Without being bound by theory, the heme pathway is a biochemical pathway that branches from the chlorophyll biochemical pathway, as shown in FIG. 1. In short, this pathway starts with a glutamate tRNA which is converted to 5-aminolaevulinic acid (ALA) by a GlutRNA reductase and a GSA amino transferase. Next, ALA is converted to porphobilinogen by ALA dehydratase. Next, porophobilinogen is converted to
hydroxymethylbilane by pophobilinogen deaminase. Next, hydroxymethylbilane is converted to uroporphyrinogen III by UPG III synthase. Next, uroporphyrinogen III is converted to coprophyrinogen by UPG III decarboxylase. Next, coprophyrinogen is converted to protoporphyringen IX by CPG oxidase. Next, protoporphyrinogen IX is converted to protoporphyrin IX by PPG oxidase. Protoporphyrin IX can be shuttled to the chlorophyll production pathway or towards heme B. Finally, protoporphyrin IX is converted to heme B by the enzyme ferrochelatase which attaches iron to protoporphyrin IX.
[0045] By reducing metabolic flux towards chlorophyll, it is possible to increase metabolic flux towards PPIX, as well as heme B. By reducing or eliminating ferrocheletase, the pathway produces PPIX but the conversion from PPIX to heme is reduced or eliminated.
[0046] In some embodiments herein, the algae strains used in the methods and compositions produced therewith are reduced in metabolic flux towards chlorophyll and increased in metabolic flux towards heme B. In some embodiments herein, an engineered algae strain contains a genetic modification in ferrocheletase, such as in one or more of the nucleotide sequence (e.g., SEQ ID NO: 7), and/or amino acid sequence (e.g., SEQ ID NO: 8), and includes genetic modifications in one or more of the regulatory regions, such as those of SEQ ID NOs: 114, 115, exons, such as those of SEQ ID NOs: 116-122, and introns, such as those of SEQ ID NOs: 123-128.
[0047] In some embodiments, the algae strain is one where chlorophyll and carotenoid synthesis is decreased. In some embodiments, the algae strain is deficient or reduced in the amount of chlorophyll. In some embodiments, the algae strain is deficient or reduced in the function, amount of, or activity of, ferrocheletase by at least 10%, by at least 20%, by at least 30%, by at least 40%, by at least 50%, compared to the wild type algae. In some
embodiments, the algae strain is deficient or reduced in the amount of heme B that accumulates, and the strain is increased in accumulation of PPIX. In some embodiments, the algae strain is red or red-like in color.
[0048] In some embodiments, the algae strain is deficient for one or more enzymes in the chlorophyll biosynthesis pathway. Such deficiencies include, but are not limited to, gene deletions, mutations and other alterations that result in a lack expression of the enzyme or a deficiency in the functionality of the enzyme. In some embodiments, the algae strain is deficient in magnesium chelatase which is the first step in converting protoporphyrin IX to chlorophyll. In some embodiments, the algae strain is deficient for light dependent protochlorophyllide which converts protochlorophyllide to chlorophyllide. In some embodiments, the algae strain is deficient for a light independent protochlorophyllide reductase which converts protochlorophyllide to chlorophyllide in the dark. In some embodiments, the algae strain is deficient for one or more of ChlB, ChlL, or ChlN. In some embodiments, the algae strain is lacking or reduced in one or more of magnesium chelatase, magnesium protoporphyrin IX, protochlorophyllide, chlorophyllide, and chlorophyll.
[0049] In some embodiments, the algae strain is deficient for one or more of the magnesium chelatase subunits CHLD, CHLH and CHLI. These subunits are also referred to by the gene names, CHLD 1 (alternatively written as CH1D1), corresponding to the CHLD subunit, CHLH1 (alternatively written as CH1H1), corresponding to the CHLH subunit, and CHLI1 and CHLI2, corresponding to the CHLI subunit, encoded by two genes, CHLH and CHLI2 (alternatively written as CH1I1 and CH1I2).
[0050] In some embodiments, the algae strain is deficient for one or more of CHLD1, CHLH1, CHLH, CHLI2 or portions thereof (including genetic modification in one or more of intron, exon, regulatory regions, or full gene sequences, such as a genetic modification to one or more of SEQ ID NOs: 45-69, 70-88, 89-113, or 130-150. For example, one of the red algae strain has genetic modification in CHLH locus. The modification deletes a single base pair in CHLH as compared to a green strain, causing a frameshift in the CHLH open reading frame and/or generate a stop codon such that the protein is translated into a truncated form. The sequence comparison is shown in FIG. 6 (upper sequence (Seq l) is a partial nucleic acid sequence (residues 1621-1679 of SEQ ID NO: 27) and a partial amino acid sequence (residues 451-460 of SEQ ID NO: 28) of CHLH gene of green algae, and lower sequence (Seq_2) is a partial nucleic acid sequence (residues 1621-1680 of SEQ ID NO: 129) and partial amino acid sequence (residues 451-460 of SEQ ID NO: 152) of CHLH gene of red algae has a mutation (asterisk)). The nucleic acid sequences of additional genes that may be altered in such algae strains are provided herein.
[0051] In some embodiments, an engineered algae strain for use with the methods and compositions herein includes a generic modification in a ferrocheletase gene that decreases or is deficient in production of ferrocheletase and also has a modification in one or more enxymes leading from PPIX to chlorophyll (such as CHLD, CHLH, CHLI2 and/or CHLH).
[0052] In some embodiments, the algae strain overexpresses one or more enzymes such that the balance of pathways favors PPIX production. In some embodiments, the algae strain overexpresses one or more of glutamyl-tRNA reductase, glutamyl- 1 -semialdehyde aminotransferase, ALA dehydratase, porphobilinogen deaminase, UPG III synthase, UPG III decarboxylase, CPG oxidase, and PPG oxidase. In some embodiments, the algae strain overexpresses one or more of such enzymes and is also reduced in the amount or activity of the ferrochelatase enzyme. In some embodiments, the algae strain is improved for its ability to produce ALA, a rate limiting precursor of heme B synthesis, and optionally, is reduced in the amount or activity of the ferrochelatase enzyme. In some embodiments, the algae strain is deficient for its ability to produce a functional ferrochelatase gene, the enzyme responsible for the conversion of protoporphyrin IX to heme B. In some embodiments, the algae strain is improved for its ability to produce UPG III synthase, UPG III decarboxylase, CPG oxidase, or PPG oxidase. In some embodiments, the algae strain has an increased amount of protoporphyrin IX as compared to a wildtype strain.
[0053] In some embodiments, the algae strain produces carotenoids or precursors of carotenoids. Without being bound by theory, carotenoids confer color and can have an impact on the visual appearance of a plant-based alternative. Exemplary carotenoids include, but are not limited to, gamma-carotene, beta-carotene, beta cryptoxanthin, zeaxanthin,
autheraxanthin, lutein, prolycopene and lycopene.
[0054] In some embodiments, the algae strain is deficient for carotenoids or precursors of carotenoids. Deficiencies in carotenoid biosynthesis can occur due to mutations, such as mutations that impact carotenoid biosynthesis, for example, mutations in the phytoene synthase gene.
[0055] In some embodiments, the algae strain for use in the methods herein and for making PPIX-containing compositions is selected or identified based on one or more phenotypes and/or genotypes. In some embodiments, the algae strain for overproducing PPIX can be created through mating processes. In some embodiments, the algae strain for overproducing PPIX can be created through random mutagenesis, such as ultra violet mutagenesis. In some embodiments, the algae strain for overproducing PPIX can be generated through chemical mutagenesis with a compound that results in DNA alterations.
[0056] In some embodiments, modifications can be created through gene editing such as precisely engineered nuclease targeting to alter the expression of one or more components, such as by CRISPR-CAS nucleases. Such nucleases can be used to create insertions, deletions, mutations and replacements of one or more nucleotides or regions of nucleotides to modify the expression of one or more pathway enzymes in the pathway to reduce chlorophyll and/or to increase the production or accumulation of PPIX. Subsequent to the creation of the modification, the algae strain is grown and/or mated such that the nuclease and associated guide nucleic acids are removed, and the algae strain that remains does not retain the nuclease and associated editing system. In some embodiments, a nuclease such as the CRISPR-CAS nuclease is used to make a modification to a component of the chlorophyll pathway such that chlorophyll expression and/or accumulation is reduced or abrogated. In some embodiments, a nuclease such as the CRISPR-CAS nuclease is used to make a modification to a component of the chlorophyll pathway such that PPIX expression and/or accumulation is increased. In some embodiments, a nuclease such as the CRISPR-CAS nuclease is used to make a genetic modification in the gene encoding for ferrocheletase, such as a modification in one or more of SEQ ID NOs: 114-128 that reduces expression or abrogates expression of the gene, or a modification that abrogates, truncates or causes a frame shift in the gene encoding the enzyme, such as in SEQ ID NOs: 116-122, and/or a modification that alters or truncates the protein expressed such as an alteration in amino acid SEQ ID NO: 8. In some embodiments, a nuclease such as the CRISPR-CAS nuclease is used to make a modification in one or more of CHLD, CHLI1, CHLI2 or CHLH1 resulting in a PPIX-enriched algae strain. Such modifications are made by designing guide RNAs with modifications to one or more of SEQ ID NOs: 45-113, 130-150 or 153 to include one or more point mutations, insertions, deletions or combinations thereof. In some embodiments, such genetic modifications in more than one target sequence, such as those in a ferrocheletase sequence and in a another chlorophyll pathway sequence (e.g., CHLD, CHLI1, CHLI2 or CHLH1) are combined either by concurrent or sequential rounds of nuclease engineering and/or by mating engineered algae strains containing the genetic modifications.
[0057] There are several families of engineered nucleases used in gene editing, for example, but not limited to, meganucleases, zinc finger nucleases (ZFNs), transcription activator-like effector-based nucleases (TALEN), the CRISPR-Cas system, and ARCUS. However, it should be understood that any known gene editing system utilizing engineered nucleases may be used in the methods described herein. Thus, in some embodiments, the algae strain overproducing PPIX can be genetically modified by using techniques such as a CRISPR-Cas system (e.g., CRISPR-CAS9) or by the use of zinc-finger nucleases. [0058] CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) is an acronym for DNA loci that contain multiple, short, direct repetitions of base sequences. The prokaryotic CRISPR/Cas system has been adapted for use as gene editing (silencing, enhancing or changing specific genes) for use in eukaryotes (see, for example, Cong,
Science, 15:339(6121):819-823 (2013) and Jinek, et al, Science, 337(6096):8l6-2l (2012)). By transfecting a cell with elements including a Cas gene and specifically designed
CRISPRs, nucleic acid sequences can be cut and modified at any desired location. Methods of preparing compositions for use in genome editing using the CRISPR/Cas systems are described in detail in US Pub. No. 2016/0340661, US Pub. No. 2016/0340662, US Pub. No. 2016/0354487, US Pub. No. 2016/0355796, US Pub. No. 2016/0355797, and WO
2014/018423, which are specifically incorporated by reference herein in their entireties.
[0059] Zinc-finger nucleases (ZFNs) are artificial restriction enzymes generated by fusing a zinc finger DNA-binding domain to a DNA-cleavage domain. Zinc finger domains can be engineered to target specific desired DNA sequences and this enables zinc-finger nucleases to target unique sequences within complex genomes. By taking advantage of endogenous DNA repair machinery, these reagents can be used to precisely alter the genomes of higher organisms. The most common cleavage domain is the Type IIS enzyme Fokl. Fokl catalyzes double-stranded cleavage of DNA, at 9 nucleotides from its recognition site on one strand and 13 nucleotides from its recognition site on the other. See, for example, U.S. Pat. Nos. 5,356,802; 5,436,150 and 5,487,994; as well as Li et al. Proc., Natl. Acad. Sci. USA 89 (l992):4275-4279; Li et al. Proc. Natl. Acad. Sci. USA, 90:2764-2768 (1993); Kim et al.
Proc. Natl. Acad. Sci. USA. 91:883-887 (l994a); Kim et al. J. Biol. Chem. 269:31,978-31,982 (l994b), all of which are incorporated herein by reference. One or more of these enzymes (or enzymatically functional fragments thereof) can be used as a source of cleavage domains.
[0060] Methods for selection of algae include, but are not limited to, genetic screening or phenotypic screening for deficiencies, mutations and changes in the chlorophyll biosynthesis pathway and/or chlorophyll accumulation, genetic screening or phenotypic screening for increased expression and/or accumulation of PPIX, PPIX biosynthesis intermediates and heme biosynthesis enzymes. In some embodiments, the algae strain for use in the methods herein and for making PPIX-containing compositions is selected or identified based on its spectral profile and/or its red or red-like color. In some embodiments, the algae for use in the methods herein and for making PPIX-containing compositions is selected or identified based on its growth rate in dark conditions. In some embodiments, the selection is based on growth rate in dark conditions and the appearance or enhancement of a red or red-like color when grown in dark conditions. In some embodiments, an algae strain is selected which is deficient in or reduced in the amount of carotenoids produced or accumulated.
[0061] In some embodiments, algae strains are mated to combine or enhance
characteristics that contribute to PPIX production, PPIX accumulation, reduction in chlorophyll and/or reduction in carotenoids. In some embodiments, an algae strain that has fast growth under dark conditions (e.g., faster than a wildtype strain) is mated with an algae strain that exhibits a red or red-like color. Thus, such algae strain is not a transgenic strain. In some embodiments, an algae strain deficient for carotenoid production or accumulation is mated with an algae strain exhibiting a red or red-like color. It is contemplated that such generated algae is a protoporphyrin IX overexpressing algae strain grows faster than its parental strain following a mating with another algae.
[0062] In some embodiments, an algae strain is mutagenized and then a new strain is selected or identified that exhibits one or more characteristics of increased PPIX production, PPIX accumulation, reduction in chlorophyll and/or reduction in carotenoids. In some embodiments, an algae strain is generated by mutagenesis of a first starting strain and selection of a second strain that grows faster in the dark than the first starting strain. In some embodiments, an algae strain is generated by mutagenesis of a first starting strain and selection of a second strain that lacks one or more carotenoids.
Algae for use in the Compositions and Methods
[0063] In the compositions and methods provided herein for producing PPIX and PPIX- containing compositions, algae strains that have a PPIX biosynthesis pathway are employed. In some embodiments, the algae strain for overproducing PPIX is a Chlorophyta (green algae). In some embodiments, the green algae is selected from the group consisting of Chlamydomonas, Dunaliella, Haematococcus, Chlorella, and Scenedesmaceae . In some embodiments, the Chlamydomonas is a Chlamydomonas reinhardtii. In varying
embodiments, the green algae can be a Chlorophycean, a Chlamydomonas, C. reinhardtii, C. reinhardtii l37c, or a psbA deficient C. reinhardtii strain. In some embodiments, the selected host is Chlamydomonas reinhardtii, such as in Rasala and Mayfield, Bioeng Bugs. (2011) 2(l):50-4; Rasala, et al., Plant Biotechnol J. (2011) May 2, PMID 21535358; Coragliotti, et aI., MoI Biotechnol. (2011) 48(l):60-75; Specht, et al., Biotechnol Lett. (2010) 32(10): 1373- 83; Rasala, et al., Plant Biotechnol J. (2010) 8(6):7l9-33; Mulo, et al., Biochim Biophys Acta. (2011) May 2, PMID:2l565l60; and Bonente, et al., Photosynth Res. (2011) May 6, PMID:2l547493; US Pub. No. 2012/0309939; US Pub. No. 2010/0129394; and Intl. Pub.
No. WO 2012/170125. All of the foregoing references are incorporated herein by reference in their entirety for all purposes.
[0064] In some embodiments, the algae strain for overproducing PPIX is a single-celled algae. Illustrative and additional microalgae species of interest include without limitation,
Achnanthes orientalis, Agmenellum, Amphiprora hyaline, Amphora coffeiformis, Amphora coffeiformis linea, Amphora coffeiformis punctata, Amphora coffeiformis taylori, Amphora coffeiformis tenuis, Amphora delicatissima, Amphora delicatissima capitata, Amphora sp., Anabaena, Ankistrodesmus, Ankistrodesmus falcatus, Boekelovia hooglandii, Borodinella sp., Botryococcus braunii, Botryococcus sudeticus, Carteria, Chaetoceros gracilis, Chaetoceros muelleri, Chaetoceros muelleri subsalsum, Chaetoceros sp., Chlamydomonas sp.,
Chlamydomonas reinhardtii, Chlorella anitrata, Chlorella Antarctica, Chlorella
aureoviridis, Chlorella Candida, Chlorella capsulate, Chlorella desiccate, Chlorella ellipsoidea, Chlorella emersonii, Chlorella fusca, Chlorella fusca var. vacuolata, Chlorella glucotropha, Chlorella infusionum, Chlorella infusionum var. actophila, Chlorella infusionum var. auxenophila, Chlorella kessleri, Chlorella lobophora (strain SAG 37.88), Chlorella luteoviridis, Chlorella luteoviridis var. aureoviridis, Chlorella luteoviridis var. lutescens, Chlorella miniata, Chlorella minutissima, Chlorella mutabilis, Chlorella nocturna, Chlorella parva, Chlorella photophila, Chlorella pringsheimii, Chlorella protothecoides, Chlorella protothecoides var. acidicola, Chlorella regularis, Chlorella regularis var.
minima, Chlorella regularis var. umbricata, Chlorella reisiglii, Chlorella saccharophila, Chlorella saccharophila var. ellipsoidea, Chlorella salina, Chlorella simplex, Chlorella sorokiniana, Chlorella sp., Chlorella sphaerica, Chlorella stigmatophora, Chlorella vanniellii, Chlorella vulgaris, Chlorella vulgaris, Chlorella vulgaris f. tertia, Chlorella vulgaris var. autotrophica, Chlorella vulgaris var. viridis, Chlorella vulgaris var. vulgaris, Chlorella vulgaris var. vulgaris f. tertia, Chlorella vulgaris var. vulgaris f. viridis, Chlorella xanthella, Chlorella zoflngiensis , Chlorella trebouxioides, Chlorella vulgaris, Chlorococcum infusionum, Chlorococcum sp. , Chlorogonium, Chroomonas sp., Chrysosphaera sp., Cricosphaera sp., Crypthecodinium cohnii, Cryptomonas sp., Cyclotella cryptica, Cyclotella meneghiniana, Cyclotella sp., Dunaliella sp., Dunaliella bardawil, Dunaliella bioculata, Dunaliella granulate, Dunaliella maritime, Dunaliella minuta, Dunaliella parva, Dunaliella peircei, Dunaliella primolecta, Dunaliella salina, Dunaliella terricola, Dunaliella tertiolecta, Dunaliella viridis, Dunaliella tertiolecta, Eremosphaera viridis, Eremosphaera sp.,
Ellipsoidon sp., Euglena, Franceia sp., Fragilaria crotonensis, Fragilaria sp., Gleocapsa sp., Gloeothamnion sp., Hymenomonas sp., Isochrysis aff. galbana, Isochrysis galbana,
Lepocinclis, Micractinium, Micractinium (UTEX LB 2614), Monoraphidium minutum, Monoraphidium sp., Nannochloris sp., Nannochloropsis salina, Nannochloropsis sp., Navicula acceptata, Navicula biskanterae, Navicula pseudotenelloides, Navicula pelliculosa, Navicula saprophila, Navicula sp., Nephrochloris sp., Nephroselmis sp., Nitschia communis, Nitzschia alexandrina, Nitzschia communis, Nitzschia dissipata, Nitzschia frustulum, Nitzschia hantzschiana, Nitzschia inconspicua, Nitzschia intermedia, Nitzschia microcephala, Nitzschia pusilla, Nitzschia pusilla elliptica, Nitzschia pusilla monoensis, Nitzschia quadrangular, Nitzschia sp., Ochromonas sp., Oocystis parva, Oocystis pusilla, Oocystis sp., Oscillatoria limnetica, Oscillatoria sp., Oscillatoria subbrevis, Pascheria acidophila,
Pavlova sp., Phagus, Phormidium, Platymonas sp., Pleurochrysis carterae, Pleurochrysis dentate, Pleurochrysis sp., Prototheca wickerhamii, Prototheca stagnora, Prototheca portoricensis , Prototheca moriformis, Prototheca zopfli, Pyramimonas sp., Pyrobotrys, Sarcinoid chrysophyte, Scenedesmus armatus, Schizochytrium, Spirogyra, Spirulina platensis, Stichococcus sp., Synechococcus sp., Tetraedron, Tetraselmis sp., Tetraselmis suecica, Thalassiosira weissflogii, and Viridiella fridericiana. In some embodiments, the algae is a Chlamydomonas species. In some embodiments, the algae is a Chlamydomonas reinhardtii. In some embodiments, the algae is a derivative of a green Chlamydomonas strain made by mutagenesis or by mating with another algae strain. In some embodiments, the Chlamydomonas sp. is strain CC-125 deposited to the University of Minnesota
Chlamydomonas collection center or a derivative thereof.
Culture methods for overproducing PPIX strains
[0065] Methods for growing algae in liquid media include a wide variety of options including ponds, aqueducts, small scale laboratory systems, and closed and partially closed bioreactor systems. Algae can also be grown directly in water, for example, in an ocean, sea, lake, river, reservoir, etc.
[0066] In some embodiments, the PPIX overproducing algae useful in the methods and compositions provided herein are grown in a controlled culture system, such as a small scale laboratory system, a large scale system, and/or a closed and partially closed bioreactor system. Small scale laboratory systems refer to cultures in volumes of less than about 6 liters, and can range from about 1 milliliter or less up to about 6 liters. Large scale cultures refer to growth of cultures in volumes of greater than about 6 liters, and can range from about 6 liters to about 200 liters, and even larger scale systems covering 5 to 2500 square meters in area, or greater. Large scale culture systems can include liquid culture systems from about 10,000 to about 20,000 liters and up to about 1,000,000 liters.
[0067] The culture systems for use with the methods for producing the compositions herein include closed structures such as bioreactors, where the environment is under stricter control than in open systems or semi-closed systems. A photobioreactor is a bioreactor which incorporates some type of light source to provide photonic energy input into the reactor. The term bioreactor can refer to a system closed to the environment and having no direct exchange of gases and contaminants with the environment. A bioreactor can be described as an enclosed, and in the case of a photobioreactor, illuminated, culture vessel designed for controlled biomass production of liquid cell suspension cultures.
[0068] In some embodiments, the algae used in the methods and for the compositions provided herein are grown in fermentation vessels. In some embodiments, the vessel is a stainless steel fermentation vessel. In some embodiments, the algae are grown in
heterotrophic conditions whereby one or more carbon sources is provided to the culture. In some embodiments, the algae are grown in aerobic and heterotrophic conditions. In some embodiments, the algae are grown to a density greater than or about lOg/L, about 20 g/L, about 30 g/L, about 40g/L, about 50g/L, about 75 g/L, about lOOg/L, about 125 g/L or about l50g/L.
[0069] In some embodiments, the algae are inoculated from a seed tank to a starting density of greater than about O.lg/L, about LOg/L, about 5.0g/L, about lO.Og/L, about 20.0g/L, about 50g/L, about 80g/L, or about lOOg/L. Once inoculated, the algae are grown heterotrophically using an aerobic fermentation process. During this process, the algae are fed nutrients to maintain their growth. In some embodiments, these nutrients include a reduced carbon source. Exemplary aerobic fermentation process and/or reduced carbon sources include, but are not limited to, acetate, glucose, sucrose, fructose, glycerol and other types of sugars (e.g., dextrose, maltose, galactose, sucrose, ribose, etc.). In some embodiments, the algae culture is supplemented with iron. [0070] In some embodiments, the algae are cultured under dark conditions. Preferably, the dark condition has a brightness of less than 1000 lux, less than 750 lux, less than 500 lux, less than 400 lux, less than 300 lux, less than 200 lux, less than 100 lux. In some embodiments, the algae cultured under dark conditions lack or are reduced in chlorophyll production at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80% compared to the algae cultured under dark conditions. In some embodiments, the algae grown under dark conditions are supplemented with one or more nutrients. In some embodiments, the algae grown under dark conditions are grown in the presence of a reduced carbon source, such as acetate, glucose, sucrose, fructose, glycerol or other types of sugars (e.g., dextrose, maltose, galactose, sucrose, ribose, etc.). In some embodiments, the algae grown under dark conditions are grown in the presence of iron or otherwise supplemented with iron.
PPIX-containing preparations and products
[0071] Algae strains and cultures overproducing PPIX such as described herein can be used in various forms and preparations. In some embodiments, a PPIX-containing composition is prepared from an algae culture overproducing PPIX, where the composition is red or red-like in color.
[0072] In some embodiments, the PPIX-containing composition is prepared from a biomass isolated from cultured algae. In some embodiments, the biomass is further fractionated to remove one or more components. In some embodiments, the biomass is fractionated to remove starch. In some embodiments, the biomass is fractionated to remove protein. In some embodiments, the biomass is fractionated or otherwise treated to remove carotenoids. In some embodiments, the biomass is fractionated or otherwise treated to enrich for certain components. In some embodiments, the fractionated or treated biomass is enriched in PPIX. In some embodiments, the fractionated or treated biomass is enriched in protein or in protein and PPIX. In some embodiments, the fractionation or treatment enhances the red or red-like color of the preparation. The fractionated or treated biomass can be enriched for protein content such that the composition is about 10% protein, greater than about 10% protein, or greater than about 20%, about 30%, about 40% or about 50% protein.
[0073] In some embodiments, the biomass is fractionated or otherwise treated to remove or reduce any heme content and optionally, to enrich for PPIX. Thus, in some embodiments, the fractionation or composition may include greater amount of PPIX than of heme by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%. Such fractionation can include separation of PPIX from heme. For example, heme-binding proteins and heme associated with proteins can be separated from PPIX which is not a protein-conjugated or protein- associated compound. Both free heme and protein-associated heme can be separated from PPIX based on heme’s association with iron. PPIX does not contain an iron moiety and as such, this feature can be used to separate PPIX from a heme-containing fraction. In some embodiments, an algae biomass herein is fractionated or otherwise treated such that the heme content is reduced, such as reduced below 1%, below 0.1%, below 0.05%, below 0.01%, below 0.001% or below a detectable level in a PPIX-containing fraction. Alternatively, an algae biomass herein is fractionated or otherwise treated such that heme-protein content is reduced, such as reduced below 1%, below 0.1%, below 0.05%, below 0.01%, below 0.001% or below a detectable level in a PPIX-containing fraction. In some embodiments, an algae biomass or fractionated biomass is produced from a strain deficient in ferrocheletase or in a strain that does not make or does not accumulate heme such that the biomass or fraction has little to no heme.
[0074] In some embodiments, the PPIX-containing composition is a PPIX-containing liquid prepared from the culture media of the cultured algae. In some embodiments, the PPIX-containing composition is prepared from PPIX found extracellularly in the algae culture (extracellular fraction). In some embodiments, the algae culture is lysed or otherwise treated to release PPIX from the cells. In some embodiments, the PPIX-containing liquid is further fractionated to remove one or more components. In some embodiments, the PPIX- containing liquid is fractionated to remove starch. In some embodiments, the PPIX- containing liquid is fractionated to remove protein. In some embodiments, the PPIX- containing liquid is fractionated or otherwise treated to remove carotenoids. In some embodiments, the PPIX-containing liquid is fractionated or otherwise treated to enrich for certain components. In some embodiments, the fractionated or treated PPIX-containing liquid is enriched in PPIX. In some embodiments, the fractionation or treatment enhances the red or red-like color of the preparation.
[0075] In some embodiments, the PPIX-containing liquid is fractionated or otherwise treated to remove or reduce any heme content and optionally, to enrich for PPIX. Such fractionation can include separation of PPIX from heme. For example, heme-binding proteins and heme associated with proteins in the liquid can be separated from PPIX which is not a protein-conjugated or protein-associated compound. Both free heme and protein-associated heme can be separated from PPIX based on heme’s association with iron. PPIX does not contain an iron moiety and as such, this feature can be used to separate PPIX from a heme- containing fraction. In some embodiments, a PPIX-containing liquid is fractionated or otherwise treated such that the heme content is reduced, such as reduced below 1%, below 0.1%, below 0.05%, below 0.01%, below 0.001% or below a level that is generally detectable in a PPIX-containing fraction. In some embodiments, a PPIX-containing liquid is produced from a strain deficient in ferrocheletase or in a strain that does not make or does not accumulate heme such that the PPIX-containing liquid has little to no heme content.
[0076] In some embodiments, the biomass or PPIX-containing composition is a PPIX- containing liquid, and/or fractionated PPIX-containing composition or a PPIX-containing liquid contains protoporphyrin IX at about 0.5%, 1.0%, 1.5%, 2.0%, 2.5%, 3.0%, 3.5%,
4.5%, 5.0%, 5.5%, 6.0%, 6.5%, 7.0%, 7.5%, 8.0%, 8.5%, 9.0%, 9.5%, 10.0% or more than 10% on a weight per total weight basis. In addition, in some embodiments, the biomass or PPIX-containing composition is a PPIX-containing liquid, and/or fractionated PPIX- containing composition or a PPIX-containing liquid contains protoporphyrin IX greater than chlorophyll content by at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, or at least 50%.
[0077] The PPIX-containing compositions, including biomass, liquid and fractionated preparations can be further processed. Such processing can include concentrating, drying, lyophilizing, and freezing. In various embodiments, the PPIX-containing compositions can be combined with additional components and ingredients, for example, to create an edible product. In some embodiments, the PPIX-containing composition confers a red or red-like color to the edible product. In some embodiments, the PPIX-containing composition confers a meat-like characteristic such as a meat-like taste, aroma and/or texture to the edible product. In some embodiments, the PPIX-containing composition provides the appearance of blood to an edible product, such as to a meat replica, a beef-like product, a chicken-like product or the like.
[0078] In some embodiments, PPIX-containing composition is a PPIX-containing liquid, and/or fractionated PPIX-containing composition or a PPIX-containing liquid provides at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9% or 10% of the protein to the edible composition. In some embodiments, PPIX-containing composition is a PPIX-containing liquid, and/or fractionated PPIX-containing composition or a PPIX-containing liquid provides greater than
5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%,
85%, 90%, 95%, 99% or 100% of the protein in the edible product. In some embodiments, PPIX-containing composition is a PPIX-containing liquid, and/or fractionated PPIX- containing composition or a PPIX-containing liquid provides a daily recommended dosage of omega-3 fatty acids or a portion thereof to the edible product, for example, at least about 5 mg, 10 mg, 15 mg, 20 mg, 25 mg, 30 mg, 35 mg, 40 mg, 45 mg, 50 mg, 55 mg, 60 mg, 65 mg, 70 mg, 75 mg, 80 mg, 85 mg, 90 mg, 95 mg, 100 mg, 125 mg, 150 mg, 175 mg, 200 mg, 250 mg, 300 mg, 350 mg, 400 mg, 450 mg or 500 mg of omega-3 fatty acids to the edible composition.
[0079] In some embodiments, PPIX-containing composition is a PPIX-containing liquid, and/or fractionated PPIX-containing composition or a PPIX-containing liquid provides at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or 100% of the daily recommended dosage of vitamin A or at least about 20 pg, 50 pg, 100 pg, 200 pg, 300 pg, 400 pg, 500 pg, 600 pg, 700 pg, 800 pg, 900 pg or 1000 pg of retinol activity equivalents (RAE) for vitamin A. In some embodiments, PPIX-containing composition is a PPIX-containing liquid, and/or fractionated PPIX- containing composition or a PPIX-containing liquid provides no more than about 2,000 pg, 2,500 pg or 3,000 pg of retinol activity equivalents (RAE) for vitamin A. Alternatively and/or additionally, PPIX-containing composition is a PPIX-containing liquid, and/or fractionated PPIX-containing composition or a PPIX-containing liquid provides at least about 5%, 10%,
15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%,
95%, 99% or 100% of the daily recommended dosage of beta-carotene. Alternatively and/or additionally, PPIX-containing composition is a PPIX-containing liquid, and/or fractionated PPIX-containing composition or a PPIX-containing liquid provides about 0.25 mg, 0.5 mg, 1 mg, 1.5 mg, 2 mg, 2.5 mg, 3 mg, 4 mg, 5, mg, 6 mg, 9 mg, 10 mg, 12 mg, or 15 mg of beta- carotene.
[0080] Alternatively and/or additionally, PPIX-containing composition is a PPIX- containing liquid, and/or fractionated PPIX-containing composition or a PPIX-containing liquid provides less than daily recommended limit for saturated fat or a portion thereof to the edible product, for example, no more than about 1%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% of the daily recommended dosage of saturated fat. Alternatively and/or additionally, PPIX-containing composition is a PPIX-containing liquid, and/or fractionated PPIX-containing composition or a PPIX-containing liquid provides no more than 0.01%, 0.05%, 0.1%, 0.2%, 0.3%, 0.4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, 1.0%, 1.2%, 1.5%, 2%, 5% or 10% of total saturated fat present in the edible composition or in the finished product made from the edible
composition.
[0081] In some embodiments, PPIX-containing compositions are combined with additional ingredients to create a meat-like product. Such meat-like products can include clean meat or cultured meat (made from animal cells grown in the laboratory or otherwise outside of an animal), plant-based and non-animal based meats (made from plant ingredients and/or ingredients not from animal sources). In some embodiments, a PPIX-containing composition made from an over-producing algae is combined with additional ingredients to create a meat-like product whereby the addition of the PPIX-containing composition confers a red or red-like color, a meat-like aroma, a meat-like taste and/or a meat-like texture to the meat-like product. In some embodiments, the meat-like features conferred by the PPIX- containing composition are conferred to the raw or uncooked product. In some embodiments, the meat-like features conferred by the PPIX -containing composition is conferred to the cooked product. Alternatively, least one of the features of meat or meat-like flavor or aroma, a meat or meat-like texture, a blood-like appearance, a meat or meat-like color are derived from the algae preparation.
[0082] In some embodiments, whole algae or fractionated algae is combined with an additional protein source in an edible composition. For example, the protein source may be wheat protein, such as wheat protein, textured wheat protein, pea protein, textured pea protein, soy protein, textured soy protein, potato protein, whey protein, yeast extract, a fungus protein such as quom, or other plant-based protein source or any combination thereof. In some embodiments, whole algae or fractionated algae is combined with an oil or source of fat in an edible composition. For example, the oil or fat source may be coconut oil, canola oil, sunflower oil, safflower oil, com oil, olive oil, avocado oil, nut oil or other plant-based oil or fat source or any combination thereof. In some embodiments, whole algae or fractionated algae is combined with a starch or other carbohydrate source such as from potato, chickpea, wheat, soy, beans, com or other plant-based starch or carbohydrate or any combination thereof. In some embodiments, whole algae or fractionated algae is combined with a thickener in an edible composition. For example, starches such as arrowroot, cornstarch, katakuri starch, potato starch, sago, tapioca and their starch derivatives may be used as a thickener; microbial and vegetable gums used as food thickeners include alginin, guar gum, locust bean gum, konjac and xanthan gum; and proteins such as collagen and egg whites may be used as thickeners; and sugar polymers for use as thickeners include agar, methylcellulose, carboxymethyl cellulose, pectin and carrageenan. In some embodiments, whole algae or an algae fraction may be combined with vitamins and minerals in an edible composition, such as vitamin E, vitamin C, thiamine (vitamin Bl), zinc, niacin, vitamin B6, riboflavin (vitamin B2), and vitamin B12.
[0083] In some embodiments, whole algae or an algae fraction may be combined with additional ingredients such that the edible composition and/or finished product is vegetarian, vegan or gluten-free, and therefore may conform to the dietary guidelines of Jewish kosher practitioners, and halal practitioners. Thus, in some embodiments, the edible composition and/or finished product may be suitable for consumption by vegetarians, vegans, gluten-free populations, Jewish kosher practitioners, and halal practitioners. In some embodiments, whole algae or an algae fraction may be combined with additional ingredients such that the edible composition and/or finished product is GMO-free and/or does not contain any ingredients derived from genetically engineered organisms or cells.
EXEMPLARY NUMBERED EMBODIMENTS
[0084] The following embodiments recite non-limiting permutations of combinations of features disclosed herein. Other permutations of combinations of features are also
contemplated. In particular, each of these numbered embodiments is contemplated as depending from or relating to every previous or subsequent numbered embodiment, independent of their order as listed.
[0085] Embodiment 1. A composition comprising a preparation from an algae strain, wherein the algae strain overexpresses or accumulates protoporphyrin IX (PPIX). 2. The composition of embodiment 2, wherein the preparation is a biomass from the algae strain. 3. The composition of embodiment 2, wherein the preparation is a fractionated biomass from the algae strain. 4. The composition of embodiment 3, wherein the fractionated biomass comprises a PPIX-enriched fraction. 5. The composition of embodiment 4, wherein the PPIX- enriched fraction further comprises a protein-enriched fraction. 6. The composition of embodiment 1, wherein the preparation is an extracellular fraction of the algae culture. 7. The composition according to any of embodiments 1-6, wherein the preparation is red or red-like in color. 8. The composition according to any of embodiments 1-7, wherein the preparation contains a greater amount of PPIX than of heme. 9. The composition according to any of embodiments 1-8, wherein the preparation contains less than about 1%, 0.5%, 0.1%, 0.05%, 0.01%, 0.005% or 0.001% heme. 10. The composition according to any of embodiments 1-9, wherein the preparation contains less than about 1%, 0.5%, 0.1%, 0.05%, 0.01%, 0.005% or 0.001% heme-protein. 11. The composition according to any of embodiments 1-10, wherein the preparation does not contain a detectable amount of a heme-protein. 12. The composition according to any of embodiments 1-11, wherein the preparation does not contain a detectable amount of heme. 13. The composition according to any of embodiments 1-4, wherein the preparation does not contain a detectable amount of protein. 14. The composition according to any of embodiments 1-13, wherein the preparation has a protoporphyrin IX content greater than chlorophyll content. 15. The composition according to any of embodiments 1-4 and 6, wherein the preparation provides at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or 100% of the total protein content to the edible composition. 16. The composition according to any of embodiments 1- 15, wherein the preparation provides vitamin A, beta carotene or a combination thereof to the composition. 17. The composition of embodiment 16, wherein the vitamin A, the beta carotene or the combination thereof is at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or 100% of the daily recommended requirement. 18. The composition according to any of embodiments 1- 17, wherein the preparation provides less than about 0.01%, 0.05%, 0.1%, 0.2%, 0.3%, 0.4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, 1.0%, 1.2%, 1.5%, 2%, 5% or 10% of total saturated fat present in the composition. 19. The composition according to any of embodiments 1-18, wherein the preparation provides at least about 5 mg, 10 mg, 15 mg, 20 mg, 25 mg, 30 mg,
35 mg, 40 mg, 45 mg, 50 mg, 55 mg, 60 mg, 65 mg, 70 mg, 75 mg, 80 mg, 85 mg, 90 mg, 95 mg, 100 mg, 125 mg, 150 mg, 175 mg, 200 mg, 250 mg, 300 mg, 350 mg, 400 mg, 450 mg or 500 mg of omega-3 fatty acids to the composition. 20. The composition according to any of embodiments 1-19, wherein the composition has a red or red-like color derived from the preparation. 21. The composition according to any of embodiments 1-20, wherein the composition has a meat or meat-like flavor derived from the preparation. 22. The composition according to any of embodiments 1-21, wherein the composition has a meat or meat-like texture derived from the preparation. 23. The composition according to any of embodiments 1-22, wherein the algae is a Chlamydomonas sp. 24. The composition of embodiment 23, wherein the algae is Chlamydomonas reinhardtii. 25. The composition of embodiment 23, wherein the Chlamydomonas sp. is strain CC-125 deposited to the
University of Minnesota Chlamydomonas collection center or a derivative thereof. 26. The composition of embodiment 23, wherein the algae has reduced or absence of ferrocheletase activity or expression of ferrocheletase.
[0086] Embodiment 27. A food product comprising the composition according to any of embodiments 1-26. 28. The food product of embodiment 27, wherein the food product comprises a clean meat, a cultured meat, a synthetic meat, a plant-based meat or a non-animal cell-based meat. 29. The food product of any of embodiments 27-28, wherein the food product is selected from the group consisting of a beef-like food product, a fish-like product, a chicken-like product, a pork-like product and a meat replica. 30. The food product of any of embodiments 27-29, wherein the food product is vegan, vegetarian or gluten-free.
[0087] Embodiment 31. An edible ingredient comprising the composition according to any of embodiments 1-25. 32. The edible ingredient of embodiment 31, wherein the ingredient is part of a finished product, wherein the finished product has a red or red-like color derived from the ingredient. 33. The edible ingredient of embodiment 31, wherein the ingredient is part of a finished product, wherein the finished product has a meat or meat-like flavor derived from the ingredient. 34. The edible ingredient of embodiment 31, wherein the ingredient is part of a finished product, wherein the finished product Hasan appearance of blood derived from the ingredient. 35. The edible ingredient according to any of
embodiments 31-34, wherein the finished product is an ingredient for a burger, a sausage, a kebab, a filet, a ground meat-like product or a meatball. 36. The edible ingredient according to any of embodiments 31-34, wherein the edible composition is part of a finished product and wherein the finished product is an animal feed. 37. The edible ingredient according to any of embodiments 31-36, wherein the edible ingredient is combined with a protein source, a fat source, a carbohydrate, a starch, a thickener, a vitamin, a mineral, or any combination thereof. 38. The edible ingredient of embodiment 35, wherein the protein source is textured wheat protein, textured soy protein, fungal protein or algal protein. 39. The edible ingredient according to any of embodiments 37 or 38, wherein the finished product is free of animal proteins. 40. The edible composition of any of embodiments 37-39, wherein the fat source comprises at least one of refined coconut oil or sunflower oil. 41. The edible composition of any of embodiments 37-40, further comprising at least one of potato starch, methylcellulose, water, and a flavor, wherein the flavor is selected at least one of yeast extract, garlic powder, onion powder, and salt.
[0088] Embodiment 42. A meat substitute comprising the composition according to any of embodiments 1-26 or the edible ingredient according to any of embodiments 31-41. 43. The meat substitute of embodiment 42, further comprising: (a) 0.0l%-5% (by weight of the meat replica matrix) of a non-animal protoporphyrin IX; (b) a compound selected from glucose, ribose, fructose, lactose, xylose, arabinose, glucose-6-phosphate, maltose, and galactose, and any combination thereof; (c) at least 1.5 mM of a compound selected from cysteine, cystine, thiamine, methionine, and any combination thereof; and (d) one or more proteins selected from the group consisting of plant proteins, fungal proteins and algal proteins, wherein the meat substitute is a ground beef-like food product that contains no animal product; wherein cooking the ground beef-like food product results in the production of at least two volatile compounds which have a beef-associated aroma.
[0089] Embodiment 44. A method of producing a protoporphyrin IX composition, comprising: growing an algae population comprising an algae that is a protoporphyrin IX over-producer; and isolating a protoporphyrin IX composition from the culture. 45. The method of embodiment 44, wherein the growing comprises culturing the algae culture in an aerobic fermentation condition. 46. The method of embodiment 44 or embodiment 45, wherein the algae contains a chloroplast. 47. The method of embodiment 46, wherein biosynthesis of the protoporphyrin IX occurs in the chloroplast. 48. The method according to any of embodiments 44-47, wherein the algae is deficient for its ability to produce chlorophyll. 49. The method according to any of embodiments 44-48, wherein the algae is deficient for the ability to produce a functional Mg-chelatase enzyme. 50. The method according to any of embodiments 44-49, wherein the algae is reduced in or lacks ChlDl, ChlD2 or ChlDH. 51. The method according to any of embodiments 44-50, wherein the algae is reduced in or lacks a functional light dependent protochlorophyllide. 52. The method according to any of embodiments 44-51, wherein the algae is reduced in or lacks a functional light independent protochlorophyllide. 53. The method according to any of embodiments 44- 52, wherein the algae is reduced in or lacks ChlB, ChlL, or ChlN. 54. The method according to any of embodiments 44-53, wherein the algae overexpresses one or more of glutamyl- tRNA reductase, glutamate- 1 -semialdehyde aminotransferase, ALA dehydratase, porphobilinogen deaminase, UPG III synthase, UPG III decarboxylase, CPG oxidase, and PPG oxidase. 55. The method according to any of embodiments 44-54, wherein the algae is generated by mating and wherein the generated strain is red or red-like in color. 56. The method according to any of embodiments 44-55, wherein the algae is generated by mutagenesis. 57. The method according to any of embodiments 44-56, wherein the algae is red or red-like in color. 58. The method according to any of embodiments 44-57, wherein the isolated protoporphyrin IX composition is an algae biomass. 59. The method of embodiment 58, wherein the algae biomass is fractionated. 60. The method of embodiment 59, wherein the algae biomass is fractionated to produce a protein-enriched fraction comprising
protoporphyrin IX . 61. The method according to any of embodiments 44-57, wherein the isolated protoporphyrin IX composition is isolated from extracellular media of the algae culture. 62. The method according to any of embodiments 44-61, wherein the isolated protopophyrin IX composition is isolated away from algae protein. 63. The method according to any of embodiments 44-62, wherein the algae is deficient for carotenoids. 64. The method according to any of embodiments 44-63, wherein the algae is a Chlamydomonas sp. 65. The method according to any of embodiments 44-64, wherein the algae is a Chlamydomonas reinhardtii. 66. The method of embodiment 64, wherein the Chlamydomonas sp. is strain CC- 125 deposited to the University of Minnesota Chlamydomonas collection center or a derivative thereof. 67. The method according to any of embodiments 44-66, wherein progeny of a protoporphyrin IX overexpressing algae strain grows faster than its parental strain following a mating with another algae. 68. The method according to any of embodiments 44- 66, wherein the protoporphyrin IX algae is a strain produced by mating a strain deficient for carotenoids with a strain exhibiting a red or red-like color. 69. The method according to any of embodiments 44-66, wherein the protoporphyrin IX overexpressing algae is generated by mutagenesis of a first starting strain and selection of a second strain that grows faster in the dark than the first starting strain. 70. The method according to any of embodiments 44-66, wherein the protoporphyrin IX algae is generated by mutagenesis of a first strain and selection of a second strain that lacks one or more carotenoids from the mutated first strain.
71. The method according to any of embodiments 44-70, wherein the algae lacks a functional ferrocheletase enzyme. 72. The method according to any of embodiments 44-70, wherein the algae is reduced in the amount of, or activity of, a ferrocheletase enzyme. 73. The method according to any of embodiments 44-70, wherein the algae is reduced in the amount of or lacks heme as compared to a wildtype strain. [0090] Embodiment 74. A protoporphyrin IX-containing composition produced by the method according to any of embodiments 44-73. 75. The composition of embodiment 74, wherein the composition does not contain a detectable level of heme, heme-binding protein or a combination thereof. 76. The method according to any of embodiments 44-73, further comprising the steps of: (a) culturing the algae strain under a dark condition, wherein the strain does not produce or is reduced in the production of chlorophyll, and (b) collecting a portion of the algae culture that is red or red-like in color to produce the protoporphyrin IX composition. 77. The method of embodiment 76, wherein the algae is a Chlamydomonas sp. 78. The method of embodiment 77, wherein the algae is a Chlamydomonas reinhardtii. 79. The method according to embodiment 76, wherein the algae exhibits a red or red-like color when grown in the dark condition. 80. The method of embodiment 76, wherein the collected portion is extracellular media from the algae culture. 81. The method of embodiment 76, wherein the collected portion is a biomass or fractionated biomass from the algae culture. 82. The method of embodiment 76, wherein the algae is grown in an aerobic fermentation condition. 83. The method of embodiment 76, wherein the algae is grown to a density greater than lOg/L, 20 g/L, 30 g/L, 40g/L, 50g, L, 75 g/L, lOOg/L, 125 g/L, or l50g/L. 84. The method of embodiment 76, wherein the algae is grown with acetate as a reduced carbon source. 85. The method of embodiment 76, wherein the algae is grown with sugar as a reduced carbon source. 86. The method of embodiment 76, wherein the algae culture is supplemented with iron during the culturing step. 87. The method of embodiment 76, wherein the algae culture is inoculated at a density greater than 0.1 g/L, 1.0 g/L, 5.0 g/L, 10 g/L, 20 g/L, 50 g/L, 80 g/L, or 100 g/L. 88. The method of embodiment 76, further comprising fractionating the collected portion, wherein the fractionating removes from the collected portion substantially all or most of a component selected from the group consisting of carotenoids, starch, and protein. 89. The method of embodiment 76, further comprising fractionating the collected portion, wherein the fractionating removes from the collected portion substantially all or most of heme, heme-binding protein or a combination thereof. 90. The method of embodiment 76, further comprising fractionating the collected portion, wherein the fractionating produces a protein-enriched fraction. 91. The method of embodiment 76, wherein the algae lacks or is reduced in one or more of magnesium chelatase, magnesium protoporphyrinogen IX, protochlorophyllide, chlorophyllide, and chlorophyll. 92. The method of embodiment 76, wherein the algae lacks or is reduced in ferrocheletase. 93. The method according to any of embodiments 44-73 and 76-92, wherein the algae is not a transgenic strain. [0091] Embodiment 94. A clean meat product produced by the method according to any of embodiments 76-93, wherein the process further comprises combining the collected portion with a clean meat manufacturing composition, wherein the collected portion provides a red or red-like color to the clean meat product. 95. The clean meat product of embodiment 94, wherein the collected portion is a PPIX-enriched fraction or purified PPIX.
[0092] Embodiment 96. An edible ingredient produced by the method according to any of embodiments 44-73 and 76-93, wherein the protoporphyrin IX composition confers a meat or meat-like flavor, texture, odor or any combination thereof to the edible ingredient. 97. The edible ingredient of embodiment 96, wherein the edible ingredient is incorporated in a finished product selected from the group consisting of a beef-like food product, a fish-like product, a chicken-like product, a pork-like product and a meat replica. 98. The edible ingredient of any of embodiments 96-97, wherein the edible ingredient is vegan, vegetarian or gluten-free. 99. The edible ingredient of any of embodiments 96-98, wherein the edible ingredient is free of animal proteins. 100. The edible ingredient of any of embodiments 96- 99, wherein the edible ingredient does not contain any genetically modified components.
[0093] Embodiment 101. An engineered algae having a genetic modifications, where the genetic modification results in an accumulation of protoporphyrin IX (PPIX) in the algae as compared to an algae lacking the genetic modification. 102. The engineered algae of embodiment 101, wherein the engineered algae has reduced or absence of chlorophyll production. 103. The engineered algae of embodiments 101 or 102, wherein the algae has red or red-like color. 104. The engineered algae according to any of embodiments 101-103, wherein the algae is capable of growth on glucose as the sole carbon source. 105. The engineered algae according to any of embodiments 101-104, wherein the genetic
modification comprises a genetic alteration to chlorophyll synthesis pathway,
protoporphyrinogen IX synthesis pathway or heme synthesis pathway. 106. The engineered algae according to any of embodiments 101-105, wherein the genetic modification is associated with a deficiency in the expression of ferrocheletase. 107. The engineered algae according to any of embodiments 101-106, wherein the genetic modification comprises an alteration in one or more of CHLD, CHLI1, CHLI2 or CHLH1. 108. The engineered algae of embodiments 106 or 107, wherein the genetic modification comprises an alteration in an upstream regulatory region, a downstream regulatory region, an exon, an intron or any combination thereof. 109. The engineered algae according to any of embodiments 105-108, wherein the genetic modification comprises an insertion, a deletion, a point mutation, an inversion, a duplication, a frameshift or any combination thereof.
[0094] Embodiment 110. The engineered algae according to any of embodiments 101- 109, wherein the engineered algae has a PPIX content greater than the chlorophyll content.
11 l.The engineered algae according to any of embodiments 101-109, wherein the engineered algae has a heme content greater than the chlorophyll content. 112. The engineered algae according to any of embodiments 101-111, wherein the engineered algae has reduced production of one or more fatty acids. 113. The engineered algae according to any of embodiments 101-112, wherein the engineered algae further comprises a genetic
modification that reduces or eliminates the expression of light independent
protochlorophyllide oxidoreductase. 114. The engineered algae of embodiment 113, wherein the genetic modification comprises a mutation or deletion in one or more of ChlB, ChlL or ChlN. 115. The engineered algae according to any of embodiments 101-114, wherein the engineered algae has down-regulated expression of ferrocheletase. 116. The engineered algae according to any of embodiments 101-115, wherein the engineered algae has upregulated expression of protoporphyrinogen IX oxidase.
[0095] Embodiment 117. The engineered algae according to any of embodiments 101- 116, wherein the algae contain a recombinant or heterologous nucleic acid. 118. The engineered algae according to any of embodiments 101-117, wherein the engineered algae comprises a Chlamydomonas sp. 119. The engineered algae of embodiment 118, wherein the Chlamydomonas sp. is Chlamydomonas reinhardtii.
[0096] Embodiment 120. An edible composition comprising an algae preparation, wherein the algae preparation comprises an engineered algae of any of embodiments 101-119 or a portion thereof. 121. The edible composition of embodiment 120, wherein the edible composition comprises PPIX derived from the engineered algae. 122. The edible composition of embodiment 120, wherein the algae preparation comprises algae cells. 123. The edible composition of embodiment 120, wherein the algae preparation is a fractionated algae preparation. EXAMPLES
Example 1: Identification of PPIX-overproducing algae
[0097] Strains of algae ( Chlamydomonas reinharaUi) overexpressing PPIX were identified by their inability to produce chlorophyll. Additionally, these strains exhibited red, brown, orange or some variation of the listed color. The identified strains exhibit light sensitivity and cannot be grown in direct light greater than 10 mE m 2 s 1 for extended periods of time.
[0098] One of the identified strains was grown under fed-batch aerobic fermentation conditions where acetate is used as a reduced carbon source of nutrition for the culture. The strain was grown in a fermenter where minimal light can reach the culture. The strain was grown to a density that is greater than 50g/L and harvested via centrifugation. The harvested strain was red in color and can he added to compositions, such as food products, to confer a red, orange or brown color.
[0099] Tables 1-5 show characteristic analysis of one exemplary, identified red heme algae (Strain number: TAI114, Species name: Chlamydomonas reinhardtii).
TABLE 1: MICROBIAL ANALYSIS
TABLE 2: HEAVY METAL ANALYSIS
TABLE 3: BIOMASS ANALYSIS
TABLE 4: Porphyrin (Heme) ANALYSIS
TABLE 5: AMINO ACID COMPOSITION
Example 2: Fractionation
[0100] Ceils from a PPIX overproducing strain of Chlamydomonas reinhardtii were harvested from a fermentation culture. Cells were re-suspended in a lOmL solution (8:2 v/v solution of acetone: 1.6M HCL) and vortexed for 30 minutes. The cell debris was centrifuged and the porphyrin layer was separated from the cell debris (FIG. 2). The porphyrin fraction was then diluted 1: 10 with FkO to precipitate the porphyrins from the acetone solution. Samples were further washed with water and can be frozen at that point for further analysis. Shown in FIG. 2 is the PPIX-containing fraction after the final step.
Example 3: Preparation of a PPIX-enriched“meatless” burger
[0101] The PPIX-enriched samples were used to prepare compositions of meat-like products produced from plant based materials and algae rich in PPIX. To create a PPIX- enriched burger, ingredients were mixed in the following proportions and formed into a disc shaped algae-plant based burger: 20% or about 20% Textured wheat protein, 20% or about 20% Refined coconut oil, 3% or about 3% Sunflower oil, 2% or about 2% Potato starch,
0.5% or about 0.5% Kojac gum, 0.5% or about 0.5% Xanthan gum, 45% or about 20%water and 4-9% or about 4-9% Flavors, including yeast extract, garlic powder, onion powder, salt, and PPIX -enriched (“red”) algae. Shown in FIG. 3 are burgers created with O.Olg, 0.1 g, l.Og, and 5.0g of the PPIX enriched algae.
[0102] In this example, the composition of the PPIX-enriched algae was 4.5% PPIX, 0.5% heme, 0% chlorophyll, 24.4% protein, 9% dietary fiber, 40% starch, 0.8% omega-3-fatty acids, 3.9% other fats, 7.5% moisture, and 8.4% ash.
Example 4: Preparation of a PPIX-enriched plant-based burger
[0103] The PPIX-enriched samples was used to prepare burger compositions from plant based materials and algae rich in PPIX. To create a PPIX-enriched plant-based burger, ingredients were mixed in the following proportions and formed into a disc: 20% or about 20% Textured soy protein, 20% or about 20% Refined coconut oil, 3% or about 3%
Sunflower oil, 2% or about 2% Potato starch, 1% or about 1% methylcellulose, 45% or about 45% water and 4-9% or about 4-9% Flavors, including yeast extract, garlic powder, onion powder, salt, and PPIX-enriched (“red”) algae. Shown in FIG. 4 are the ingredient mixes of the plant-based burger ingredients with no PPIX-enriched algae (far left), with the addition of PPIX-enriched algae (second from left), the ingredients with the addition of PPIX-enriched algae shaped into a burger before and after cooking (third from left and far right photos, respectively). As shown, the addition of the PPIX-enriched algae conferred a red/red-like color (resembling a burger with animal blood) to the ingredient mix and to the burger, and this color undergoes a transition when cooked. [0104] In this example, the composition of the PPIX-enriched algae was 4.5% PPIX, 0.5% heme, 0% chlorophyll, 24.4% protein, 9% dietary fiber, 40% starch, 0.8% omega-3-fatty acids, 3.9% other fats, 7.5% moisture, and 8.4% ash.
Example 5: Preparation of a PPIX-enriched meatless“tuna”
[0105] The PPIX-enriched samples were used to prepare fish-like compositions. To create a PPIX-enriched meatless“fish”, ingredients were mixed in the following proportions: 20% Textured soy protein, 65% water and 10% Flavors and PPIX -enriched 5% (“red”) algae. Shown in FIG. 5 is a square portion of the meatless“tuna” produced.
[0106] In this example, the composition of the PPIX-enriched algae was 4.5% PPIX, 0.5% heme, 0% chlorophyll, 24.4% protein, 9% dietary fiber, 40% starch, 0.8% omega-3-fatty acids, 3.9% other fats, 7.5% moisture, and 8.4% ash.
Example 6: Separation of PPIX from heme and heme-binding proteins
[0107] Separation of PPIX from heme and heme-binding proteins may be accomplished as follows. Algae biomass is mixed in a buffer such as Tris-EDTA buffer (pH 7.2) and stirred for 1 h at room temperature at about 1600 RPM. Samples are then placed on ice and treated with ultrasonication such as for 5 min with 1 s pulse. To the ultras onicated algae, acetonitrile is added and then the mixture is vortexed for about 5 min and then is subjected to
centrifugation such as at 2500xg for 5 min, making a pellet of precipitated proteins. The acetonitrile containing supernatant containing porphyrins (including PPIX), is removed and can be analyzed for porphyrin content and further use.
[0108] Further separation can be achieved as follows: To the pellet from the
centrifugation, acetonitrile: 1.7 M HC1 (8:2, v/v) is added and placed in a shaker for about 20 min, extracting heme from the proteins into the acetonitrile. To create a two phase liquid- liquid system, saturated MgSCri and NaCl are added, and the solution is then vortexed for about 5 min and centrifuged at 2500xg for 5 min. The top organic layer can be removed and, if necessary, diluted with pure acetonitrile prior to analysis and further separation by LC/MS- MS. (Fyrestam and Ostman, Anal Bioanal Chem (2017) 409:6999-7010“Determination of heme in microorganisms using HPLC-MS/MS and cobalt(III) protoporphyrin IX inhibition of heme acquisition in Escherichia coli”). Example 7: Targeted Modification of chlorophyll pathway to create PPIX-enriched strains
[0109] Guide RNAs (sgRNAs) can be designed against the ferrocheletase gene to cause a deletion or an insertion that renders the protein complex non-functional, including a modification to one or more of SEQ ID NOs: 116-122. Once designed sgRNAs can be combined with the Cas9 protein by incubating them at 37°C to form ribonuclear proteins (RNPs). These RNPs carrying the sgRNAs to target ferrocheletase are then electroporated into green algae cultures. 3x10 8 cells are placed into MAX efficiency transformation buffer reagent for algae (Thermo fisher scientific) and placed into a cuvette with a 0.2cm gap. The electroporation voltage is set to 250V and the pulse interval is set to l5ms. Once electroporated cells are recovered in growth media with 40mM sucrose added to improve recovery efficiency. Cells are then plated on growth media containing agar and grown in the dark due to the photosensitivity of chlorophyll-deficient mutants. Once recovered the population can be pulled and struck out for individual colonies. Plates are again placed in the dark for 2 to 3 weeks. Mutants of ferrocheletase can be identified by an increase in their fluorescence at 635nm when they are excited by a light with a wavelength of 420nm when compared to the unmodified green algae.
Example 8: Additional modification of PPIX-enriched strains that are improved for different meat imitations and other uses.
[0110] Strains of algae overexpressing PPIX can by mated with strains that are under or overproducing omega-3s, omega-6s or omega-9s. For imitation fish, more omega oils in strains of algae overexpressing heme are ideal. For imitation beef-like products, less omega oils in strains of algae overexpressing heme are ideal. As such strains of algae that are mutants for either over or underexpressing omega oils can be mated with strains of algae overexpressing heme to form a more ideal algae for various meat-like products.
[0111] Mating can be done by identifying strains of Chlamydomonas that are the opposite mating type and then starving them for nitrogen. After nitrogen starvation, strains are re suspended in water to promote the formation of flagella. The flagella of the different mating types assist in the fusion of algae strains that will result in the formation of a zygote. The mated cultures are then exposed to chloroform to kill strains that did not mate. The chloroform does not kill zygotes. The zygotes are then placed into growth medium and allowed to propagate. Individual colonies are then identified and screened for an increase in PPIX by measuring for an increase in fluorescence of the precursor protoporphyrin IX or by biochemical assay (Abnova KA1617) as well as those that are overexpressing or under expressing omega oils.
SEQUENCES
ALA dehydratase (ALAD) nucleic acid sequence (SEQ ID NO: 1):
atgcagatgatgcagcgcaacgttgtgggccagcgccccgtcgctggctcccgccgc tcgctggtggttgccaac gttgcggaggtgacccgccccgcggtcagcaccaacggcaagcaccggactggtgtgccg gagggaactcccatc gtcacccctcaggacctgccctcgcgccctcgccgcaaccgccgcagcgagagcttccgt gcttccgttcgtgag gtgaacgtgtcgcccgccaacttcatcctgccgatcttcatccacgaggagagcaaccag aacgtgcccatcgcc tccatgcctggcatcaaccgcctggcgtatggcaagaacgtgattgactacgttgctgag gctcgctcttacggt gtcaaccaggtcgtggttttccccaagacgcccgaccacctgaagacgcaaaccgcggag gaggcgttcaacaag aacggcctcagccagcgcacgatccgcctgctgaaggactctttccctgacctggaggtg tacacggacgtggct ctggacccctacaactcggacggccacgacggtatcgtgtcggacgccggtgtgatcctg aacgacgagaccatc gagtacctgtgccgccaggccgtgagccaggccgaggccggtgccgacgtggtgtcgccc tctgacatgatggac ggccgcgtgggcgccatccgccgcgccctggaccgcgagggcttcaccaacgtgtccatc atgtcctacaccgcc aagtacgcctccgcctactacggccccttccgtgacgccctggcgtccgcgcccaagccc ggccaggcgcaccgc cgcatcccccccaacaagaagacctaccagatggaccccgccaactaccgcgaggccatc cgcgaggccaaggcc gacgaggccgagggcgctgacatcatgatggtcaagcccggcatgccgtacctggacgtg gtacgcctgctgcgt gagaccagcccgctgcccgtggccgtgtaccacgtgtcgggcgagtacgccatgctcaag gcggcggcggagcgc ggctggctgaacgagaaggatgccgtgcttgaggccatgacctgcttccgccgcgccggc gctgacctcatcctc acctactacggcattgaggcctccaagtggctggcgggcgagaagtaa
ALA dehydratase (ALAD) amino acid sequence (SEQ ID NO: 2):
MQMMQRNWGQRPVAGSRRSLWANVAEVTRPAVSTNGKHRTGVPEGTPIVTPQDLPSRPRR NRRSESFRASVRE VNVSPANFILPIFIHEESNQNVPIASMPGINRLAYGKNVIDYVAEARSYGVNQVWFPKTP DHLKTQTAEEAFNK NGLSQRTIRLLKDSFPDLEVYTDVALDPYNSDGHDGIVSDAGVILNDETIEYLCRQAVSQ AEAGADWSPSDMMD GRVGAIRRALDREGFTNVSIMSYTAKYASAYYGPFRDALASAPKPGQAHRRIPPNKKTYQ MDPANYREAIREAKA DEAEGADIMMVKPGMPYLDWRLLRETSPLPVAVYHVSGEYAMLKAAAERGWLNEKDAVLE AMTCFRRAGADLIL TYYGIEASKWLAGEK
coproporphyrinogen III oxidase (CPX1) nucleic acid sequence (SEQ ID NO: 3):
atggcactgcaagcctcaacccgctcgctccagcagcgccgcgccttctcttcggcc cagacctccaagcgtgtg tctgtgaccaaggtccgcgcgacggctatcgaggcggagaactatgtgaagcaggctccc cagtcgctggtccgc ccgggcatcgacactgaggactctatgcgcgctcgcttcgagaaggtgatccgcaacgcc caggactccatctgc aatgctatctccgagatcgatggcaagccgttccaccaggacgcctggacccgccccggc ggcggtggcggcatc agccgcgtgctgcaggacggcaacgtgtgggagaaggccggcgtcaacgtgtccgtggtc tacggcaccatgccc cctgaggcctaccgcgctgccactggcaacgccgagaagctgaagaacaagggtgacggt ggccgcgtgcccttc ttcgccgccggcatctcgtcggtgatgcacccccgcaacccccactgccccaccatgcac ttcaactaccgctac ttcgagactgaggagtggaacggcatccccggccagtggtggttcggcggcggcaccgac atcacccccagctat gtggtgcccgaggacatgaagcacttccacggcacctacaaggcggtgtgcgaccgccac gatcccgcttactac gagaagttccgcacctggtgcgatgagtacttcctcatcaagcaccgcggcgagcgccgc ggcctgggcggcatc ttcttcgatgacctgaacgaccgcaaccccgaggacatcctgaagttctcgaccgacgcc gtgaacaacgtggtg gaggcatactgccccatcatcaagaagcacatgaacgacccctacacccccgaggagaag gagtggcagcagatc cgccgcggccgctacgtggagttcaacctggtctatgaccgcggcaccaccttcggcctg aagaccggcggccgc attgagtcgatcctcatgtccatgccccagaccgcctcatggctgtacgaccaccagccc aaggccggctcgccc gaggccgagctgctcgacgcctgccgcaacccccgcgtctgggtgtaa coproporphyrinogen III oxidase (CPX1) amino acid sequence (SEQ ID NO: 4)
MALQASTRSLQQRRAFSSAQTSKRVSVTKVRATAIEAENYVKQAPQSLVRPGIDTEDSMR ARFEKVIRNAQDSIC
NAISEIDGKPFHQDAWTRPGGGGGISRVLQDGNVWEKAGVNVSWYGTMPPEAYRAAT GNAEKLKNKGDGGRVPF
FAAGISSVMHPRNPHCPTMHFNYRYFETEEWNGIPGQWWFGGGTDITPSYWPEDMKH FHGTYKAVCDRHDPAYY
EKFRTWCDEYFLIKHRGERRGLGGIFFDDLNDRNPEDILKFSTDAVNNWEAYCPIIK KHMNDPYTPEEKEWQQI
RRGRYVEFNLVYDRGTTFGLKTGGRIESILMSMPQTASWLYDHQPKAGSPEAELLDA CRNPRVWV
coproporphyrinogen III oxidase (CPX2) nucleic add sequence (SEQ ID NO: 5):
atgctgaggaagcagattggtggatctggccagcagcgggcgggcctccgacgggtg aaccaaggacctgcgcgt cggcggttggcaccctgccgcgtggcggcccccgtgcaaacctcgtcctccgtcgccaca ttcaatggcttcgtg gactacattcacggactccagaagaacattctgagcactgctgaggatctggagaacggc gagcggaagtttgtt gttgaccgctgggagcgcgacgccagcaaccccaacgccgggtatggcattacgtgcgtg cttgaggacgggaag gtgctggagaaggccgcagccaatatctcagtggtgcgcgggacgctgtcggcgcagcgc gcagtggccatgagc tcccgcggccgcagcagcatcgaccccaagggcgggcagccctacgccgcggccgccatg agcctagtgttccac agcgcgcacccgctcatccccacgctgcgcgcgacgtgcggttgttccaggtgggcgatg aggcgtggtacggcg gtggctgtgacctgacgcccaactacctagacgtggaggactcgcagtccttccaccgct actggaaggacgtgt gcggcaagtacaagccgggcctgtacaccgagctcaaggagtggtgcgacaggtacttct acatcccggcccgca aagagcaccgtggcattggcggcctgttctttgatgacatggccactgcggaggcgggct gcgatgtggaggcgt ttgtgcgggaagtgggagatggcatcctgccctgctggctgcccatcgtggcgcggcacc gtggccagcccttca cggagcagcagcggcaatggcagctgctgcgccgcggtcgctacatcgagttcaacctgc tgtacgaccgcggca tcaagttcggtctggacggcggccgcatcgagagcatcatggtgtcggcgccgccgctga tcgcgtggaagtaca acgtggtgccacagccgggcagccccgaggaggagatgctgaaggtgcttcagcagcccc gcgagtgggcctga coproporphyrinogen III oxidase (CPX2) amino add sequence (SEQ ID NO: 6):
MLRKQIGGSGQQRAGLRRVNQGPARRRLAPCRVAAPVQTSSSVATFNGFVDYIHGLQKNI LSTAEDLENGERKFV
VDRWERDASNPNAGYGITCVLEDGKVLEKAAANISWRGTLSAQRAVAMSSRGRSSID PKGGQPYAAAAMSLVFH
SAHPLIPTLRADVRLFQVGDEAWYGGGCDLTPNYLDVEDSQSFHRYWKDVCGKYKPG LYTELKEWCDRYFYIPAR
KEHRGIGGLFFDDMATAEAGCDVEAFVREVGDGILPCWLPIVARHRGQPFTEQQRQW QLLRRGRYIEFNLLYDRG
IKFGLDGGRIESIMVSAPPLIAWKYNWPQPGSPEEEMLKVLQQPREWA
Ferrochelatase from Chlamydomonas reinhardtii nucleic acid sequence (SEQ ID NO: 7): atggcgtcgtttggattgatgcaaaggacggtgcactgtccccagcttgtggaggagcgg tgttcgccggtcgct ggctgctctggtcgtggcctgccagttatccagcggcaacggcgtggcgtgtgcagtgcc accaacggtgtccag cgagggcgtgtgctgcgccggacggccgcttcgaccgacgtggtctccttcgtggacccc aatgacattagaaaa cccgcagcagcagcagctggccctgcggtggataaggtcggcgttctgctgttaaacctt ggcgggcccgaaaag ctcgacgacgtcaagcctttcctgtataacctattcgccgacccagaaattattcgcctg ccagcggcagctcag ttcctgcagccgctgctcgcgacgatcatctccacgcttcgcgccccgaagagcgcggag ggctatgaggccatt ggcggtggtagcccgttgcgtaggattacagacgagcaggcggaggcgctggcggagtct ctgcgcgccaagggc caacctgcgaacgtgtacgtgggcatgcgctattggcacccctacacggaggaggcgctg gagcacattaaggcc gacggcgtcacgcgcctggtcatcctcccgctgtaccctcagttctccatctctaccagc ggctccagccttcga ctgcttgagtcgctcttcaagagcgacatcgcgctcaagtcgctgcggcacacggtcatc ccgtcctggtaccag cggcggggctacgtgagcgcgatggcggacctgattgtagaggagctgaagaagttccgg gacgtgcccagcgtg gagctgtttttctccgcgcacggcgtgcccaagtcctacgtggaggaggcgggcgaccca tacaaggaggagatg gaggagtgcgtgcggctcattacggacgaggtcaagcggcgcggcttcgccaacacgcac acgctggcctaccag agccgcgtgggccccgcggaatggctcaagccgtacacggatgagtccatcaaggagctg ggcaagcgcggcgtc aagtcgctgctggcggtgcccatcagctttgtcagcgagcacattgagacgttggaggag atcgacatggagtac cgcgagctggcggaggagagcggcatccgcaactggggccgcgtgccggcgctgaacacc aacgccgccttcatc gacgacctggcggacgcggtgatggaggcgctgccctacgtgggctgcctggccgggccg acagactcgctggtg ccgctgggcgacctggagatgctgctgcaggcctacgaccgcgagcgccgcacgctgccg tcaccggtggtgatg tgggagtggggctggaccaagagcgcggagacgtggaacggccgcattgccatgattgcc atcatcatcatcctg gcgctggaggcagccagcggccagtccatcctcaaaaacctgttcctggcggagtag Ferrochelatase from Chlamydomonas reinhardtii amino acid sequence (SEQ ID NO: 8):
MASFGLMQRTVHCPQLVEERCSPVAGCSGRGLPVIQRQRRGVCSATNGVQRGRVLRR TAASTDWSFVDPNDIRK PAAAAAGPAVDKVGVLLLNLGGPEKLDDVKPFLYNLFADPEIIRLPAAAQFLQPLLATII STLRAPKSAEGYEAI GGGSPLRRITDEQAEALAESLRAKGQPANVYVGMRYWHPYTEEALEHIKADGVTRLVILP LYPQFSISTSGSSLR LLESLFKSDIALKSLRHTVIPSWYQRRGYVSAMADLIVEELKKFRDVPSVELFFSAHGVP KSYVEEAGDPYKEEM EECVRLITDEVKRRGFANTHTLAYQSRVGPAEWLKPYTDESIKELGKRGVKSLLAVPISF VSEHIETLEEIDMEY RELAEESGIRNWGRVPALNTNAAFIDDLADAVMEALPYVGCLAGPTDSLVPLGDLEMLLQ AYDRERRTLPSPWW EWGWTKSAETWNGRIAMIAI II ILALEAASGQSILKNLFLAE
Glutamate-l-semialdehyde aminotransferase (GSA) nucleic acid sequence (SEQ ID NO:
9):
atgcagatgcagctgaacgccaagaccgtgcagggcgccttcaaggcgcagcgccct cgctctgtccgcggcaac gtggcggtgcgcgcagtggccgctccccctaagctggtcaccaagcgctccgaggagatc ttcaaggaggctcag gagctgctgcccggtggcgtgaactcgcccgtgcgcgctttccgctcggttggtggcggc cccatcgtcttcgac agggtcaagggtgcctactgctgggacgtcgatggcaacaagtacatcgactacgttggc tcttggggccctgcc atttgcggccacggcaacgacgaggtcaacaacgccctgaaggcgcagatcgacaagggc acctcgttcggtgct ccctgcgagctggagaacgtgctggccaagatggtgattgaccgcgtgccctcggtggag atggtgcgcttcgtg tcctcgggcactgaggcgtgcctgtcggtgctgcgcctgatgcgcgcatacaccggccgc gagaaggtgctgaag ttcaccggctgctaccacggccacgccgactccttcctggtgaaggccggctccggtgtg atcaccctgggcctg cccgactcgcccggtgtgcccaagagcaccgccgccgccaccctgaccgccacctacaac aacctggactccgtg cgcgagctgttcgccgccaacaagggcgagattgccggtgtgatcctggagcccgtggtc ggcaacagcggcttc attgtgcccaccaaggagttcctgcagggcctgcgcgagatctgcacggctgagggcgcc gtgctgtgcttcgat gaggtcatgaccggcttccgcattgccaagggctgcgcccaggagcacttcggtatcacc cccgacctgaccacc atgggcaaggtcattggtggcggcatgcctgtgggcgcctacggcggcaagaaggagatc atgaagatggtcgcc cccgccggccccatgtaccaggccggcaccctttcgggcaaccccatggccatgactgcc ggcatcaagacgctg gagatcctgggccgccccggcgcctacgagcacctggagaaggtgaccaagcgcctgatc gacggcatcatggcc gccgccaaggagcacagccacgagatcaccggcggcaacatcagcggcatgtttggcttc ttcttctgcaagggc cctgtgacctgcttcgaggacgccctggcggccgacactgccaagttcgcgcgcttccac cgcggcatgctggag gagggcgtctacctggctccctcgcagttcgaggccggcttcacctctctggcccactcc gaggcggacgtggat gccacgatcgccgccgctcgccgcgtgttcgcccgcatctaa
Glutamate-l-semialdehyde aminotransferase (GSA) amino acid sequence (SEQ ID NO:
10):
MQMQLNAKTVQGAFKAQRPRSVRGNVAVRAVAAPPKLVTKRSEEIFKEAQELLPGGVNSP VRAFRSVGGGPIVFD RVKGAYCWDVDGNKYIDYVGSWGPAICGHGNDEVNNALKAQIDKGTSFGAPCELENVLAK MVIDRVPSVEMVRFV SSGTEACLSVLRLMRAYTGREKVLKFTGCYHGHADSFLVKAGSGVITLGLPDSPGVPKST AAATLTATYNNLDSV RELFAANKGEIAGVILEPWGNSGFIVPTKEFLQGLREICTAEGAVLCFDEVMTGFRIAKG CAQEHFGITPDLTT MGKVIGGGMPVGAYGGKKEIMKMVAPAGPMYQAGTLSGNPMAMTAGIKTLEILGRPGAYE HLEKVTKRLIDGIMA AAKEHSHEITGGNISGMFGFFFCKGPVTCFEDALAADTAKFARFHRGMLEEGVYLAPSQF EAGFTSLAHSEADVD ATIAAARRVFARI
glutamyl-tma reductase (HEMA) nucleic acid sequence (SEQ ID NO: 11):
atgcagaccactatgcagcagcgtctccagggccgtaacgtggccgggcggagcgtc gctccctcggtccctgcc catcgctccttccactcacaccgggctgccactcaaaccgctacgatcagcgctgctgct agctcaaccaccaag ctgccagcttcgcatctggagagcagcaagaaggcgctggattcgctgaagcagcaggcc gtcaatcgctacgcg ggtgacaagaagagctccattattgccattggtctcaccattcacaacgcacccgtggag ctgcgcgagaagctg gctgtgcctgaggctgaatggccgcgtgctattgaggagctctgccagttcccgcacatc gaggaggccgcggtg ctgtcgacgtgcaatcgcatggagctctacgttgtcggtctgtcgtggcaccgcggcgtt cgcgaggtggaggag tggctgtctcgcaccagcggcgtgcctctggatgagctgcgcccctacctgttcctgctg cgcgaccgcgacgcc acgcaccacctgatgcgcgtgtcgggtggccttgactcgctggttatgggcgagggccag attctcgcccaagtg cgccaggtctacaaggtcggccagaactgccccggcttcggtcgccacctgaacggcctg ttcaagcaggctatc accgctggcaagcgcgtgcgtgccgagacctccatctccaccggctccgtctccgtctca tccgccgccgtcgag ctggcgcagctcaagctccccacccacaactggtccgacgctaaggtctgcatcatcggc gctggcaagatgtct acgctgctggtgaagcacctgcagagcaagggctgcaaggaggtgacggtgctcaaccgc tctctgccgcgcgcc caggcgctggcggaggagttccctgaggtcaagttcaacatccacctgatgcccgacctg ctgcagtgcgtggag gccagcgacgtcatcttcgccgcctccggctctgaggagatcctcatccacaaggagcat gtcgaggccatgtcc aagccatcggacgttgttggctccaagcgccgcttcgtcgacatctccgtgccccgcaac atcgcccccgccatc aacgagctggagcacggcatcgtctacaacgtcgacgacctgaaggaggttgtggccgcc aacaaggagggccgc gcgcaggcggccgccgaggccgaggtgctgatccgcgaggagcagcgcgcgttcgaggcc tggcgtgactctctg gagaccgtgcccaccatcaaggcgctgcgctccaaggccgagaccatccgcgccgccgag tttgagaaggccgtg tctcgcctgggcgaggggctatccaagaagcagctcaaggcggtggaggagctcagcaag ggcatcgtcaacaag ctgctgcacgggcccatgacggcactgcgctgcgacggcaccgatccggatgccgtgggc cagaccctcgcgaac atggaggccctggagcgcatgttccagctctcggaggtggacgtggccgcgctggcgggc aagcagtaa glutamyl-tma reductase (HEMA) amino acid sequence (SEQ ID NO: 12):
MQTTMQQRLQGRNVAGRSVAPSVPAHRSFHSHRAATQTATISAAASSTTKLPASHLESSK KALDSLKQQAVNRYA GDKKSSIIAIGLTIHNAPVELREKLAVPEAEWPRAIEELCQFPHIEEAAVLSTCNRMELY WGLSWHRGVREVEE WLSRTSGVPLDELRPYLFLLRDRDATHHLMRVSGGLDSLVMGEGQILAQVRQVYKVGQNC PGFGRHLNGLFKQAI TAGKRVRAETSISTGSVSVSSAAVELAQLKLPTHNWSDAKVCI IGAGKMSTLLVKHLQSKGCKEVTVLNRSLPRA QALAEEFPEVKFNIHLMPDLLQCVEASDVIFAASGSEEILIHKEHVEAMSKPSDWGSKRR FVDISVPRNIAPAI NELEHGIVYNVDDLKEWAANKEGRAQAAAEAEVLIREEQRAFEAWRDSLETVPTIKALRS KAETIRAAEFEKAV SRLGEGLSKKQLKAVEELSKGIVNKLLHGPMTALRCDGTDPDAVGQTLANMEALERMFQL SEVDVAALAGKQ
Light independent protochlorophyllide reductase subunit N (chlN) nucleic acid sequence (SEQ ID NO: 13):
atgttatactcacaatttaaacattcggtgcctttaggccgtaagtctccccttctt tcagggggccccccttct gggggtcgcccaacaacggctgcctcaggcctaggtcgcaacgtggccgtaagaattggg accccgttgggcttt gcccttcgggcccaggtaattatggcagctgcgggcaatactagcggtgcgccgcacccc gtaggggagtcccag cctgcgttgtcccaggtggattctcaacttgtaattgagtgtgaaacaggaaattaccat actttttgcccaatt agttgtgtttcttggttataccaaaaaattgaagatagttttttcttagttattggtaca aaaacgtgtgggtat tttttacaaaatgctttaggggttatgatttttgccgaacctcgttacgctatggcggaa ttagaagaaagcgat atttcggcgcaattaaatgattacaaagaattaaaacgtctatgtttacaaattaaacaa gaccgtaacccaagt gttattgtgtggattggcacatgcacaaccgaaattattaaaatggatttagaaggtatg gcaccgaaactagaa gctgaaatcggtattccaattgtggtagcacgcgcaaatggacttgattatgcttttaca caaggtgaagatact gttttagctgcgatggtccaaaaatgcccggaattaggcgctattccagctattgtacct cagattccttctgac tctcgtacacttagccaactatctgtagcggcttcggtacccgaaaacagtgcgtctggg ccagaaggggagcct tcactagcccagaagggaatggattctaagttaacaaacaactctccatgccgagtagat tctgtctcagaatct accccggcgtttcctggacgtgctccgcacgtcgggaaaagtactcctcaaaatttagtt ttatttggttcatta cctagcacgatggcaaatcaactggagtttgaattaaaacgccaaggtattaatgttact gggtggttacctgcg gctcgctattcatctttacctgcattaggtgaaaacgtgtatgtttgtgggattaatcca tttttaagtcgaact gctacttctttaatgcgtcgtcgtaaatgcaaattaatttcagctcctttcccaattggt ccagatggtacaaaa gcttgggtcgaaaaaatttgtaatgttttcggtgttacaccaactggtttagaagatcgt gaacgtcttgtttgg gaaggtttaaaagattatttaaatttcgtaaaagggaaatctgttttctttatgggtgat aatctgttagaaatt tcattagcccgttttttaattcgctgtggtatgaccgtttatgaaatcggtattccgtac atggaccaacgattt caagctggggaattagaattattaaaaaaaacatgcatggaaatgaacgtgcccctaccg cgtattgttgaaaaa cctgataattactatcaaattcaacgtattaaagaattacaaccagatttagttattacc ggcatggcccatgca aacccactggaagcgcgcggcattactacgaaatggtccgttgaatttacgtttgcgcaa attcatgggtttggc aacgcacgtgatatcttagaattagttacaaaaccgttacgtcgtaataaaaatctatct aaatatcaatttccg ttagatagctgggacaagcctgcttccgtaggcgctcacgaactgtcggcctaa
Light independent protochlorophyllide reductase subunit N (chlN) amino acid sequence (SEQ ID NO: 14):
MLYSQFKHSVPLGRKSPLLSGGPPSGGRPTTAASGLGRNVAVRIGTPLGFALRAQVIMAA AGNTSGAPHPVGESQ PALSQVDSQLVIECETGNYHTFCPISCVSWLYQKIEDSFFLVIGTKTCGYFLQNALGVMI FAEPRYAMAELEESD ISAQLNDYKELKRLCLQIKQDRNPSVIVWIGTCTTEI IKMDLEGMAPKLEAEIGIPIVVARANGLDYAFTQGEDT VLAAMVQKCPELGAIPAIVPQIPSDSRTLSQLSVAASVPENSASGPEGEPSLAQKGMDSK LTNNSPCRVDSVSES TPAFPGRAPHVGKSTPQNLVLFGSLPSTMANQLEFELKRQGINVTGWLPAARYSSLPALG ENVYVCGINPFLSRT ATSLMRRRKCKLISAPFPIGPDGTKAWVEKICNVFGVTPTGLEDRERLVWEGLKDYLNFV KGKSVFFMGDNLLEI SLARFLIRCGMTVYEIGIPYMDQRFQAGELELLKKTCMEMNVPLPRIVEKPDNYYQIQRI KELQPDLVITGMAHA
NPLEARGITTKWSVEFTFAQIHGFGNARDILELVTKPLRRNKNLSKYQFPLDSWDKP ASVGAHELSA
Light Independent protochlorophyllide subunit B (chlB) nucleic acid sequence (SEQ ID NO: 15):
atgaaattagcgtattggatgtatgcgggaccggctcatattggaacattacgagtt gcaagctcgtttcgaaat gtgcatgctattatgcatgctcccttaggcgatgattattttaacgtaatgcgttcaatg ttagaacgtgaacgt gattttacgccagtgacggcaagtattgttgatcgtcatgttttagctcgtggttcacaa gaaaaagttgttgaa aacattcaacgaaaagataaagaagaatgtccggatttaattttattaacaccaacatgt acctcaagtattttg caagaagatttacaaaattttgtaaatcgcgcggccgaagtagcaaagcgttcggatgtt ttattagctgacgtt aaccattaccgagtgaatgaattacaagcggctgaccgtacgttagagcaaattgtacgc ttttatttagaaaaa gaagtaaataaacttcacgcggagttaggcggccttaaaaaaccgcttcgctttgcccag cgtacccaaaagccg tctgccaatattttaggcatgtttacactaggtttccataatcaacatgactgtcgtgaa ttaaaacgtttatta aatgatttaggtatcgaagtcaatgaagtgattcctgaaggtagttttgtacatggatta aaaaatttaccaaaa gcgtggtttaacatcgtcccgtatcgtgaagttggtttaatgacggcaatttatttagaa aaagaatttggcatg ccttatacctcaatcacgccaatgggcattattgacaccgcggcgtttattcgtgaaatt gcggccatttgtagt caaattagcacttcacaggcatctacaaactcaactgaaggactccagaggggagaaaat gtcagtttaactgaa actaattcgattatttttaataaagcaaaatatgaacaatacattaatcaacaaacgcat tttgtttctcaagca gcttggttttcacgttctattgactgtcaaaatttaaccggtaaaaaaaccgttgtgttt ggtgatgcaactcac gcggcaagtatgacgaaaattcttgtgcgcgaaatgggtattcatgttgtttgcgcgggc acgtattgtaaacat gatgcagattggtttagagagcaagtttcaggtttttgtgatcaagttttaattacagat gatcacagccaaatt gcggaaatcattgctcaaattgaacctgcagccatttttggtacacaaatggaacgtcat gttgggaaaaggtta gatattccttgtggggttatttctgcaccggtacatattcaaaacttcccactaggcttt agaccgtttttaggg tatgaaggtactaatcaaatttccgatttagtttataattcgtttagtttaggtatggaa gatcacttactagaa attttcaacggtcatgacaataaagaagttattacacgttcgtattcttcagaaactgat ttagaatggacaaaa gaagcattagatgaactagctcgtgttcctggttttgttcgttcaaaagttaaacgtaat actgaaaaatttgcg cgtacaaataaaaatcaagttattactattgaagttatgtacgcagctaaagaagcggta tcagcgtaa
Light Independent protochlorophyllide subunit B (chlB) amino acid sequence (SEQ ID NO: 16):
MKLAYWMYAGPAHIGTLRVASSFRNVHAIMHAPLGDDYFNVMRSMLERERDFTPVTASIV DRHVLARGSQEKWE NIQRKDKEECPDLILLTPTCTSSILQEDLQNFVNRAAEVAKRSDVLLADVNHYRVNELQA ADRTLEQIVRFYLEK EVNKLHAELGGLKKPLRFAQRTQKPSANILGMFTLGFHNQHDCRELKRLLNDLGIEVNEV IPEGSFVHGLKNLPK AWFNIVPYREVGLMTAIYLEKEFGMPYTSITPMGI IDTAAFIREIAAICSQISTSQASTNSTEGLQRGENVSLTE TNSI IFNKAKYEQYINQQTHFVSQAAWFSRSIDCQNLTGKKTVVFGDATHAASMTKILVREMGI HWCAGTYCKH DADWFREQVSGFCDQVLITDDHSQIAEI IAQIEPAAIFGTQMERHVGKRLDIPCGVISAPVHIQNFPLGFRPFLG YEGTNQISDLVYNSFSLGMEDHLLEIFNGHDNKEVITRSYSSETDLEWTKEALDELARVP GFVRSKVKRNTEKFA RTNKNQVITIEVMYAAKEAVSA
Light independent protochlorophyllide reductase subunit L (chlL) nucleic acid sequence (SEQ ID NO: 17):
atgaaattagcagtttatggcaaaggtggtattggtaaatccacaacaagttgtaac atttcaattgcattagca aaacgtggcaaaaaagtattacaaattggttgtgatccaaaacacgatagtacttttaca ttaaccggtttttta attccaacaattattgatactttacaaagtaaagattatcattacgaagatgtttggccg gaagatgttatttac caaggctacgggagtgtggattgtgttgaagcaggtggcccgccagccggcgccggctgt ggtgggtatgttgtt ggtgaaacagttaaattattaaaagaattaaatgcattttatgaatatgatgttattctg tttgatgttttaggg gatgttgtatgtggtgggtttgctgcacctttaaattacgccgactattgcattattgtc acagataatggcttt gatgcgttatttgccgcaaaccgtattgctgcttcagtgcgcgaaaaagcgcgcattcac ccattacgtttagct gggttaattgggaatcgtacagccaaacgcgatttaatcgataaatacgttgaagcgtgc ccgatgccagtctta gaggtattaccgttaattgaagacattcgtgtgtcacgcgtaaaaggtaaaacattattt gaaatggcagaacat gattcatcattacactacatttgtgacttttatttaaatattgcggatcaattattaact gaaccagaaggtgtt gttccgcgcgaattagcagaccgtgaattatttactctattatcagatttctatttaaac gctgggactcctagc cctagtggatctgagttcggctcaggcgcccttagcggaacgagcggcgaaacagctccc ggtaatatgggtcag cacatgagtaacgcagtaaaaacaaacgaacaggaaatgaatttctttcttgtgtaa Light independent protochlorophyllide reductase subunit L (chlL) amino acid sequence (SEQ ID NO: 18):
MKLAVYGKGGIGKSTTSCNISIALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTI IDTLQSKDYHYEDVWPEDVIY QGYGSVDCVEAGGPPAGAGCGGYWGETVKLLKELNAFYEYDVILFDVLGDWCGGFAAPLN YADYCI IVTDNGF DALFAANRIAASVREKARIHPLRLAGLIGNRTAKRDLIDKYVEACPMPVLEVLPLIEDIR VSRVKGKTLFEMAEH DSSLHYICDFYLNIADQLLTEPEGWPRELADRELFTLLSDFYLNAGTPSPSGSEFGSGAL SGTSGETAPGNMGQ HMSNAVKTNEQEMNFFLV
Magnesium Chelatase subunit H (CHLH2) nucleic acid sequence (SEQ ID NO: 19): atgcggattgtgctggtcagcggcttcgagagctttaacgtgggcctgtacaaggatgcg gcggagctgctgaag cgctccatgcccaacgtcacactccaggtgttctccgaccgcgacctggcctccgacgcc acccgctcccggctg gaggcggctctggggcgcgccgacatcttcttcggatcactgctgttcgactacgaccag gtggagtggctacgg gcccggctggagcgggtgcctgtgcggctagtgtttgagtcggcgttggagctcatgagc tgcaacaaggtgggg tcgttcatgatgggcggcggcggtcccggcggcggcccgcccggcaaggcgcccggcccg ccgcccgcggtgaag aaggttctctccatgtttggaagcggtcgcgaggaggacaagatgggcggctcctccaat gtggtggccatgttc agttacctggtggagaccctgatggagccaacgggtgggttatttggtagttggtggttg tgttatggttggccg tttcggttgggtgatctgggctggtatctacaacccccctcaaccctcacgcctccaggc tacgtgccgccgcct gtggtggagactcccgcactgggctgcctccacccctccgcgcccggccgctacttcgag tcccccgccgagtac atgaagtggtacgccagggagggcccgctgcgcggcacgggcgccccggtggttggcgtg ctgctgtaccgcaag catgtgatcaccgaccagccgtacatcccgcagctggtcagccagctggaggcggagggg ctgctgcccgtgccc atcttcatcaacggcgtggaggcgcacaccgtggttcgcgacctgctgacctccgtgcac gagcaggatctgctt gcacgcggcgagacgggcgccatcagccccaccctgaagcgggacgcggtcaaggtggac gcggtggtgagcacc attggcttcccgctggtgggcggccccgccggcaccatggagggcgggcggcaggcggag gtggccaaggccatc ctgggcgccaaggacgtgccgtacacggtggcggcgccgctgcttattcaggacatggag agctggagcagggac ggcgtggcgggtctccagagtgtggtgctgtactcgctgccggagctggacggcgcagtg gacacggtgccactg ggggggctggtgggggacgacatctacctggtgccggagcgggtgaagaagctggcgggg cggctcaagtcgtgg cgtacgacacgcactaagcatgcctctgtttgtgacgtccagcccctcccccccccgtct cccctctccaccctc cctctcccttcctctcccttcctctcactctccaccctcttccccctccgcccaaacata acgaggcgggggctg ctgggcgcaagcgggccctggagtacccgctgcgacctagctagtccaactccacccatc ccccaatgccgcaat agctttccggagatgagcacacacacacacacacacacacacacacacacacacacacac acacacacacacaca cgccacccacgcacacacacacacacacacgctccccccgctcgccacacccccatccca ccccacccgcaggag ctgctgacgtaccccgcggactggggcccggccgagtggggcccgctgccctacctgccc gaccccgacgtgctg gttcgccgcatggaggcgcagtggggcgagctgcgagcctaccgcggcctcaacacctcg gcgcgcggcatgttc caggagtacggggctgacgtggtcctgcacttcggcatgcacggcaccgtggagtggttg cctggggcgccgctg gggaacaacggcctcagctggagcgacgtgctgctcggcgagctgccaaacgtgtacgtg tacgctgccaacaac ccctccgagtccatcgtggcaaagcggcgcggctacggcaccatcgtcagccacaacgtg ccgccgtacgggcgg gcgggtctgtacaagcagctttccagcctcaaggagacgcttcaggagtaccgcgaggcc gcgcaggccgcacgt gcccgagcaggagccagcagcagcagcggcagtagcagcagtagcagtagcagcggcagt ggcagtagcagcagc agtgtggagctgcgggcggcgttggcaccggtgttcgacgcctacactgaccgcctgtat gcctacctgcagctg ctggaggggcggctgttcagcgaggggctacacgtactgggagcgccgccggcgccgccg caggtgggtggtttt cccgcgagcttccaacggtaccgtaaactgcccaactgcccaacttctccccaaacacag gaggctgtcaagatc cggaacctgctcatgcagaacacgcaggagctggacgggctgctcaagggcctgggtggg cgttacgtgcttccc gaggcgggcggcgacctgctgcgggacgggtcgggcgtgctgcccaccggccgcaacatc cacgcactggacccc taccgcatgccctcccccgccgccatggcccgtggggcggcggtggcggcggccattctt gagcagcaccgggcg gctaacagcggggcgtggcccgagacctgcgccgtcaacctgtgggggctggactccatc aagagcaagggcgag agtgtgggggtggtgctggcgctggtgggggcggtgccggtgcgcgagggtacgggccgc gtcgcgcgcttccaa ctggtgccgctgtcagagttgggccggccgcgtgtggacgtgctttgtaacatgagcggc atcttccgcgactcc ttccagaacgtggtggagctgctcgacgacctgtttgcaagggccgccgccgccgctgac gagccagatgacatg aacttcatcgccaaacacgcccgagccatggagaagcagggcctgtccgccacctcggcc cgcctgttctccaac ccggctggcgactacgggtcgatggtcaacgagcgagtggggcagggcagctgggccaac ggcgacgagctgggt gacacgtgggcggcccgcaacgccttcagctacggccgaggcaaggagcgaggcacggcg cggcccgaggtgctg caggcgctgctcaagaccacggaccggatcgtgcagcagatcgacagtgtggagtacggc ctgacagacatccag gagtactacgccaacacgggcgccctcaagagagccgccgaggtggccaaaggcgacccg ggccccggtggccgg cggccgcgcgtggggtgttccattgtggaggcctttggcggcgcgggcgcgggcgcgggc ggcgccggtggagcg ggcgtgccgccgcctcgcgagctggaggaggtgctgcgcctggagtaccgctcgaagctg ctcaaccccaagtgg gcccgggccatggcggcgcagggcagcggcggcgcctacgagatcagtcagcgcatgacg gcgttggtgggctgg ggcgccaccaccgatttcagggagggctgggtgtgggacccaggcgccatggacacgtat gtgggcgatgaggag atggccagcaagctcaagaagaacaacccgcaggcctttgccaacgtgctgcggcgcatg ctggaggcggcgggc cgcggcatgtggagccccaacaaggaccagctggcacagctcaagtcgctgtacagcgag atggacgaccagctg gagggggtgacg
Magnesium Chelatase subunit H (CHLH2) amino acid sequence (SEQ ID NO: 20):
MRIVLVSGFESFNVGLYKDAAELLKRSMPNVTLQVFSDRDLASDATRSRLEAALGRA DIFFGSLLFDYDQVEWLR
ARLERVPVRLVFESALELMSCNKVGSFMMGGGGPGGGPPGKAPGPPPAVKKVLSMFG SGREEDKMGGSSNWAMF
SYLVETLMEPTGGLFGSWWLCYGWPFRLGDLGWYLQPPSTLTPPGYVPPPWETPALG CLHPSAPGRYFESPAEY
MKWYAREGPLRGTGAPWGVLLYRKHVITDQPYIPQLVSQLEAEGLLPVPIFINGVEA HTWRDLLTSVHEQDLL
ARGETGAISPTLKRDAVKVDAWSTIGFPLVGGPAGTMEGGRQAEVAKAILGAKDVPY TVAAPLLIQDMESWSRD
GVAGLQSWLYSLPELDGAVDTVPLGGLVGDDIYLVPERVKKLAGRLKSWRTTRTKHA SVCDVQPLPPPSPLSTL
PLPSSPFLSLSTLFPLRPNITRRGLLGASGPWSTRCDLASPTPPIPQCRNSFPEMST HTHTHTHTHTHTHTHTHT
RHPRTHTHTHAPPARHTPIPPHPQELLTYPADWGPAEWGPLPYLPDPDVLVRRMEAQ WGELRAYRGLNTSARGMF
QEYGADWLHFGMHGTVEWLPGAPLGNNGLSWSDVLLGELPNVYVYAANNPSESIVAK RRGYGTIVSHNVPPYGR
AGLYKQLSSLKETLQEYREAAQAARARAGASSSSGSSSSSSSSGSGSSSSSVELRAA LAPVFDAYTDRLYAYLQL
LEGRLFSEGLHVLGAPPAPPQVGGFPASFQRYRKLPNCPTSPQTQEAVKIRNLLMQN TQELDGLLKGLGGRYVLP
EAGGDLLRDGSGVLPTGRNIHALDPYRMPSPAAMARGAAVAAAILEQHRAANSGAWP ETCAVNLWGLDSIKSKGE
SVGWLALVGAVPVREGTGRVARFQLVPLSELGRPRVDVLCNMSGIFRDSFQNWELLD DLFARAAAAADEPDDM
NFIAKHARAMEKQGLSATSARLFSNPAGDYGSMVNERVGQGSWANGDELGDTWAARN AFSYGRGKERGTARPEVL
QALLKTTDRIVQQIDSVEYGLTDIQEYYANTGALKRAAEVAKGDPGPGGRRPRVGCS IVEAFGGAGAGAGGAGGA
GVPPPRELEEVLRLEYRSKLLNPKWARAMAAQGSGGAYEISQRMTALVGWGATTDFR EGWWDPGAMDTYVGDEE
MASKLKKNNPQAFANVLRRMLEAAGRGMWSPNKDQLAQLKSLYSEMDDQLEGVT
Magnesium Chelatase subunit 1 (CHLI1) Chlamydomonas reinhardtii nucleic acid sequence (SEQ ID NO: 21):
atggccctgaacatgcgtgtttcctcttccaaggtcgctgccaagcagcagggccgc atctccgcggtgccggtt gtgtcgagcaaggtggcctcctccgcccgcgtggcccccttccagggcgctcccgtggcc gcgcagcgcgctgct ctgctggtgcgcgccgctgccgctactgaggtcaaggctgctgagggccgcactgagaag gagctgggccaggcc cgccccatcttccccttcaccgccatcgtgggccaggatgagatgaagctggcgctgatt ctgaacgtgatcgac cccaagatcggtggtgtcatgatcatgggcgaccgtggcactggcaagtccaccaccatt cgtgccctggcggat ctgctgcccgagatgcaggtggttgccaacgacccctttaactcggaccccaccgacccc gagctgatgagcgag gaggtgcgcaaccgcgtcaaggccggcgagcagctgcccgtgtcttccaagaagattccc atggtggacctgccc ctgggcgccactgaggaccgcgtgtgcggcaccatcgacatcgagaaggcgctgaccgag ggtgtcaaggcgttc gagcccggcctgctggccaaggccaaccgcggcatcctgtacgtggatgaggtcaacctg ctggacgaccacctg gtcgatgtgctgctggactcggccgcctccggctggaacaccgtggagcgcgagggtatc tccatcagccacccc gcccgcttcatcctggtcggctcgggcaaccccgaggagggtgagctgcgcccccagctg ctggatcgcttcggc atgcacgcccagatcggcaccgtcaaggacccccgcctgcgtgtgcagatcgtgtcgcag cgctcgaccttcgac gagaaccccgccgccttccgcaaggactacgaggccggccagatggcgctgacccagcgc atcgtggacgcgcgc aagctgctgaagcagggcgaggtcaactacgacttccgcgtcaagatcagccagatctgc tcggacctgaacgtg gacggcatccgcggcgacatcgtgaccaaccgcgccgccaaggccctggccgccttcgag ggccgcaccgaggtg acccccgaggacatctaccgtgtcattcccctgtgcctgcgccaccgcctccggaaagac cccctggctgagatc gacgacggtgaccgcgtgcgtgagatcttcaagcaggtgttcggcatggagtaa
Magnesium Chelatase subunit 1 (CHLI1) Chlamydomonas reinhardtii amino acid sequence (SEQ ID NO: 22):
MALNMRVSSSKVAAKQQGRISAVPWSSKVASSARVAPFQGAPVAAQRAALLVRAAAATEV KAAEGRTEKELGQA RPIFPFTAIVGQDEMKLALILNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEMQWAND PFNSDPTDPELMSE EVRNRVKAGEQLPVSSKKIPMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR GILYVDEVNLLDDHL VDVLLDSAASGWNTVEREGISISHPARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKD PRLRVQIVSQRSTFD ENPAAFRKDYEAGQMALTQRIVDARKLLKQGEVNYDFRVKISQICSDLNVDGIRGDIVTN RAAKALAAFEGRTEV TPEDIYRVIPLCLRHRLRKDPLAEIDDGDRVREIFKQVFGME Magnesium Chelatase sunubitl (CHLI2) Chlamydomonas reinhardtii nucleic acid sequence (SEQ ID NO: 23):
atgcagagtctccagggtcagcgcgcgttcactgcggtgcgccagggtcgggcgggt cccctgcggactcgcctg gtcgtgcgctcgtctgttgccttgccatccacgaaagccgcgaagaagccgaacttcccg ttcgtcaagattcag ggccaggaggagatgaagcttgcactgctgctgaacgtggtcgaccccaacatcggcgga gtgcttattatgggt gaccgcggcactgccaagtcggtcgcggtccgcgccctggtggatatgcttcccgacatt gacgtggttgagggc gacgccttcaacagctcccccaccgaccccaagttcatgggccccgacaccctgcagcgc ttccgcaacggcgag aagctgcccaccgtccgcatgcggacccccctggtggagctgcctctgggcgccaccgag gaccgcatctgcggc accatcgacatcgagaaggcgctgacgcagggcatcaaggcctacgagcccggcctgctg gccaaggccaaccgc ggcatcctgtatgtggacgaggtgaacctgctggatgatggcctggttgatgtcgtgctg gactcgtcggctagc ggcctgaacactgtggagcgtgagggtgtgtccattgtgcaccctgcccgcttcatcatg attggctcaggcaac ccccaggagggtgagctgcgcccgcagctgctggatcgcttcggcatgagcgtcaacgtg gccacgctgcaggac accaagcagcgcacgcagctggtgctggaccggcttgcgtacgaggcggaccctgacgca tttgtggactcgtgc aaggccgagcagacggcgctcacggacaagctggaggcggcccgccagcgcctgcggtcc gtcaagatcagcgag gagctgcagatcctgatctcggacatttgctcgcgcctggatgtggatggcctgcgcggt gacattgtgatcaac cgcgccgccaaggcgcttgtggccttcgagggccgcaccgaggtgaccacgaatgacgtg gagcgcgtcatctcg ggctgcctcaaccaccgcctgcgcaaggacccgctggaccccattgacaacggcaccaag gtggccatcctgttc aagcgcatgaccgaccccgagatcatgaagcgcgaggaggaggccaagaagaagcgcgag gaggcggccgccaag gccaaggcggagggcaaggcggaccgccccacgggcgccaaggctggcgcctgggctggc ttgccccctcgtcgg taa
Magnesium Chelatase sunubitl (CHLI2) Chlamydomonas reinhardtii amino acid sequence (SEQ ID NO: 24):
MQSLQGQRAFTAVRQGRAGPLRTRLWRSSVALPSTKAAKKPNFPFVKIQGQEEMKLALLL NWDPNIGGVLIMG DRGTAKSVAVRALVDMLPDIDWEGDAFNSSPTDPKFMGPDTLQRFRNGEKLPTVRMRTPL VELPLGATEDRICG TIDIEKALTQGIKAYEPGLLAKANRGILYVDEVNLLDDGLVDVVLDSSASGLNTVEREGV SIVHPARFIMIGSGN PQEGELRPQLLDRFGMSVNVATLQDTKQRTQLVLDRLAYEADPDAFVDSCKAEQTALTDK LEAARQRLRSVKISE ELQILISDICSRLDVDGLRGDIVINRAAKALVAFEGRTEVTTNDVERVISGCLNHRLRKD PLDPIDNGTKVAILF KRMTDPEIMKREEEAKKKREEAAAKAKAEGKADRPTGAKAGAWAGLPPRR
Magnesium Chelatase subunit D (CHLD) Chlamydomonas reinhardtii nucleic acid sequence (SEQ ID NO: 25):
atgaagtctctctgccatgagctcgctggccccagcgttactgggtgcggccggcga agcctccggaaggctttc agcggtgccaagattgcgcaggtctctcgccccgctgtgcttaacagcgtgcagcgccaa cagcgtctcgcctgt tctgccgtggccgagctctccgctgctgagctgcgcgccatgaaggtgtctgaggaggac tccaagggcttcgat gcggatgtgtcgacccgcctggcccgctcgtaccctctggcggccgtggtgggccaggac aacatcaagcaggcg ctgctgctgggcgccgtggacaccgggctgggcggcatcgccatcgccggtcgccgcggt accgccaagtccatc atggctcgcggcctgcacgctctgctgccgcccattgaggtggtggagggcagcatctgc aacgccgaccccgag gacccccgctcctgggaggctggcctggctgagaagtatgcgggcggccctgtgaagacc aagatgcgctcggcg ccgtttgtgcagatccctctgggtgtgactgaggaccgcttggtgggcactgtggacatt gaggcgtccatgaag gagggcaagactgtgttccagcccggcctgctggctgaggcgcaccgcggcatcctgtac gtggacgagatcaac ctgctggatgacggcattgccaacctgctgctgtccatcctgtcggacggagtcaacgtg gtggagcgcgagggc atctccatcagccacccctgccggccgctgctgattgccacctacaaccccgaggagggc cctctgcgtgagcac ctgctggaccgcatcgccattggcctcagcgccgacgtccccagcaccagcgacgagcgc gtcaaggccattgac gcagccatccgcttccaggacaagccgcaggacactattgacgacaccgcggagctcacc gacgccctgcgcacc tcggtcatcctggctcgcgagtacctgaaggacgtgaccatcgcgccggagcaggtgacc tacattgtggaggag gcgcgccgcggcggagtccaggggcaccgcgcggagctgtacgcggtcaagtgtgccaag gcgtgtgcggctctg gagggccgtgagcgtgtgaacaaggatgacctgcgccaggccgtgcagctggtcatcctg ccgcgcgccaccatc ctggaccagcccccgcccgagcaggagcagcccccgccgccgcccccgccccctcccccg ccgccgccgcaggac caaatggaggacgaggaccaggaggagaaggaggacgagaaggaggaggaggagaaggag aacgaggaccaggac gagcccgagatccctcaggagttcatgtttgagtccgagggcgtcatcatggacccctcc atcctcatgttcgcg cagcagcagcagcgcgcgcagggccgctccggccgcgccaagacgctcatcttcagcgac gaccgcggccgctac atcaagcccatgctgcccaagggtgacaaggtcaagcgcctggcagtggacgccacgctt cgcgccgccgcgccc taccagaagattcgccggcagcaggccatcagcgagggcaaggtgcagcgcaaggtgtac gtggacaagccagac atgcgctccaagaagctggcccgcaaggccggtgcgctggtgatttttgttgtggacgcg tccggctccatggct ctgaaccgcatgagcgccgccaagggcgcctgcatgcgcctgctggctgagtcgtacacc agccgcgaccaggtg tgcctcatccccttctacggcgacaaggccgaggtgctgctgccgccctccaagtccatc gccatggcccgccgc cgcctggactcgctgccctgcggcggcggctcgccccttgcgcacggcctgtccacggcg gtacgtgtgggcatg caggccagccaggcgggcgaggtgggccgcgtcatgatggtgctcatcacggacggccgc gccaacgtcagcctg gccaagtccaacgaggaccccgaggcgctcaagcccgacgcgcccaagcccaccgccgac tcgctgaaggacgag gtgcgcgacatggccaagaaggccgcgtccgccggcatcaacgtgcttgtcattgacacg gagaacaagttcgtg agcaccggctttgcggaggagatctccaaggcagcgcagggcaagtactactacctgccc aacgccagcgacgcc gccatcgcggcggccgcgtccggcgccatggccgcggccaagggcggctactag
Magnesium Chelatase subunit D (CHLD) Chlamydomonas reinhardtii amino acid sequence (SEQ ID NO: 26):
MKSLCHELAGPSVTGCGRRSLRKAFSGAKIAQVSRPAVLNSVQRQQRLACSAVAELSAAE LRAMKVSEEDSKGFD ADVSTRLARSYPLAAWGQDNIKQALLLGAVDTGLGGIAIAGRRGTAKSIMARGLHALLPP IEWEGSICNADPE DPRSWEAGLAEKYAGGPVKTKMRSAPFVQIPLGVTEDRLVGTVDIEASMKEGKTVFQPGL LAEAHRGILYVDEIN LLDDGIANLLLSILSDGVNWEREGISISHPCRPLLIATYNPEEGPLREHLLDRIAIGLSA DVPSTSDERVKAID AAIRFQDKPQDTIDDTAELTDALRTSVILAREYLKDVTIAPEQVTYIVEEARRGGVQGHR AELYAVKCAKACAAL EGRERVNKDDLRQAVQLVILPRATILDQPPPEQEQPPPPPPPPPPPPPQDQMEDEDQEEK EDEKEEEEKENEDQD EPEIPQEFMFESEGVIMDPSILMFAQQQQRAQGRSGRAKTLIFSDDRGRYIKPMLPKGDK VKRLAVDATLRAAAP YQKIRRQQAISEGKVQRKVYVDKPDMRSKKLARKAGALVIFWDASGSMALNRMSAAKGAC MRLLAESYTSRDQV CLIPFYGDKAEVLLPPSKSIAMARRRLDSLPCGGGSPLAHGLSTAVRVGMQASQAGEVGR VMMVLITDGRANVSL AKSNEDPEALKPDAPKPTADSLKDEVRDMAKKAASAGINVLVIDTENKFVSTGFAEEISK AAQGKYYYLPNASDA AIAAAASGAMAAAKGGY
Magnesium Chelatase subunit H (CHLH1) Chlamydomonas reinhardtii nucleic acid sequence (SEQ ID NO: 27):
atgcagacttcctcgcttcttggccggcgcacggcccacccggctgcgggcgcgacg cccaagccggttgcgccc tcgccccgcgtggctagcacccgccaggtcgcgtgcaatgtggcgactggaccccggccg cccatgaccaccttc accggtggcaacaagggccctgctaagcagcaggtgtcgctggatctgcgcgacgagggc gctggcatgttcacc agcaccagcccggagatgcgccgtgtcgtccctgacgatgtgaagggtcgcgttaaggtg aaggttgtgtacgtg gtgctggaggcccagtaccagtcggccatcagcgctgcggtgaagaacatcaacgccaag aactccaaggtgtgc ttcgaggtggtgggctacctgctggaggagctgcgtgaccagaagaacctcgatatgctc aaggaggatgtggcc tctgccaacatcttcatcggctcgctcatcttcattgaggagcttgccgagaagattgtg gaggcggtgagcccc ctgcgcgagaagctggacgcgtgcctgatcttcccgtccatgccggcggtcatgaagctg aacaagctgggcacg ttttcgatggctcagctgggccagtcgaagtcggtgttctcggagttcatcaagtctgct cgcaagaacaacgac aacttcgaggagggcttgctgaagctggtgcgcaccctgcctaaggtgctgaagtatctg ccctcggacaaggcg caggacgccaagaacttcgtgaacagcctgcagtactggctgggcggtaactcggacaac ctggagaacctgctg ctgaacaccgtcagcaactacgtgcccgctctgaagggcgtggacttcagcgtggctgag cccaccgcctacccc gatgtgggtatctggcaccctctggcctcgggcatgtacgaggacctgaaggagtacctg aactggtacgacacc cgcaaggacatggtcttcgccaaggacgcccccgtcattggcctggtgctgcagcgctcg cacctggtgactggc gatgagggccactacagcggcgtggtcgctgagctggagagccgcggtgctaaggtcatc cccgtctttgccggt ggcctggacttctccgcccccgtcaagaagttcttctacgaccccctgggctctggccgc acgttcgtggacacc gttgtgtcgctgaccggcttcgcgctggtgggcggccccgcgcgccaggacgcgccgaag gccattgaggcgctg aagaacctgaacgtgccctacctggtgtcgctgccgctggtgttccagaccactgaggag tggctggacagcgag ctgggcgtgcaccccgtccaggtggctctgcaggttgccctgcccgagctggatggtgcc atggagcccatcgtg ttcgctggccgtgactcgaacaccggcaagtcgcactcgctgcccgaccgcatcgcttcg ctgtgcgctcgcgcc gtgaactgggccaacctgcgcaagaagcgcaacgccgagaagaagctggccgtcaccgtg ttcagcttcccccct gacaagggcaacgtcggcactgccgcctacctgaacgtgttcggctccatctaccgcgtg ctgaagaacctgcag cgcgagggctacgacgtgggcgccctgccgccctcggaggaggatctgatccagtcggtg ctgacccagaaggag gccaagttcaactcgaccgacctgcacatcgcctacaagatgaaggtggacgagtaccag aagctgtgcccttac gccgaggcgctggaggagaactggggcaagccccccggcaccctgaacaccaacggccag gagctgctggtgtac ggccgccagtacggcaacgtcttcatcggcgtgcagcccaccttcggctacgagggcgac ccgatgcgcctgctg ttctcgaagtcggccagcccccaccacggcttcgccgcctactacaccttcctggagaag atcttcaaggccgac gccgtgctgcacttcggcacccacggctcgctggagttcatgcccggcaagcaggtcggc atgtcgggtgtgtgc taccccgactcgctgatcggcaccatccccaacctctactactacgccgccaacaacccg tctgaggccaccatc gccaagcgccgctcgtacgccaacaccatttcgtacctgacgccgcctgccgagaacgcc ggcctgtacaagggc ctgaaggagctgaaggagctgatcagctcgtaccagggcatgcgtgagtctggccgcgcc gagcagatctgcgcc accatcattgagaccgccaagctgtgcaacctggaccgcgacgtgaccctgcccgacgct gacgccaaggacctg accatggacatgcgcgacagcgttgtgggccaggtgtaccgcaagctgatggagattgag tcccgcctgctgccc tgcggcctgcacgtggtgggctgcccgcccaccgccgaggaggccgtggccaccctggtc aacatcgctgagctg gaccgcccggacaacaacccccccatcaagggcatgcccggcatcctggcccgcgccatt ggtcgcgacatcgag tcgatttacagcggcaacaacaagggcgtcctggctgacgttgaccagctgcagcgcatc accgaggcctcccgc acctgcgtgcgcgagttcgtgaaggaccgcaccggcctgaacggccgcatcggcaccaac tggatcaccaacctg ctcaagttcaccggcttctacgtggacccctgggtgcgcggcctgcagaacggcgagttc gccagcgccaaccgc gaggagctgatcaccctgttcaactacctggagttctgcctgacccaggtggtcaaggac aacgagctgggcgcc ctggtagaggcgctgaacggccagtacgtcgagcccggccccggcggtgaccccatccgc aaccccaacgtgctg cccaccggcaagaacatccacgccctggaccctcagtcgattcccactcaggccgcgctg aagagcgcccgcctg gtggtggaccgcctgctggaccgcgagcgcgacaacaacggcggcaagtaccccgagacc atcgcgctggtgctg tggggcactgacaacatcaagacctacggcgagtcgctggcccaggtcatgatgatggtc ggtgtcaagcccgtg gccgacgccctgggccgcgtgaacaagctggaggtgatccctctggaggagctgggccgc ccccgcgtggacgtg gttgtcaactgctcgggtgtgttccgcgacctgttcgtgaaccagatgctgctgctggac cgcgccatcaagctg gcggccgagcaggacgagcccgatgagatgaacttcgtgcgcaagcacgccaagcagcag gcggcggagctgggc ctgcagagcctgcgcgacgcggccacccgtgtgttctccaacagctcgggctcctactcg tccaacgtcaacctg gcggtggagaacagcagctggagcgacgagtcgcagctgcaggagatgtacctgaagcgc aagtcgtacgccttc aactcggaccgccccggcgccggtggcgagatgcagcgcgacgtgttcgagacggccatg aagaccgtggacgtg accttccagaacctggactcgtccgagatctcgctgaccgatgtgtcgcactacttcgac tccgaccccaccaag ctggtggcgtcgctgcgcaacgacggccgcacccccaacgcctacatcgccgacaccacc accgccaacgcgcag gtccgcactctgggtgagaccgtgcgcctggacgcccgcaccaagctgctcaaccccaag tggtacgagggcatg cttgcctcgggctacgagggcgtgcgcgagatccagaagcgcatgaccaacaccatgggc tggtcggccacctcg ggcatggtggacaactgggtgtacgacgaggccaactcgaccttcatcgaggatgcggcc atggccgagcgcctg atgaacaccaaccccaacagcttccgcaagctggtggccaccttcctggaggccaacggc cgcggctactgggac gccaagcccgagcagctggagcgcctgcgccagctgtacatggacgtggaggacaagatt gagggcgtcgaataa
Magnesium Chelatase subunit H (CHLH1) Chlamydomonas reinhardtii amino acid sequence (SEQ ID NO: 28):
MQTSSLLGRRTAHPAAGATPKPVAPSPRVASTRQVACNVATGPRPPMTTFTGGNKGPAKQ QVSLDLRDEGAGMFT STSPEMRRWPDDVKGRVKVKVVYWLEAQYQSAISAAVKNINAKNSKVCFEWGYLLEELRD QKNLDMLKEDVA SANIFIGSLIFIEELAEKIVEAVSPLREKLDACLIFPSMPAVMKLNKLGTFSMAQLGQSK SVFSEFIKSARKNND NFEEGLLKLVRTLPKVLKYLPSDKAQDAKNFVNSLQYWLGGNSDNLENLLLNTVSNYVPA LKGVDFSVAEPTAYP DVGIWHPLASGMYEDLKEYLNWYDTRKDMVFAKDAPVIGLVLQRSHLVTGDEGHYSGWAE LESRGAKVIPVFAG GLDFSAPVKKFFYDPLGSGRTFVDTWSLTGFALVGGPARQDAPKAIEALKNLNVPYLVSL PLVFQTTEEWLDSE LGVHPVQVALQVALPELDGAMEPIVFAGRDSNTGKSHSLPDRIASLCARAVNWANLRKKR NAEKKLAVTVFSFPP DKGNVGTAAYLNVFGSIYRVLKNLQREGYDVGALPPSEEDLIQSVLTQKEAKFNSTDLHI AYKMKVDEYQKLCPY AEALEENWGKPPGTLNTNGQELLVYGRQYGNVFIGVQPTFGYEGDPMRLLFSKSASPHHG FAAYYTFLEKIFKAD AVLHFGTHGSLEFMPGKQVGMSGVCYPDSLIGTIPNLYYYAANNPSEATIAKRRSYANTI SYLTPPAENAGLYKG LKELKELISSYQGMRESGRAEQICATIIETAKLCNLDRDVTLPDADAKDLTMDMRDSWGQ VYRKLMEIESRLLP CGLHWGCPPTAEEAVATLVNIAELDRPDNNPPIKGMPGILARAIGRDIESIYSGNNKGVL ADVDQLQRITEASR TCVREFVKDRTGLNGRIGTNWITNLLKFTGFYVDPWVRGLQNGEFASANREELITLFNYL EFCLTQWKDNELGA LVEALNGQYVEPGPGGDPIRNPNVLPTGKNIHALDPQSIPTQAALKSARLWDRLLDRERD NNGGKYPETIALVL WGTDNIKTYGESLAQVMMMVGVKPVADALGRVNKLEVIPLEELGRPRVDVVVNCSGVFRD LFVNQMLLLDRAIKL AAEQDEPDEMNFVRKHAKQQAAELGLQSLRDAATRVFSNSSGSYSSNVNLAVENSSWSDE SQLQEMYLKRKSYAF NSDRPGAGGEMQRDVFETAMKTVDVTFQNLDSSEISLTDVSHYFDSDPTKLVASLRNDGR TPNAYIADTTTANAQ VRTLGETVRLDARTKLLNPKWYEGMLASGYEGVREIQKRMTNTMGWSATSGMVDNWVYDE ANSTFIEDAAMAERL MNTNPNSFRKLVATFLEANGRGYWDAKPEQLERLRQLYMDVEDKIEGVE
Photochlorophyllide reductase subunit B (chlB) nucleic acid sequence (SEQ ID NO:
29):
atgaaattagcttattggatgtacgcaggtcccgctcatatcggtgtgttgcgtgtt agcagctcttttaaaaat gtacatgccattatgcatgctcctttaggagatgattattttaatgtaatgcgttccatg ttagaacgtgaacgt gattttacaccagtaacagccagtattgtagatcgtcatgttttagcaagaggatcgcaa gaaaaagtggttgaa aatattacgcgaaaaaataaagaagaaactcctgatttaattttattaactcctacttgt acgtcaagcatttta caagaagatttacacaattttgttgaatcggcattagctaaaccagtacaaatagatgaa catgcagaccataaa gtaactcaacaaagtgcactttcaagtgtatcccctttactaccgcttgaagaaaataca ttaatagtaagtgaa ctagataagaagcttagcccgtctagcaagttgcatattaatatgcccaatatttgtatt cccgaaggagaaggg gaaggggagcagactaaaaattcaatttttgttaaatctgcaactttaacaaatttgtca gaagaggaactatta aatcaagaacatcataccaaaacaagaaatcactctgacgttattttagctgatgtaaac cattatcgtgtaaat gaattacaagctgcagatcgtactcttgaacaaattgtacgttattatatttctcaagca caaaaacaaaattgt ttaaacattactaaaacagccaaaccatctgtaaatattattggtatttttactttgggt tttcataatcaacat gattgtcgtgaattaaaacgtttatttaatgatttaggtattcaaatcaatgaaatcata cctgaaggcggaaat gtacacaacttaaaaaaattaccccaagcttggtttaattttgtgccctaccgtgaaatt ggcttaatgactgct atgtatttaaaatccgagtttaatatgccttacgtcgcaattactcctatgggattaatt gatacggctgcttgt attcgttcaatttgtaaaatcattacaactcaattattaaatcagacggctacagtgcag gagccatcaaaattt atttacccgaaggcgacgtcattagaacaaaccaatattctcgaaacctctcaaaaagaa actattcttaaagac aatccagatagcggaaataccctttctacaactgtagaagaaattgaaactttatttaat aaatatatcgatcaa caaactcgttttgtttcccaagcagcctggttttcacgttctattgactgtcaaaattta acaggtaaaaaagcc gtagttttcggagatgctacacattcagctgccatgacaaaattattagcacgtgaaatg ggtattaaggtttca tgcgctggaacttattgcaaacacgatgcggattggtttagagagcaagttagtgggttt tgtgatcaagtttta attaccgatgatcacacacaagtaggggatatgattgcacaattagaacctgcagccatt tttgggacacaaatg gaacgtcacgttggtaaacgtttagatattccatgtggtgttatatctgctcctgtgcat attcaaaactttccg ttaggttatcgaccttttttaggttatgaaggtacaaatcaaatagctgatttagtgtat aattcatttaatctt ggaatggaagaccatttattacaaatttttggaggtcatgattcagaaaacaattcgtca attgcaacgcatttg aatacaaataacgcaataaatttagcgccaggatatttacctgagggagaaggcagtagt agaacttcaaatgta gtgtctacaatttctagtgaaaaaaaagccattgtatggtctccagaaggtttagcagaa ttaaataaagtccca ggatttgttcgaggaaaagttaaacgtaatacggaaaaatatgctttacaaaaaaattgt tcgatgattactgta gaagttatgtatgcagcaaaagaagctttgtcggcttaa
Photochlorophyllide reductase subunit B (chlB) amino acid sequence (SEQ ID NO: 30):
MKLAYWMYAGPAHIGVLRVSSSFKNVHAIMHAPLGDDYFNVMRSMLERERDFTPVTA SIVDRHVLARGSQEKWE
NITRKNKEETPDLILLTPTCTSSILQEDLHNFVESALAKPVQIDEHADHKVTQQSAL SSVSPLLPLEENTLIVSE
LDKKLSPSSKLHINMPNICIPEGEGEGEQTKNSIFVKSATLTNLSEEELLNQEHHTK TRNHSDVILADVNHYRVN
ELQAADRTLEQIVRYYISQAQKQNCLNITKTAKPSVNIIGIFTLGFHNQHDCRELKR LFNDLGIQINEIIPEGGN
VHNLKKLPQAWFNFVPYREIGLMTAMYLKSEFNMPYVAITPMGLIDTAACIRSICKI ITTQLLNQTATVQEPSKF
IYPKATSLEQTNILETSQKETILKDNPDSGNTLSTTVEEIETLFNKYIDQQTRFVSQ AAWFSRSIDCQNLTGKKA
WFGDATHSAAMTKLLAREMGIKVSCAGTYCKHDADWFREQVSGFCDQVLITDDHTQV GDMIAQLEPAAIFGTQM
ERHVGKRLDIPCGVISAPVHIQNFPLGYRPFLGYEGTNQIADLVYNSFNLGMEDHLL QIFGGHDSENNSSIATHL
NTNNAINLAPGYLPEGEGSSRTSNWSTISSEKKAIVWSPEGLAELNKVPGFVRGKVK RNTEKYALQKNCSMITV
EVMYAAKEALSA
Photochlorophyllide reductase subunit L (chIL) nucleic acid sequence (SEQ ID NO:
31):
atgaaattagctgtttacggaaaaggtggtattggaaaatcaacgacaagttgtaat atttcgattgctttacga aaacgtggtaaaaaagtgttacaaattggttgtgatcctaaacatgatagtacttttaca ttgacagggttttta attccaaccattattgatacattaagttctaaagattatcattatgaagatatttggccc gaagatgttatttac ggaggttatgggggtgtagattgtgttgaagctggaggaccacctgccggtgcggggtgt ggtggttatgttgta ggtgaaacggtaaaacttttaaaagagttaaatgcttttttcgaatacgatgttatttta tttgatgttttaggt gatgttgtttgtggtggctttgctgctccattaaactacgctgattattgtattattgta actgataatggtttt gatgctttatttgctgcaaatcgtattgcagcttcagttcgtgaaaaagcacgtacacat ccattgcgtttagcg ggtttaatcggaaatcgtacatcaaaacgtgatttaattgataaatatgtagaagcttgt cctatgccagtatta gaagttttaccattaattgaagaaattcgtatttcacgtgttaaaggcaaaactttattt gaaatgtcaaataaa aataatatgacttcggctcatatggatggctctaaaggtgacaattctacagtaggagtg tcagaaactccatcg gaagattatatttgtaatttttatttaaatattgctgatcaattattaacagaaccagaa ggagttattccacgt gaattagcagataaagaactttttactcttttatcagatttctatcttaaaatttaa
Photochlorophyllide reductase subunit L (chIL) amino acid sequence (SEQ ID NO: 32):
MKLAVYGKGGIGKSTTSCNISIALRKRGKKVLQIGCDPKHDSTFTLTGFLIPTI IDTLSSKDYHYEDIWPEDVIY GGYGGVDCVEAGGPPAGAGCGGYWGETVKLLKELNAFFEYDVILFDVLGDWCGGFAAPLN YADYCI IVTDNGF DALFAANRIAASVREKARTHPLRLAGLIGNRTSKRDLIDKYVEACPMPVLEVLPLIEEIR ISRVKGKTLFEMSNK NNMTSAHMDGSKGDNSTVGVSETPSEDYICNFYLNIADQLLTEPEGVIPRELADKELFTL LSDFYLKI Photochlorophyllide reductase subunit N (chlN) nucleic acid sequence (SEQ ID NO:
33):
atgttagatggtgccacaacgattttaaatttaaatagtttttttgaatgtgaaact ggcaattatcatactttt tgcccgattagctgtgtagcttggttatatcaaaaaatcgaagatagcttttttttagta attgggacaaaaaca tgtggttattttttacaaaatgcccttggagttatgatttttgccgaacctaggtatgct atggcagaattagaa gaaagtgatatttcagcacaattaaacgattataaagaattaaaacgtttatgtttacaa attaaacaagataga aatcccagcgttattgtttggattggaacttgtacaactgaaattatcaaaatggattta gaagggatggctcca cgtttagaaactgaaatcggcatacccattgttgtagcacgtgctaatggtttagattat gcttttacacaaggt gaagacacagttttatcagcaatggccttagcatccttaaaaaaagatgttcctttttta gtaggtaatactggg ttaacaaacaaccagcttctccttgaaaaatcaacttcttcagttaatgggacagacgga aaggaattacttaaa aaatctcttgtattatttggttccgtaccaagtacagttactacacaattaactttagaa ttaaaaaaagaaggt attaatgtatctggatggcttccatctgctaattataaagatttacctacttttaataaa gatacacttgtatgt ggtataaatccttttttaagtcgaacagctaccacgttaatgcgtcgtagtaagtgcaca ttaatttgtgcaccc tttccaataggccccgatggcacaagagtttggattgaaaaaatttgtggtgcttttggc attaatcctagtctt aatccaattactggtaatactaatttatatgatcgtgaacaaaaaattttcaacgggcta gaagattatttaaaa ttattacgtggaaaatctgtattttttatgggtgataatttattagaaatttctttagca cgttttttaacacgt tgtggtatgattgtttatgaaatcggaattccatatttagataaacgatttcaagcagca gaattagctttatta gaacaaacttgtaaagaaatgaatgtaccaatgccgcgcattgtagaaaaaccagataat tattatcaaattcga cgtatacgtgaattaaaacctgatttaacgattactggaatggcacatgcaaatccatta gaagctcgaggtatt acaacaaaatggtcagttgaatttacttttgctcaaattcatggatttactaatacacgt gaaattttagaatta gtaacacagcctcttagacgcaatctaatgtcaaatcaatctgtaaatgctatttcttaa
Photochlorophyllide reductase subunit N (chlN) amino acid sequence (SEQ ID NO: 34):
MLDGATTILNLNSFFECETGNYHTFCPISCVAWLYQKIEDSFFLVIGTKTCGYFLQN ALGVMIFAEPRYAMAELE ESDISAQLNDYKELKRLCLQIKQDRNPSVIVWIGTCTTEIIKMDLEGMAPRLETEIGIPI WARANGLDYAFTQG EDTVLSAMALASLKKDVPFLVGNTGLTNNQLLLEKSTSSVNGTDGKELLKKSLVLFGSVP STVTTQLTLELKKEG INVSGWLPSANYKDLPTFNKDTLVCGINPFLSRTATTLMRRSKCTLICAPFPIGPDGTRV WIEKICGAFGINPSL NPITGNTNLYDREQKIFNGLEDYLKLLRGKSVFFMGDNLLEISLARFLTRCGMIVYEIGI PYLDKRFQAAELALL EQTCKEMNVPMPRIVEKPDNYYQIRRIRELKPDLTITGMAHANPLEARGITTKWSVEFTF AQIHGFTNTREILEL VTQPLRRNLMSNQSVNAIS
Porphobilinogen deaminase (PBGD1) nucleic acid sequence (SEQ ID NO: 35):
atgcagcagtgcgttggccgctccgtccgcgctccgtccagcagggcggtcgcgccc aaggtcgctggcgctcgt gtcagccgccgcgtgtgccgcgtctatgcctccgctgttgctaccaagacggtgaagatt ggcacgcgcggctcg cccctggctctggcccaggcttacatgactcgcgacctgctgaagaagagcttccctgag ctgagcgaggagggt gctctggagatcgtgatcatcaagaccaccggtgacaaaatcctgaaccagcccctggct gacatcggtggcaag ggtctgtttaccaaggagatcgatgatgctctgctgagcggcaagattgacatcgccgtg cactccatgaaggac gtgcccacctacctgcccgagggcaccatcctgccctgcaacctgccccgcgaggatgtg cgcgatgtgttcatc tcgcctgtcgccaaggacctgagcgagctgcccgccggcgccattgtgggctcggcctcg ctgcgccgtcaggcc cagatcctggccaagtacccccacctcaaggtggagaacttccgcggcaacgtgcagacc cgcctgcgcaagctg aacgagggcgcctgctccgccaccctgctggctctggccggtctgaagcgcctggacatg actgagcacatcacc aagaccctcagcattgacgagatgctgcccgccgtgagccagggcgccattggcattgcc tgccgcaccgacgac ggcgccagccgcaacctgctggccgccctgaaccacgaggagacccgcatcgccgtggtg tgcgagcgcgccttc ctgaccgccctggacggctcttgccgcacccccattgccggctacgcgcacaagggcgcc gacggcatgctgcac ttcagcggcctggtggccaccccggacggcaagcagatcatgcgcgctagccgcgtggtg cccttcacggaggcg gatgccgtcaagtgcggcgaggaggccggcaaggagctcaaggccaacggccccaaggag ctgttcatgtactaa
Porphobilinogen deaminase (PBGD1) amino acid sequence (SEQ ID NO: 36):
MQQCVGRSVRAPSSRAVAPKVAGARVSRRVCRVYASAVATKTVKIGTRGSPLALAQAYMT RDLLKKSFPELSEEG ALEIVI IKTTGDKILNQPLADIGGKGLFTKEIDDALLSGKIDIAVHSMKDVPTYLPEGTILPCNLP REDVRDVFI SPVAKDLSELPAGAIVGSASLRRQAQILAKYPHLKVENFRGNVQTRLRKLNEGACSATLL ALAGLKRLDMTEHIT KTLSIDEMLPAVSQGAIGIACRTDDGASRNLLAALNHEETRIAWCERAFLTALDGSCRTP IAGYAHKGADGMLH FSGLVATPDGKQIMRASRWPFTEADAVKCGEEAGKELKANGPKELFMY Porphobilinogen deaminase (PBGD2) nucleic acid sequence (SEQ ID NO: 37)
atgcgatcgtatctgctcaaggctcaagtggcctcatgtcagttttcgcgcacgtcg aaggtctggagactggcg ccgggttctgacagacgacggtgtcggggcctcactcggacaccgcactgcgcggccccc accagcgagcccgcc ccgccatccagcagcggcaagagcgggcaacgaccactcgtgatagccacgcggccatct aagcttgcaaaggag cagacgcggcaggtgcagcagctgctgctggcggcggcgcagctcaaggacgagcagctg cagctgagcaccctg gaactggcgtctaggggcgacacgactcagggtgtgtcgctgcgcagtctgggctcgggc gcattcaccgaggag ctggaccaggctgtgctgtcgggcgctgccgacatgtcggtgcacagcctgaaggactgc cccgccgccctggcg cccgggctgctgctggccgcctgcctgccgcgggccgacccccgggacgtcctcatcgcg cccgaggccacctcg ctgggcgagctggtgccgggcagccgtgtgggcaccagcagcagccgccgcgcggcgcag atcaagcactccttc ccccacctgcaggttgtgcagctgcgcggcaatgtggactcgcggctggggcgcatccgc agccgcgacatcggc gccacagtgctggcggcggcgggcctcaagcggctgggtgtgatgaactcggacgagggt gacactaccgctacg ggcgccgtgggggtggtgtgcagggcagacgatgagtgggtggtcggcctgctggacgcc atctcgcaccgcggc acggccctggaggtggcggcggagcgggcgtgcctggcagcgctgctgggcggcggcggc gcgtgccagcgttca gcgttcccggacattgcgtgggcctgccacacgcggcacgaccccgacagcaacacaatg gacctggattgcctg gtggcggacctggagggcaaggagctcttcaggtacacggagttctaccggccggtcatt gacgaggtggacgcg gtgtcgctggggtcgctgtacggcagcctgctgcgcatgatggcgccaccaggcgcggcc ccctgttggcagcta ccttcctcgcggcattag
Porphobilinogen deaminase (PBGD2) amino acid sequence (SEQ ID NO: 38):
MRSYLLKAQVASCQFSRTSKWRLAPGSDRRRCRGLTRTPHCAAPTSEPAPPSSSGKSGQR PLVIATRPSKLAKE
QTRQVQQLLLAAAQLKDEQLQLSTLELASRGDTTQGVSLRSLGSGAFTEELDQAVLS GAADMSVHSLKDCPAALA
PGLLLAACLPRADPRDVLIAPEATSLGELVPGSRVGTSSSRRAAQIKHSFPHLQWQL RGNVDSRLGRIRSRDIG
ATVLAAAGLKRLGVMNSDEGDTTATGAVGWCRADDEWWGLLDAISHRGTALEVAAER ACLAALLGGGGACQRS
AFPDIAWACHTRHDPDSNTMDLDCLVADLEGKELFRYTEFYRPVIDEVDAVSLGSLY GSLLRMMAPPGAAPCWQL
PSSRH
Protoporphyrinogen oxidase (PPX1) nucleic acid sequence (SEQ ID NO: 39):
atgatgttgacccagactcctgggaccgccacggcttctagccggcggtcgcagatc cgctcggctgcgcacgtc tccgccaaggtcgcgcctcggcccacgccattctcggtcgcgagccccgcgaccgctgcg agccccgcgaccgcg gcggcccgccgcacactccaccgcactgctgcggcggccactggtgctcccacggcgtcc ggagccggcgtcgcc aagacgctcgacaatgtgtatgacgtgatcgtggtcggtggaggtctctcgggcctggtg accggccaggccctg gcggctcagcacaaaattcagaacttccttgttacggaggctcgcgagcgcgtcggcggc aacattacgtccatg tcgggcgatggctacgtgtgggaggagggcccgaacagcttccagcccaacgatagcatg ctgcagattgcggtg gactctggctgcgagaaggaccttgtgttcggtgaccccacggctccccgcttcgtgtgg tgggagggcaagctg cgccccgtgccctcgggcctggacgccttcaccttcgacctcatgtccatccccggcaag atccgcgccgggctg ggcgccatcggcctcatcaacggagccatgccctccttcgaggagagtgtggagcagttc atccgccgcaacctg ggcgatgaggtgttcttccgcctgatcgagcccttctgctccggcgtgtacgcgggcgac ccctccaagctgtcc atgaaggcggccttcaacaggatctggattctggagaagaacggcggcagcctggtggga ggtgccatcaagctg ttccaggaacgccagtccaacccggccccgccgcgggacccgcgcctgccgcccaagccc aagggccagacggtg ggctcgttccgcaagggcctgaagatgctgccggacgccattgagcgcaacatccccgac aagatccgcgtgaac tggaagctggtgtctctgggccgcgaggcggacgggcggtacgggctggtgtacgacacg cccgagggccgtgtc aaggtgtttgcccgcgccgtggctctgaccgcgcccagctacgtggtggcggacctggtc aaggagcaggcgccc gccgccgccgaggccctgggctccttcgactacccgccggtgggcgccgtgacgctgtcg tacccgctgagcgcc gtgcgggaggagcgcaaggcctcggacgggtccgtgccgggcttcggtcagctgcacccg cgcacgcagggcatc accactctgggcaccatctacagctccagcctgttccccggccgcgcgcccgagggccac atgctgctgctcaac tacatcggcggcaccaccaaccgcggcatcgtcaaccagaccaccgagcagctggtggag caggtggacaaggac ctgcgcaacatggtcatcaagcccgacgcgcccaagccccgtgtggtgggcgtgcgcgtg tggccgcgcgccatc ccgcagttcaacctgggccacctggagcagctggacaaggcgcgcaaggcgctggacgcg gcggggctgcagggc gtgcacctggggggcaactacgtcagcggtgtggccctgggcaaggtggtggagcacggc tacgagtccgcagcc aacctggccaagagcgtgtccaaggccgcagtcaaggcctaa
Protoporphyrinogen oxidase (PPX1) amino acid sequence (SEQ ID NO: 40):
MMLTQTPGTATASSRRSQIRSAAHVSAKVAPRPTPFSVASPATAASPATAAARRTLHRTA AAATGAPTASGAGVA
KTLDNVYDVIWGGGLSGLVTGQALAAQHKIQNFLVTEARERVGGNITSMSGDGYVWE EGPNSFQPNDSMLQIAV
DSGCEKDLVFGDPTAPRFVWWEGKLRPVPSGLDAFTFDLMSIPGKIRAGLGAIGLIN GAMPSFEESVEQFIRRNL
GDEVFFRLIEPFCSGVYAGDPSKLSMKAAFNRIWILEKNGGSLVGGAIKLFQERQSN PAPPRDPRLPPKPKGQTV GSFRKGLKMLPDAIERNIPDKIRVNWKLVSLGREADGRYGLVYDTPEGRVKVFARAVALT APSYWADLVKEQAP AAAEALGSFDYPPVGAVTLSYPLSAVREERKASDGSVPGFGQLHPRTQGITTLGTIYSSS LFPGRAPEGHMLLLN YIGGTTNRGIVNQTTEQLVEQVDKDLRNMVIKPDAPKPRWGVRVWPRAIPQFNLGHLEQL DKARKALDAAGLQG VHLGGNYVSGVALGKWEHGYESAANLAKSVSKAAVKA
Uroporphyrinogen III decarboxylase (UROD1) nucleic acid sequence (SEQ ID NO: 41): atgcagaccaaggctttcacctctgcgcgcccccagcgggccgctgcgctcaaggcgcag cgcacctcgtcggtg accgtgcgcgcgaccgcggcccccgccgtggcctctgcccccgccgcctcgggctctgcc tctgaccccctgatg ctgcgcgccatccgcggcgacaaggtggagcgcccgcccgtgtggatgatgcgccaggcc ggccgctaccagaag gtgtaccaggacctgtgcaagaagcaccccacgttccgtgagcgctcggagcgcgtggac ctggcggtggagatc tctctgcagccgtggcacgcgttcaagcccgacggcgtcatcctgttcagcgacattctg acccccctgcccggc atgaacatccccttcgacatggcgcccggccccatcatcatggaccccatccgcaccatg gcgcaagtggagaag gtgacgaagctggacgctgaggccgcctgccccttcgtgggcgagtcgctgcgccagctg cgcacctacatcggc aaccaggccgcggtcctgggcttcgtgggcgcccccttcaccctggccacctacattgtg gagggcggcagctcc aagaacttcgcgcacatcaagaagatggctttctccacccccgagatcctgcacgccctg ctggacaagctggct gacaacgtggccgactacgtccgctaccaggccgacgccggcgcccaggtggtgcagatc ttcgactcgtgggcc agcgagctgcagccccaggacttcgacgtgttctccggcccctacatcaagaaggtgatc gacagcgtgcgcaag acccaccccgacctgcccatcatcctctacatcagcggctctggcggcctgctggagcgc atggcctcttgctcg cccgacatcatctcgctggaccagtcggtggacttcaccgacggcgtcaagcgctgcggc accaacttcgccttc cagggcaacatggaccccggcgtcctgttcggctccaaggacttcatcgagaagcgcgtc atggacaccatcaag gctgcccgcgacgccgacgtgcgccacgtgatgaacctgggccacggcgtgctgcccggc acccccgaggaccac gtgggccactacttccacgtcgcccgcaccgcccacgagcgcatgtaa
Uroporphyrinogen III decarboxylase (UROD1) amino acid sequence (SEQ ID NO: 42):
MQTKAFTSARPQRAAALKAQRTSSVTVRATAAPAVASAPAASGSASDPLMLRAIRGD KVERPPVWMMRQAGRYQK VYQDLCKKHPTFRERSERVDLAVEISLQPWHAFKPDGVILFSDILTPLPGMNIPFDMAPG PI IMDPIRTMAQVEK VTKLDAEAACPFVGESLRQLRTYIGNQAAVLGFVGAPFTLATYIVEGGSSKNFAHIKKMA FSTPEILHALLDKLA DNVADYVRYQADAGAQWQIFDSWASELQPQDFDVFSGPYIKKVIDSVRKTHPDLPIILYI SGSGGLLERMASCS PDIISLDQSVDFTDGVKRCGTNFAFQGNMDPGVLFGSKDFIEKRVMDTIKAARDADVRHV MNLGHGVLPGTPEDH VGHYFHVARTAHERM
Uroporphyrinogen III synthase (HEM4) nucleic acid sequence (SEQ ID NO: 43):
atgtcggccctggacgccgccgccatcccctacgagctagtgccgggtgtgtcctcc gctctggccgccccgctg ttcgccggcgtcccgctcacacacgtcagcctgagcccctcgttcaccgtggtcagcggg cacgacgtggccggc accgactgggcggcgttccgggggctgcccacgctggtggttctgatggcgggtcgtaac ctggggcagatagcc cggcggcttgtgcaggacgcggggtgggcgcccgatacacctgtaagtcaacctagtggc tag
Uroporphyrinogen III synthase (HEM4) amino acid sequence (SEQ ID NO: 44):
MSALDAAAIPYELVPGVSSALAAPLFAGVPLTHVSLSPSFTWSGHDVAGTDWAAFRGLPT LWLMAGRNLGQIA RRLVQDAGWAPDTPVSQPSG
CHUD 5’ untranslated region (regulatory region) (SEQ ID NO: 45):
ggcgtccccacaaccaggacagcctacttcttgaccttattaataagtcgctgcgtg tcgcgactgaccattttg gcccggacttgcgtgcttgtgatttgtgcttcgactagatccgcgggcaccaagggacgc ggacagctgatagtc aagaactagatcctctgggagcgtctggggctgtccccgctgctcgccaaggaa
CHUD 3’ untranslated region (regulatory region) (SEQ ID NO: 46):
gtgccgagtgactgaggtggcaaggtgcagtggcggcggaggcagttgtgctggggt ggcaaggcggacaggcga agctggtgggttgcgacgaggaggaggtgcacgtgcacgcgtaacataagaagaacagtg ggaggacaggtagcg tgacttgactgggacgaggagcgtactgatgtgtggcgtgtgttggtatgtgagcgttac ccctcccctagatag cggcggtctccactttcaggaggatgagagccatcatgaggctttgagggggcactggtt cgtgtgtaggctgag gctgctgttgaagtcacaaggcagcactgcatgcgcgagtgagtgtggccggatatgcat cgagttgcaggtaca ctgaaatgaggtgactgcggcgtatatcgctgccagtacaggttgaagcggcgggcacgg tgaatggagtactcg gcctggaacgcttgcgatcagatggtcgagctcaagaagatttggttgagccgttgggtc gtgcgtcatattatg gcttgcatcttcggggagcggcaagaaacggactccaatgcaggccctcgggcgagaaag attgggcgtgtccgg gggtgcattctcgccgcgtggggctgcatcgaatttcgcttgagtgccccttcccgggga gggggggcggtagtt caaccccatcatcgtaggggggttgtaaatgccagcccaaactaaa
CHLD Exon 1 (SEQ ID NO: 47):
atgaagtctctctgccatgagctcgctggccccagcgttactgggtgcggccggcga agcctccggaaggctttc agcggtgccaagattgcgcaggtctctcgccccgctgtgcttaacagcgtgcagcgccaa cagcgtctcgcctgt tctgccgtggccgagctctccgctgctgagctgcgcg
CHLD Exon 2 (SEQ ID NO: 48):
ccatgaaggtgtctgaggaggactccaagggcttcgatgcggatgtgtcgacccgcc tggcccgctcgtaccctc tggcggccgtggtgggccaggacaacatcaagcaggcgctgctgctgggcgccgtggaca ccgggctgggcggca tcgccatcgccggtcgccgcggtaccgccaagtccatcatggctcgcggcctgcacgctc tgctgccgcccattg aggtggtggagggcagcatctgcaacgccgaccccgaggacccccgctcctgggag
CHLD Exon 3 (SEQ ID NO: 49):
gctggcctggctgagaagtatgcgggcggccctgtgaagaccaagatgcgctcggcg ccgtttgtgcagatccct ctgggtgtgactgaggaccgcttggtgggcactgtggacattgaggcgtccatgaag
CHLD exon 4 (SEQ ID NO: 50):
gagggcaagactgtgttccagcccggcctgctggctgaggcgcaccgcggcatcctg tacgtggacgagatcaac ctgctggatgacggcattgccaacctgctgctgtccatcctgtcggacggagtcaacgtg gtggagcgcgagggc atctccatcagccaccc
CHLD exon 5 (SEQ ID NO: 51):
ctgccggccgctgctgattgccacctacaaccccgaggagggccctctgcgtgagca cctgctggaccgcatcgc cattggcctcagcgccgacgtccccagcaccagcgacgagcgcgtcaaggc
cattgacgcagccatccgcttccaggacaagccgcag
CHLD exon 6 (SEQ ID NO: 52):
gacactattgacgacacc gcggagctcaccgacgccctgcgcacctcg
CHLD exon 7 (SEQ ID NO: 53):
gtcatcctggctcgcgagtacctgaaggacgtgaccatcgcgccggagcaggtgacc tacattgtggaggaggcg cgccgcggcggagtccaggggcacc gcgcggagctgtacgcggtcaag
CHLD exon 8 (SEQ ID NO: 54):
tgtgccaaggcgtgtgcggctctggagggccgtgagcgtgtgaacaaggatgacctg cgccaggccgtgcagctg gtcatcctgccgcgcgccaccatcctggaccagcccccgcccgagcaggagcagcccccg ccgccgcccccgccc cctcccccgccgccgccgcag
CHLD exon 9 (SEQ ID NO: 55):
gaccaaatggaggacgaggaccaggaggagaaggaggacgagaaggaggaggaggag aaggagaacgaggaccag gacgagcccgag CHLD exon 10 (SEQ ID NO: 56)
atccctcaggagttcatgtttgagtccgagggcgtcatcatggacccctccatcctc atgttcgcgcagcagcag cagcgcgcgcagggccgctccggccgcgccaagacgctcatcttcagcgacgaccgcggc cgctacatcaagccc atgctgcccaagggtgacaaggtcaagcgcctggcagtggacgccacgcttcgcgccgcc gcgccctaccagaag
CHLD exon 11 (SEQ ID NO: 57):
attcgccggcagcaggccatcagcgagggcaaggtgcagcgcaaggtgtacgtggac aagccagaca
CHLD exon 12 (SEQ ID NO: 58):
tgcgctccaagaagctggcccgcaaggccggtgcgctggtgatttttgttgtggacg cgtccggctccatggctc tgaaccgcatgagcgccgccaagggcgcctgcatgcgcctgctggctgagtcgtacacca gccgcgaccaggtgt gcctcatccccttctacggcgacaaggccgaggtgctgctgccgccctccaagtccatcg ccatggcccgccgcc gcctggactcgctgccctgcggcggcggctcgccccttgcgcacggcctgtccacggcgg tacgtgtgggcatgc aggccagccaggcgggcgaggtgggccgcgtcatgatggtgctcatcacggacggccgcg ccaacgtcagcctgg ccaagtccaacgaggaccccgaggcgctcaagcccgacgcgcccaagcccaccgccgact cgctgaaggacgagg tgcgcgacatggccaagaaggccgcgtccgccggcatcaacgtgcttgtcattgacacgg agaacaagttcgtga gcaccggctttgcggaggagatctccaaggcagcgcagggcaagtactactacctgccca acgccagcgacgccg ccatcgcggcggccgcgtccggcgccatggccgcggccaagggcggctactag
CHLD Intron 1 (SEQ ID NO: 59):
gtgagcgcctactttgatatgtaccaaagataccactgataggtttaggcacggaag atctggacttggaccccg tttgcgcaagccgggcgatgcacccatttcgcggtcacgccgagcgctggggtgcaattt agcgtgcccgacaag ctagaaaacagggaattaccatttgtttaattttgttgcgagagatctttgcttgtgtcc accggccgcgcgggg gaacttccggtgttgcgcaaggttgcgtgcgtgcccaccatcaacacctgtgccaggtct gtgtcacccccaggt tccaccaccctgcaatcttccaattgtgtctcgtttgctcgttgtctaatagtcgtcctt tgctcatccctacct gcag
CHLD Intron 2 (SEQ ID NO: 60):
gtgaggcagggaaggtgacacaggaggttttgaaagagagacagggaggcaaagatg gatggcggggcgggcagt gactttggggcggcatggagtgggattggtggagtgggattgggcaccatgtatcacaga tgttggcaacacagc gcagggccttgctctgtgcttgtgttgaccgtctagtcccccgtgccctgaaccaagtct ttcctcctgacacgg tcctccatgtcctccttccggcattcccttcctcgtccacag
CHLD Intron 3 (SEQ ID NO: 61):
gtgagccagcaagggaggagaggggaacggccgggtagggcagccggagtttaacca cgccaattcaacggggag caacggggaagaggaagggccggaagaggacggcaaaagcatttggtgggggcagcggct gtagtcagaagcgca aaggctgccacagtgtggcccgcaccctcctcaccaccagtttggcatgatcgtttagca tgggctggaatactc accgccagttctctcctctcccctctcctcccctgtccccgcctgcag
CHLD Intron 4 (SEQ ID NO: 62):
gtgagtgcgcgcgctgggtgtgtttgtgggacggcgcggcattggagcgcaggtgcg ggtgctgggccgtgcact tgtccgttggttcccttggaagcttcgatacacactcttactgcacgctctttaaccgcc ccccccctccacctc tgcccgccccgtgcag
CHLD Intron 5 (SEQ ID NO: 63):
gtgggtgggggaaagtgactggatgtcggtgggttttaggtatgtgcgtgtgtacga tgcggggagcagtacgga agcgggcacgagcggtgagggggcaggattgtggcgcacgctcgggccaagcccgggctc gcgacagagggtggg cttgtattcgtagtcaagcgcatcaggaagtgcagttgactggattcacctgaaacggcg ctgagcgggcggcta atagaatcccgcttcctgtccgcccctccccttgcccttcaatccgtcag CHLD Intron 6 (SEQ ID NO: 64)
gtgagtggcgggggccgtgcgtttgtttgttgcgtgggctggctggctggctttgtt ggatgagggcgctgctca ccactcatctctttgaatccccacttatccagttgcctgcatgaaaccccgcctgactca ctccccaccatcctg taccgcttttccaaacatccttgcaaccatcccgccatccccacccgcag
CHLD Intron 7 (SEQ ID NO: 65):
gtgaggagttggagggggaaggggcgaggggatgcgacagaagcgagggcgagggga gccggggtgggttgttgc aagtgtcgtgaattatagaatgaccccaaaagcgccggcccaacagggcctattacttgc gagtcaatccaaccc ctgatatagggagaatggggtagaggtcgtatcacgacagcaaggatgtacagtgggcct tggggttgggaggta cagggaaaaaggagaggacatggggttgggtaagcggggaataacaaatatacacccagc gtttatggaagtggg agatggaaacgggggcggacgaacaggaacaggggccggatggaggggctatgggggcat ggtgggtgggggtac ggcgcggggcagagcagggtcttgggtgaatgggcaagatgctgatgcttgggatgaaga cactatgagcaaaga aatggttgttgacgattgccatgatcatcgcagtgggggaggcggggtggcaataccggc agtcaacagttgggg tgcgatcaagattgattggagtaccagcagtggccgggatctggctgacgtgtctcgagc gagttgctggggtgg caaggagatgcaggggcagacgacgttgtgcgaccacacttacacacatttccttcccct tgcgtgtgtccgtgc gccctgtgcctccag
CHLD Intron 8 (SEQ ID NO: 66):
gtacgtaaacgtatttgattgctcaggtggttagccttggtgtggctgctgtttgac ttgtgcagctgtctttgt gtacatgttccacaaccctgtactccccatattccgcccccattccag
CHLD Intron 9 (SEQ ID NO: 67):
gtgagaggcggcgcggcggcttgcgggcgaaggcggggggcggggcggaggcaatgc ggccgcgcatggccagca acggaagggctggctatcaacacggcgagcgcacgatattcatataagagtgccatcgtg caatgctgaatactt gcgccaaccggatctcgctgctccgcttccaccggactgctttctcatctctccccttca ccctgtgtgtatcca cag
CHLD Intron 10 (SEQ ID NO: 68):
gtgagtgcccgaggtggtgggtggtgaattggggcacgagggtatgtgggcctaagg gagctgaatggggcatgt tttcttctgagcatcacggtcagagcttgacctgtcctccccgctgtacccccgtgcacg gtccgacacag
CHLD Intron 11 (SEQ ID NO: 69):
gtgagtacagcgcatcccggcgcaatcattgggcctagttactgctgcaggactcgt gtgctcttaagggctggc agctgtcagaagctctactcctcgcactgaccactgtgcctttctctccttcctctctcc ctccccgcacccctc ctcccacttcctcaacag
CHLI2 5’ - untranslated region (regulatory region) (SEQ ID NO: 70):
gcagacttccataaagctcttgtaacgctgtaccaactagtaagcggtacaattcgc ctgagcccgagcaacgcg acctttcttgctctgtggatctctgataatctaaccagaccaaaaccttttcactaatct aggcaaca
CHLI2 3’ - untranslated region (regulatory region) (SEQ ID NO: 71):
aaaaggctggtgtaggcctgtcgggtcgtgttaaaggttgctgcgtgaacgtgtaag tgtgacagtgtgccggta tgtgtgtgtatacatgtgttgcggtgtgcttttgtggcggtacatggtgatgactgagcg ggtgggacagagcac ggttaactgacgagggcagtccgtgcgagacggacgtttttgtagccgaggtgcaaggac tgatgacgggctaag ctgctggagacttggagttgagagtgcaggtggatcgacggtttctctaaggagtatgaa taggcaggagggctg gagacatttggggtgcaaggaggcggtagtatgggagatgtccatgggcggattttggcc tctgtaacttcttaa cgccca CHLI2 Exon 1 (SEQ ID NO: 72)
atgcagagtctccagggtcagcgcgcgttcactgcggtgcgccagggtcgggcgggt cccctgcggactcgcctg gtcgtgcgctcgtctgttgccttgccatccacgaaagccgcgaagaagccgaacttcccg ttcgtcaagattcag ggccaggaggagatgaagcttgcactgctgctgaacgtggtcgaccccaacatcggcgga gtgcttattatgggt gaccgcggcactgccaagtcggtcgcg
CHLI2 Exon 2 (SEQ ID NO: 73):
gtccgcgccctggtggatatgcttcccgacattgacgtggttgagggcgacgccttc aacagctcccccaccgac cccaagttcatgggccccgacaccctgcagcgcttccgcaacggcgagaagctgcccacc gtccgcatgcggacc cccctg
CHLI2 Exon 3 (SEQ ID NO: 74):
gtggagctgcctctgggcgccaccgaggaccgcatctgcggcaccatcgacatcgag aaggcgctgacgcagggc atcaaggcctacgagcccggcctgctg
CHLI2 Exon 4 (SEQ ID NO: 75):
gccaaggccaaccgcggcatcctgtatgtggacgaggtgaacctgctggatgatggc ctg
CHLI2 Exon 5 (SEQ ID NO: 76):
gttgatgtcgtgctggactcgtcggctagcggcctgaacactgtggagcgtgagggt gtgtccattgtgcaccct gcccgcttcatcatgattggctcaggcaacccccag
CHLI2 Exon 6 (SEQ ID NO: 77):
gagggtgagctgcgcccgcagctgctggatcgcttcggcatgagcgtcaacgtggcc acgctgcaggacaccaag cagcgcacgcagctggtgctggaccg
CHLI2 Exon 7 (SEQ ID NO: 78):
gcttgcgtacgaggcggaccctgacgcatttgtggactcgtgcaaggccgagcagac ggcgctcacggacaagct ggaggcggcccgccagcgcctgcggtccgtcaagatcagcgaggagctgcag
CHLI2 Exon 8 (SEQ ID NO: 79):
atcctgatctcggacatttgctcgcgcctggatgtggatggcctgcgcggtgacatt gtgatcaaccgcgccgcc aaggcgcttgtggccttcgagggccgcaccgaggtgaccacgaatgacgtggagcgcgtc atctcgggctgcctc aaccaccg
CHLI2 Exon 9 (SEQ ID NO: 80):
cctgcgcaaggacccgctggaccccattgacaacggcaccaaggtggccatcctgtt caagcgcatgaccgaccc cgagatcatgaagcgcgaggaggaggccaagaagaagcgcgaggaggcggccgccaaggc caaggcggagggcaa ggcggaccgccccacgggcgccaaggctggcgcctgggctggcttgccccctcgtcggta a
CHLI2 Intron 1 (SEQ ID NO: 81):
gtaggtaacacaagcaattatggggcgaagatctaggctccgctgatccgggcgggc aatcggcatcgtcggtgc aaccgtggggcgtctgtgcaccctttgctggtgccaggttgcctgactcgcctgcattcc tgtaccgagccacat tggctgctttgcagcgtgcatgggacgggtgtaggataagcgctatgtatgcgatagcgc gggtgcaccggcttg gcatggcaaggttgcggggtgcacatgcgtgccagcgtcccctcagcatcagagtctgga tctaagggctcagcg gcttcctgcgcatgtgggtctttgcgtagtgctacgaagccttataattaaagctcatgt attgagtggtccggg tttggggcactagtagtgccaggaggcgcgtgccaggttgatatgagcatatcagcaccc gttccttgcgaaacg cttccgttgtgctcccttccccaccacctccccgctcatacccatacatatggctatccg tcctctcattgcttg cccctacag
CHLI2 Intron 2 (SEQ ID NO: 82):
gtgagcgggcctaccttctgaagacagtcttacgtgttgcactgcagcggtgttgcg cacctctgcttttgcgtg cgccgggaagcgcggattgcggcctcacagatcaagcccggaaacgcttgttgtttccag cgggtggcacacacg cgcgcgcgcgcacagtgacaccctcacggccgcgctgccctgcag
CHLI2 Intron 3 (SEQ ID NO: 83):
gtgcgtagtgcatggggagaggggacgaggggaggagggcagggccaataaaccgaa ccccaagtcatcgagaca cagaacccgataatagctcccagatcgccaaggggtgaggcgggaagccaaggatgatgc gttggccgcattgcg tgttgacgtcaggcttacacagggtctgactggctgtgcttggggtttggcacgcttctt gactggccccgtacg catgctgcag
CHLI2 Intron 4 (SEQ ID NO: 84):
gtgagtggtggtggtttctgggtcagcagaggacttctgtagtaggtaatgtgggcc agggaagtgtggctaaca tgccaaacacgggggcgcaccagtgcaagctgcattcgctgacgtgcacgggtgcaatgg gtgcaaggcgaactg caatcgcggtgcacagttgccagggctgcgctcacgcttgagtgtctgcacacgcactgc ag
CHLI2 Intron 5 (SEQ ID NO: 85):
gtgcgtagcgtgcgcgcatgtacttgtctcccttgtcatgttgggaaaggtcggtcc ccagcctgcttgcaagat gcggccggtcagcagctgcggacggtcagcacctacgtgccgaggttgtgtaacatgaat ggcgttggggcggcc gacctgccacaagctgaactgcgaccagcaaggcagctgccagcaacgcacacccgacgt gctacacgcttgtgt tttgacctcctaaacacacccgcccgctgtctgtcacgtccacag
CHLI2 Intron 6 (SEQ ID NO: 86):
gtaagcggcggcggcgcggggacacggagggacatttcgcgagcatgggttgaggag tcgggaggattcggtggc tggccggagtcgggagtcggagtcgcgagtcggaagtcaagcttctggcggcttcgtgct gtcgggtgcgctcgc catgatggcgctgaccggagggcgtcacgctgtgtatgtgggcgcgcag
CHLI2 Intron 7 (SEQ ID NO: 87):
gtacggggcgtacagcgggggcggctgcacggggccagtgaccgacagggcagcacg cggctggcgaagagcgac aaagtgacagggtgaccaagaccgggtgatgccacgagaggggcgcgggagccgtgcatt gggtcgaggagggag gaatgcaactttacactgatgcctctgtatacggccgccttccgagccctgcaaaccttc gctttcccccgacgc acgcag
CHLI2 Intron 8 (SEQ ID NO: 88):
gtgagcgcagcgtgcggtggatgcggtgcgcgtgcgggttgccaacttattattttg tacgtggacgcgtggctg gcgatggcatgtcatggcgcgaatggatattgggcgaatggataccggtaatggtagcac ggggcggcagggcct ggcggtagtggggttgagggggcgaggactccagcgcgcgatacatgccatgttcagcat ggccccaactgacag cgcccgctgccctgtgcgccccgctccctccgcgcacccgctcctcctacacag
CHLH1 5’ - untranslated region (regulatory region) (SEQ ID NO: 89):
ctagtctagagggaactagggaggggcaacagagaa
CHLH1 3’ - untranslated region (regulatory region) (SEQ ID NO: 90):
gcggcctccccttcatggtagcactagttggcgggttgtggttggactaggcggcta gggtatatacctagtagc ggcggctgcggagtggagggctggcgcccagcgcgagggcgtggcctttcctcctggacc cgagagcgctccgcg aggagacggcgagtgagataggcagcagcgagcggagatcgatttgtgaacagttttgtg gcgggatcccatagc ggatgcagagaagaccttagagcagcttcctcggtggagtgaacgagccagagcggaggg aaggcgcatgaggga actgcagggactggaactgcgggagtgcaggtccggtgctaggtccgctaaacagtgcgg tctacgcctgtgtgt gaggtgtgcgtgtgtgtgtgagctgtgcggttttgttgtgcaaagtaggagtgagccgag ccgcgcgtactttgt ggcgtgtttggctgctggcgctgagagccaagagagggtaaacgggtttggtattttatg gtgcggggtgaaagc agccctcgcaggaatggagcgattctgcagcatgatgcacgtgtgcctgcgcgtggatgg tggctgttgatatgg ctctgccactccggcagcaccgctacgatacctagcggtgcctggagtggtctctctgtt tggtgcgtgatgttt gggtttgccgttttgattctttgtttcgtgctgaatggctgaggcggcaagacccctcgt gccagtgtacagagc ctcacggctccctcggaccccgcgtggggacgtccattcccggtggcggtgtcgcctcgg cggtgtaaagcaaaa aatatttt
CHLH1 Exon 1 (SEQ ID NO: 91):
atgcagacttcctcgcttcttggccggcgcacggcccacccggctgcgggcgcgacg cccaagccg
CHLH1 Exon 2 (SEQ ID NO: 92):
gttgcgccctcgccccgcgtggctagcacccgccag
CHLH1 Exon 3 (SEQ ID NO: 93):
gtcgcgtgcaatgtggcgactggaccccggccgcccatgaccaccttcaccggtggc aacaagggccctgctaag cagcaggtgtcgctggatctgcgcgacgagg
CHLH1 Exon 4 (SEQ ID NO: 94):
gcgctggcatgttcaccagcaccagcccggagatgcgccgtgtcgtccctgacgatg tgaagggtcgcgttaagg tgaaggttgtgtacgtggtgctggaggcccagtaccagtcggccatcagcgctgcggtga agaacatcaacgcca agaactccaag
CHLH1 Exon 5 (SEQ ID NO: 95):
gtgtgcttcgaggtggtgggctacctgctggaggagctgcgtgaccagaagaacctc gatatgctcaaggaggat gtggcctctgccaacatcttcatcggctcgctcatcttcattgaggagcttgccgagaag
CHLH1 Exon 6 (SEQ ID NO: 96):
attgtggaggcggtgagccccctgcgcgagaagctggacgcgtgcctgatcttcccg tccatgccggcggtcatg aagctgaacaagctgggcacgttttcgatggctcagctgggccagtcgaagtcggtgttc tcggagttcatcaag tctgctcgcaag
CHLH1 Exon 7 (SEQ ID NO: 97):
aacaacgacaacttcgaggagggcttgctgaagctggtgcgcaccctgcctaaggtg ctgaagtatctgccctcg gacaaggcgcaggacgccaagaacttcgtgaacagcctgcagtactggctgggcggtaac tcggacaacctggag aacctgctgctgaacaccgtcagcaactacgtgcccgctctgaagggcgtggacttcagc gtggctgagcccacc gcctaccccgatgtgggtatctggcaccctctggcctcgggcatgtacgaggacctgaag gagtacctgaactg
CHLH1 Exon 8 (SEQ ID NO: 98):
gtacgacacccgcaaggacatggtcttcgccaaggacgcccccgtcattggcctggt gctgcagcgctcgcacct ggtgactggcgatgagggccactacagcggcgtggtcgctgagctggagagccgcggtgc taaggtcatccccgt ctttgccg CHLH1 Exon 9 (SEQ ID NO: 99)
gtggcctggacttctccgcccccgtcaagaagttcttctacgaccccctgggctctg gccgcacgttcgtggaca ccgttgtgtcgctgaccggcttcgcgctggtgggcggccccgcgcgccaggacgcgccga aggccattgaggcgc tgaagaacctgaacgtgccctacctggtgtcgctgccgctggtgttccagaccactgagg agtggctggacagcg agctgggcgtgcaccccgtccaggtggctctgcag
CHLH1 Exon 10 (SEQ ID NO: 100):
gttgccctgcccgagctggatggtgccatggagcccatcgtgttcgctggccgtgac tcgaacaccggcaagtcg cactcgctgcccgaccgcatcgcttcgctgtgcgctcgcgccgtgaactgggccaacctg cgcaagaagcgcaac gccgagaagaagctggccgtcaccgtgttcagcttcccccctgacaagggcaacgtcggc actgccgcctacctg aacgtgttcggctccatctaccgcgtgctgaagaacctgcagcgcgagggctacgacgtg ggcgccctgccgccc tcggaggaggatctgatccagtcggtgctgacccagaaggaggccaagttcaactcgacc gacctgcacatcgcc tacaagatgaaggtggacgagtaccagaagctgtgcccttacgccgaggcgctggaggag aactggggcaagccc cccggcaccctgaacaccaacggccaggagctgctggtgtacggccgccagtacggcaac gtcttcatcggcgtg cagcccaccttcggctacgagggcgacccgatgcgcctgctgttctcgaagtcggccagc ccccaccacggcttc gccgcctactacaccttcctggagaagatcttcaaggccgacgccgtgctgcacttcggc acccacggctcgctg gagttcatgcccggcaagcaggtcggcatgtcgggtgtgtgctaccccgactcgctgatc ggcaccatccccaac ctctactactacgccgccaacaacccgtctgaggccaccatcgccaagcgccgctcgtac gccaacaccattteg tacctgacgccgcctgccgagaacgccggcctgtacaagggcctgaaggagctgaaggag ctgatcagctcgtac cagggcatgcgtgagtctggccgcgccgagcagatctgcgccaccatcattgagaccgcc aagctgtgcaacctg gaccgcgacgtgaccctgcccgacgctgacgccaaggacctgaccatggacatgcgcgac agcgttgtgggccag gtgtaccgcaagctgatggagattgagtcccgcctgctgccctgcggcctgcacgtggtg ggctgcccgcccacc gccgaggaggccgtggccaccctggtcaacatcgctgagctggaccgcccggacaacaac ccccccatcaagggc atgcccggcatcctggcccgcgccattggtcgcgacatcgagtcgatttacagcggcaac aacaagggcgtcctg gctgacgttgaccagctgcagcgcatcaccgaggcctcccgcacctgcgtgcgcgagttc gtgaaggaccgcacc ggcctgaacggccgcatcggcaccaactggatcaccaacctgctcaagttcaccggcttc tacgtggacccctgg gtgcgcggcctgcagaacggcgagttcgccagcgccaaccgcgaggagctgatcaccctg ttcaactacctggag ttctgcctgacccag
CHLH1 Exon 11 (SEQ ID NO: 101):
gtggtcaaggacaacgagctgggcgccctggtagaggcgctgaacggccagtacgtc gagcccggccccggcggt gaccccatccgcaaccccaacgtgctgcccaccggcaagaacatccacgccctggaccct cagtcgattcccact caggccgcgctgaagagcgcccgcctggtggtggaccgcctgctggaccgcgagcgcgac aacaacggcggcaag taccccgagaccatcgcgctggtgctgtggggcactgacaacatcaagacctacggcgag tcgctggcccaggtc atgatgatggtcggtgtcaagcccgtggccgacgccctgggccgcgtgaacaagctggag gtgatccctctggag gagctgggccgcccccgcgtggacgtggttgtcaactgctcgggtgtgttccgcgacctg ttcgtgaaccagatg ctgctgctggaccgcgccatcaagctggcggccgagcaggacgagcccgatgagatgaac ttcgtgcgcaagcac gccaagcagcaggcggcggagctgggcctgcagagcctgcgcgacgcggccacccgtgtg ttctccaacagctcg ggctcctactcgtccaacgtcaacctggcggtggagaacagcagctggagcgacgagtcg cagctgcaggagatg tacctgaagcgcaagtcgtacgccttcaactcggaccg
CHLH1 Exon 12 (SEQ ID NO: 102):
ccccggcgccggtggcgagatgcagcgcgacgtgttcgagacggccatgaagaccgt ggacgtgaccttccagaa cctggactcgtccgagatctcgctgaccgatgtgtcgcactacttcgactccgaccccac caagctggtggcgtc gctgcgcaacgacggccgcacccccaacgcctacatcgccgacaccaccaccgccaacgc gcaggtccgcactct gggtgagaccgtgcgcctggacgcccgcaccaagctgctcaaccccaagtggtacgaggg catgcttgcctcggg ctacgagggcgtgcgcgagatccagaagcgcatgaccaacaccatgggctggtcggccac ctcgggcatggtgga caactgggtgtacgacgaggccaactcgaccttcatcgaggatgcggccatggccgagcg cctgatgaacaccaa ccccaacagcttccgcaagctggtggccaccttcctggaggccaacggccgcggctactg ggacgccaagcccga gcagctggagcgcctgcgccagctgtacatggacgtggaggacaagattgagggcgtcga ataa
CHLH1 Intron 1 (SEQ ID NO: 103):
gtaggtgtaattagaaggatcaaaacctagcggcctgatctgggactgacggcctcg cgcttcaatcactctgat gcag CHLH1 Intron 2 (SEQ ID NO: 104)
gtaggcacggcagaatgctcaatgaacatgcagctacatatgtttgggatcatggct gatctctgtgcgacgggt ccgcgcag
CHLH1 Intron 3 (SEQ ID NO: 105):
gtgagcagcgcggaccgagcaagcgctggcgatgcagttggatttgttgttcttggg tcaggcgctcgctcgatg gccagcgcgtgtatttaatgggataagggttgagacaaagcatctcttcgggtaaaaatc ttagttttcgacagc acgttgagaggcatgcaacttgctctttcgcag
CHLH1 Intron 4 (SEQ ID NO: 106):
gtgggtaaggagttgcattatcagtgtggcatggtgttgcgggcgtctggggcgctg caacagcggcatcgtgcc gaactgaccgtgccgggctacccgcgtgcag
CHLH1 Intron 5 (SEQ ID NO: 107):
gtgcgctagggttggggtctggagggtgtggattgcgcccaagtgccctgttgcgct tggcggtcgctgtcatga tgtgagggtgacgtagtgcactcaattgcctgctacgtcaccacctttgatgggctggat ctgaggcaggtcagc tcggttccctgctgcatccagtgtccctgtcgccctgcacgtttgacgctgttccccctt ccgcactgtctcgct ttgcag
CHLH1 Intron 6 (SEQ ID NO: 108):
gtgtgggcacgcgctttgggaagggaggcatacatttttggttgcggttaggctggg cgcggacttggcactcac acggtcattgcacactcatgtctcaccttcatttacggtcccttgtgccgaactacctac ag
CHLH1 Intron 7 (SEQ ID NO: 109):
gtgagcagcatcagggcagagtgcatgaacggattggtggcagtggggaatggaatt agacggacacgtctgggc ggcaatatgttgcgctgcagtttttggggtgtagtgaactagaaaatagggaagagatag gccacataacatccg aaagctcatatttttgcaaccggcgcacctatcacagcccacctgaagggttttgtagtc aacgcgtgcaactga ctagatgtccccttacctgtctgatttcag
CHLH1 Intron 8 (SEQ ID NO: 110):
gtgaggcggggcggcgctgccctcggtaggggttgcagatggtgatgggtaaccgaa tgcatggccaatggggag tgaaatcaggaaaggaggggtaacacaatgcagggcagcacctgaatcgtgaaggcggag ttaggcagggatctg tcagttcgcctgtcacgtggatgggcgcagctgacctttgtggtgttgtggtgtggcgca g
CHLH1 Intron 9 (SEQ ID NO: 111):
gtgagctcagctgggacatgtaggggctcgggtcgccggagcatcgatgtagaatta cgggaggaggggagaggg gagaggattgcacgaaccgagatgagggcggtggttcgggatttcgggcaaaagctcgtg cggcaagcgttcagt gactgaagagcagtgtgcttcaactgcccctctgtccctcag
CHLH1 Intron 10 (SEQ ID NO: 112):
gtgcgaccggtgccgctgcgtggccaacagcttggtgccaccttcctgcggtgttga tttacactgtgtgcgtgg atgtgttggtttttcgcaactttagtctgggctccagctctttgccttcattgatcactc gtcttacctcctgcg ccatcatttgaatacag CHLH1 Intron 11 (SEQ ID NO: 113)
gtgagccttaatgcaacacgtgtagccgttcgcatgggtggctgggtcatgctatgg ttggatcggcgtccgcct gcttgctactgcctgttcggtaccagcgtttactgaccccgcgtgtgccattcccaccac ctaccccctcgcctt gcag
Ferrochelatase 5’ - Untranslated region (regulatory region) (SEQ ID NO: 114):
gacagtgatatagcaataccgatataataggtttggcgggcttcaccttgtccttac ccagaatgtggccctgac agtcgatttccagcccccttgccactcgctccctgatttcttcaatcaactagttgggtc gttttctcgtaagg
Ferrochelatase 3’ - Untranslated region (regulatory region) (SEQ ID NO: 115):
gggggcgggtggcgagtaaggcgtatggcggagcgaggagatgggctgtggcgtggc cggtgttcttttgtgtga ttggaaacatagacggggtgcggcacgcggcctgactgctgcgcggttggtgtggttgcg gggggagcggggtcg atggggcagcgcgcacgagttggttgaaggaggagggccaggcgctgggctacacccatg gtttgaggatgctag tgagtgatgtgtgcggggggcatggtgtgtaccattcagagtccagatgcacgcacggtt gcgtgggagcgttcc ctgctgtgcatgatgatggcgccttcgatgaatcatctcttgaaggtccaaatgaaacgt ctgaagtctgcagag ggtggtgctggacatgccatccaggcggaagtgggcagctgtgtctgactacaaagtagg tcttgttttgcttgg atagcgtttggctatgtagcgtgtattctgctcatcaatcacgccaggcgtcagggacta cccatgcaagtcggg agcgtggctggctctggaaaagttgtagctgctaggtggcgttggctggggtgtcatgca tctcggcaggtaggc ggtagcggtggacgacctctgcagcggagcatgtgcacaagatgtgactgcgcatgcacc cgtatatgacggcgt tggcgtcagttgttgagagtgaacagaggagagacgagcgaagctgccatgcccttagtg gctggtgcgagaggg gaagaaagagagaggaaggactttgcggcagtgccccacgccggagttggggacacggtc atcaacagggcggcg gagctgggcggagtgggtgtgtgatgggacagggttcaaggcaggttggcgaggtcggag tgggtagaccagtcc ttcagtgcaagggcattagggcatgatgtaagggctgaagcttg
Ferrochelatase Exon 1 (SEQ ID NO: 116):
atggcgtcgtttggattgatgcaaaggacggtgcactgtccccagcttgtggaggag cggtgttcgccggtcgct ggctgctctggtcgtggcctgccagttatccagcggcaacg
Ferrochelatase Exon 2 (SEQ ID NO: 117):
gcgtggcgtgtgcagtgccaccaacggtgtccagcgagggcgtgtgctgcgccggac ggccgcttcgaccgacgt ggtctccttcgtggaccccaatgacattagaaaacccgcagcagcagcagctggccctgc ggtggataaggtcgg cgttctgctgttaaaccttggcgggcccgaaaagctcgacgacgtcaagcctttcctgta taacctattcgccga cccagaaattattcgcctgccagcggcagctcagttcctgcagccgctgctcgcgacgat catctccacgcttcg cgccccgaagagcgcggagggctatgaggccattggcggtggtagcccgttgcgtaggat tacagacgagcaggc ggaggcgctggcggagtctctgcgcgccaagggccaacctgcgaacgtgtacgtgggcat gcgctattggcaccc ctacacggaggaggcgctggagcacattaaggccgacggcgtcacgcgcctggtcatcct cccgctgtaccctca gttctccatctctaccagcggctccagccttcgactgcttgagtcgctcttcaagagcga catcgcgctcaagtc gctgcggcacacggtcatcccgtcctggtaccagcggcggggctacgtgagcgcgatggc ggacctgattgtaga
9
Ferrochelatase Exon 3 (SEQ ID NO: 118):
gagctgaagaagttccgggacgtgcccagcgtggagctgtttttctccgcgcacggc gtgcccaagtcctacgtg gaggaggcgggcgacccatacaaggaggagatggaggagtgcgtgcggctcattacggac gag
Ferrochelatase Exon 4 (SEQ ID NO: 119):
gtcaagcggcgcggcttcgccaacacgcacacgctggcctaccagagccgcgtgggc cccgcggaatggctcaag ccgtacacggatgagtccatcaa Ferrochelatase Exon 5 (SEQ ID NO: 120)
ggagctgggcaagcgcggcgtcaagtcgctgctggcggtgcccatcagctttgtcag cgagcacattgagacgtt ggaggagatcgacatggagtaccgcgagctggcggaggagagcg
Ferrochelatase Exon 6 (SEQ ID NO: 121):
gcatccgcaactggggccgcgtgccggcgctgaacaccaacgccgccttcatcgacg acctggcggacgcggtga tggaggcgctgccctacgtgggctgcctggccgggccgacagactcgctggtgccgctgg
Ferrochelatase Exon 7 (SEQ ID NO: 122):
gcgacctggagatgctgctgcaggcctacgaccgcgagcgccgcacgctgccgtcac cggtggtgatgtgggagt ggggctggaccaagagcgcggagacgtggaacggccgcattgccatgattgccatcatca tcatcctggcgctgg aggcagccagcggccagtccatcctcaaaaacctgttcctggcggagtag
Ferrochelatase Intron 1 (SEQ ID NO: 123):
gtgcgataataaatttgcatccttatgaattgctcaatgactaacgagcagcgtccg cgaccacag
Ferrochelatase Intron 2 (SEQ ID NO: 124):
gtgagggtggcattctgtaaagggagttgtggagttgggcagagcgagtgggtttgg tcgccagggcgaggatgt tgcgcgggcgttggcaggaacagggctgctagggcttgcgtggccagcgactagggtttc gactggccagcgccg ccggggcgcgcttgccgaagctgcacagccccaagcgcttctgtggatcaaatggaaact tgtggcagtgtgtat gctagcgccttggcgcaagaccaattttagtggtattactgttattactgtggtagcggt gggtattcggcggcg tggttgttgttgcagccccgtgcgactaagaccgctggcaacgacagcaagccgccgcac ccaggcatatacggc ccaccagcaccaccgtacacaaccacgtgcctttgcactctacgcaccacagcgcgctgc tgccgctcccacctc ccatcccaacggcccctcttacccccacttcacaacccctcctctcacacgccctcctct tccccctcctcttcc ag
Ferrochelatase Intron 3 (SEQ ID NO: 125):
gtgggccgggcgcagcgggcgggcgggaggggcaggaggggcaggaggggaggaagg gaggggaggaagggatgg aaagctggcgcagcggcagcggcgggacaggtagagggcgctgccccagcggcggcaggt gggcatggtgggcgg gtaggggcgacgcgtgagggactcgtcaggcatccgcatggcggcgacttgctgctcctc accgctgacggctgc atctgctgtgtgcgtaacctggcctggctggcaccgcag
Ferrochelatase Intron 4 (SEQ ID NO: 126):
gtgaggcccgtgggtgggacgcggggagggacgcggggagggggagacgcgggagcg ggacaagggtgaggatac ggggagggaataggagaggccatggggagggatggggacacgggaggatgcacgggcctg ggtggagccaggggg aagtggacgacgagcccggcgggaggagggctgggtagaaggacgcgggaggtggttggg acaggtggacggggc gtgtggagcatacggcgcaagaagcgggactgagcgggttgcagggatggatgtaatcac ggcaagtaagaaccc cgagtggggctcagcgtgtcagcctgccttatctttcgcgcaagcgctggggttttattt cgctgtacacacgtc gcgcctttctgccgcag
Ferrochelatase Intron 5 (SEQ ID NO: 127):
gtgaggaggcgccggagttttgggggaaggggtgcggcgtgaagcgagatggcaggg gcgaaggaaggagcggat ggtggctgggtgcaagcggagaggcgacagagagtggaggttttggtggagcggttgggg agaggggcgcagcag ggatgcggccctggggatggcgggacagaagggagcaagtttgccaagtgaagggggggg gtgctcaagaggaga gggcggtggaggttaagacggccgtgctggttatgctggggttgcaaggcgcatgggcgc atggagccgggggag tttggctgtggatgggcactgcggatgggcacggcttgctactcatgtgcggtcgcggtc cgcggtgtgtcagcc agccaggacccatcccactgggtcttcctgcgtgcctgggactgcttgccgccacccacc cattcatcaccacca ctgcgcagacccaccaacaccgctgccctgaactgctctgactcttggcgctcctcag Ferrochelatase Intron 6 (SEQ ID NO: 128)
gtgagtcgcgccgtcgcggttggttcgcggatgccggttggcggatgacgttcggcg gttggcattgggtttggg tttgaggggttgttgggtgaggtcgggattggggtcgggattgggggtcgagcgtggggc tggcgtggatgatgg cgtggtctttggaaggggcttggggaggttgcgcgtgtggatgcggacagcatgggcgcg acagtgcgcatgtgc atgtgctgtgtcaaacgtctggtgcgttcagtgtgtccttgcgtgcctcccaccgtacgc agccatcccgcgcgc ctggaccgtagagaccgcctacgtgtccgctagcggcctcggcctcagcctaagcgccag tagcgccagcgacac aagcaacactgtcgctaatggcagcagcggcagcagcagcagtcacgagaatgcccgcgg ccgggagaaagtgct cctagccgggggccgccgctagctggtttcctcagcgcgtggacggtggtgccttcatcc cgaccaccccaggcg cgtccccagtcccgtcgagctcgcctgccttgtggcccgccttgaccgccctggcgccac ccggtggctcgcata acgactcgctttccgttctccgcctgacgctgtccgcctgacgctctgcgcttgactctt tgcgccttcctcccc tcttcccccag
Mutant sequenced RedAlgaeCHLH DNA (SEQ ID NO: 129):
atgcagacttcctcgcttcttggccggcgcacggcccacccggctgcgggcgcgacg cccaagccggttgcgccc tcgccccgcgtggctagcacccgccaggtcgcgtgcaatgtggcgactggaccccggccg cccatgaccaccttc accggtggcaacaagggccctgctaagcagcaggtgtcgctggatctgcgcgacgagggc gctggcatgttcacc agcaccagcccggagatgcgccgtgtcgtccctgacgatgtgaagggtcgcgttaaggtg aaggttgtgtacgtg gtgctggaggcccagtaccagtcggccatcagcgctgcggtgaagaacatcaacgccaag aactccaaggtgtgc ttcgaggtggtgggctacctgctggaggagctgcgtgaccagaagaacctcgatatgctc aaggaggatgtggcc tctgccaacatcttcatcggctcgctcatcttcattgaggagcttgccgagaagattgtg gaggcggtgagcccc ctgcgcgagaagctggacgcgtgcctgatcttcccgtccatgccggcggtcatgaagctg aacaagctgggcacg ttttcgatggctcagctgggccagtcgaagtcggtgttctcggagttcatcaagtctgct cgcaagaacaacgac aacttcgaggagggcttgctgaagctggtgcgcaccctgcctaaggtgctgaagtatctg ccctcggacaaggcg caggacgccaagaacttcgtgaacagcctgcagtactggctgggcggtaactcggacaac ctggagaacctgctg ctgaacaccgtcagcaactacgtgcccgctctgaagggcgtggacttcagcgtggctgag cccaccgcctacccc gatgtgggtatctggcaccctctggcctcgggcatgtacgaggacctgaaggagtacctg aactggtacgacacc cgcaaggacatggtcttcgccaaggacgcccccgtcattggcctggtgctgcagcgctcg cacctggtgactggc gatgagggccactacagcggcgtggtcgctgagctggagagccgcggtgctaaggtcatc cccgtctttgccggt ggcctggacttctccgcccccgtcaagaagttcttctacgaccccctgggctctggccgc acgttcgtggacacc gttgtgtcgctgaccggcttcgcgctggtgggcggccccgcgcgccaggacgcgccgaag gccattgaggcgctg aagaacctgaacgtgccctacctggtgtcgctgccgctggtgttccagaccactgaggag tggctggacagcgag ctgggcgtgcaccccgtccaggtggctctgcaggttgccctgcccgagctggatggtgcc atggagcccatcgtg ttcgctggccgtgactcgaacaccggcaagtcgcactcgctgcccgaccgcatcgcttcg ctgtgcgctcgcgcc gtgaactgggccaacctgcgcaagaagcgcaacgccgagaagaagctggccgtcaccgtg ttcagcttcccccct gacaagggcaacgtcggcactgccgcctacctgaacgtgttcggctccatctaccgcgtg ctgaagaacctgcag cgcgagggctacgacgtgggcgccctgtccgccctcggaggaggatctgatccagtcggt gctgacccagaagga ggccaagttcaactcgaccgacctgcacatcgcctacaagatgaaggtggacgagtacca gaagctgtgccctta cgccgaggcgctggaggagaactggggcaagccccccggcaccctgaacaccaacggcca ggagctgctggtgta cggccgccagtacggcaacgtcttcatcggcgtgcagcccaccttcggctacgagggcga cccgatgcgcctgct gttctcgaagtcggccagcccccaccacggcttcgccgcctactacaccttcctggagaa gatcttcaaggccga cgccgtgctgcacttcggcacccacggctcgctggagttcatgcccggcaagcaggtcgg catgtcgggtgtgtg ctaccccgactcgctgatcggcaccatccccaacctctactactacgccgccaacaaccc gtctgaggccaccat cgccaagcgccgctcgtacgccaacaccatttcgtacctgacgccgcctgccgagaacgc cggcctgtacaaggg cctgaaggagctgaaggagctgatcagctcgtaccagggcatgcgtgagtctggccgcgc cgagcagatctgcgc caccatcattgagaccgccaagctgtgcaacctggaccgcgacgtgaccctgcccgacgc tgacgccaaggacct gaccatggacatgcgcgacagcgttgtgggccaggtgtaccgcaagctgatggagattga gtcccgcctgctgcc ctgcggcctgcacgtggtgggctgcccgcccaccgccgaggaggccgtggccaccctggt caacatcgctgagct ggaccgcccggacaacaacccccccatcaagggcatgcccggcatcctggcccgcgccat tggtcgcgacatcga gtcgatttacagcggcaacaacaagggcgtcctggctgacgttgaccagctgcagcgcat caccgaggcctcccg cacctgcgtgcgcgagttcgtgaaggaccgcaccggcctgaacggccgcatcggcaccaa ctggatcaccaacct gctcaagttcaccggcttctacgtggacccctgggtgcgcggcctgcagaacggcgagtt cgccagcgccaaccg cgaggagctgatcaccctgttcaactacctggagttctgcctgacccaggtggtcaagga caacgagctgggcgc cctggtagaggcgctgaacggccagtacgtcgagcccggccccggcggtgaccccatccg caaccccaacgtgct gcccaccggcaagaacatccacgccctggaccctcagtcgattcccactcaggccgcgct gaagagcgcccgcct ggtggtggaccgcctgctggaccgcgagcgcgacaacaacggcggcaagtaccccgagac catcgcgctggtgct gtggggcactgacaacatcaagacctacggcgagtcgctggcccaggtcatgatgatggt cggtgtcaagcccgt ggccgacgccctgggccgcgtgaacaagctggaggtgatccctctggaggagctgggccg cccccgcgtggacgt ggttgtcaactgctcgggtgtgttccgcgacctgttcgtgaaccagatgctgctgctgga ccgcgccatcaagct ggcggccgagcaggacgagcccgatgagatgaacttcgtgcgcaagcacgccaagcagca ggcggcggagctggg cctgcagagcctgcgcgacgcggccacccgtgtgttctccaacagctcgggctcctactc gtccaacgtcaacct ggcggtggagaacagcagctggagcgacgagtcgcagctgcaggagatgtacctgaagcg caagtcgtacgcctt caactcggaccgccccggcgccggtggcgagatgcagcgcgacgtgttcgagacggccat gaagaccgtggacgt gaccttccagaacctggactcgtccgagatctcgctgaccgatgtgtcgcactacttcga ctccgaccccaccaa gctggtggcgtcgctgcgcaacgacggccgcacccccaacgcctacatcgccgacaccac caccgccaacgcgca ggtccgcactctgggtgagaccgtgcgcctggacgcccgcaccaagctgctcaaccccaa gtggtacgagggcat gcttgcctcgggctacgagggcgtgcgcgagatccagaagcgcatgaccaacaccatggg ctggtcggccacctc gggcatggtggacaactgggtgtacgacgaggccaactcgaccttcatcgaggatgcggc catggccgagcgcct gatgaacaccaaccccaacagcttccgcaagctggtggccaccttcctggaggccaacgg ccgcggctactggga cgccaagcccgagcagctggagcgcctgcgccagctgtacatggacgtggaggacaagat tgagggcgtcgaata a
CHLI1 5’ - untranslated region (regulatory region) (SEQ ID NO: 130):
tcctacagagtaaaggtctaggcgatgcgcgactgaaagactgtgaatcccggcgtc gccgtggtgggatgtggg ccggtgcgctgtcgcagaggataaattacaggtatcaaacaaggttagggcgttggaagg agcggcgctagggaa ctgaaatcggatctgcatcggaccctcattccgcgacttgtccttcttttgcctcgcccc gcagctcttgagttt tgttcttgaccctttgacacgaaccaaccgatataaaa
CHLI1 3’ - untranslated region (regulatory region) (SEQ ID NO: 131):
gcggcaggccttcatggtcgtcgttggagcatttgcggaaaggctgatggcagcaga tgcagccatgtcagttgt ggctgaagttgttggctggggcgggagcgggcagcagctgctgcgagcggccgaagcagc ggtgctgctttgcgt atgagaggaagaccagtgccctcgaggaggcgagtgcctgtgtgagtgtcaggacgtgtg acttcggaaactgag ggcggtgagtagatgtgactggggcttgcaggaagcctactgaccctatcagaaaaggtg agcaggggtatatgg tctaggagcgttgccggagcgtggctggccagtgctagccgcgcgggctctgttgctcgc tggcgcgccgccgcc ttcacaacagatgccgtagaaatgcagcgatgtgacgaggcgtggcctattctgcaatgt gtgaggcgccaatgg cgccactgacaaatggaggagtggtcaaagcttgggtacgttttgagagctgcatcgggc agcgaggatcagtgt gcggtaagaccgacggcagacggattggcaagggaataggagggacgtgggcgtgggcgc ccgcgctttgtcgag gccgcatgagccggccgcttctagacccgtagcccattttgaacaagcgcccacgcgtgc tcccgatgggggaca tcgatcacgggaattgattaaggggcatgtgtggtgtgcaagtgagtgactggtggttcc gtccctgtgaggttg tttcgttggacgtggctgccgggttgcgcgcgggctaagcgggcctgaggcagagcgctg gcgtgtagccgcgag tatcgatctgtaacgtgc
CHLI1 Exon 1 (SEQ ID NO: 132):
atggccctgaacatgcgtgtttcctcttccaaggtcgctgccaagcagcagggccgc atctccgcggtgccggtt gtgtcgagcaaggtggcctcctccgcccgcgtggcccccttccag
CHLI1 Exon 2 (SEQ ID NO: 133):
ggcgctcccgtggccgcgcagcgcgctgctctgctgg
CHLI1 Exon 3 (SEQ ID NO: 134):
tgcgcgccgctgccgctactgaggtcaaggctgctgagggccgcactgagaaggagc tgg
CHLI1 Exon 4 (SEQ ID NO: 135):
gccaggcccgccccatcttccccttcaccgccatcgtgggccaggatgagatgaagc tggcgctgattctgaacg tgatcgaccccaagatcggtggtgtcatgatcatgggcgaccgtggcactggcaagtcca ccaccattcgtgccc tggcggatctgctgcccgagatgcag
CHLI1 Exon 5 (SEQ ID NO: 136):
gtggttgccaacgacccctttaactcggaccccaccgaccccgagctgatgagcgag gaggtgcgcaaccgcgtc aaggccggcgagcagctgcccgtgtcttccaagaagattcccatggtggacctgcccctg ggcgccactgaggac cgcgtgtgcggcaccatcgacatcgagaaggcgctgaccgagg CHLI1 Exon 6 (SEQ ID NO: 137)
gtgtcaaggcgttcgagcccggcctgctggccaaggccaaccgcggcatcctgtacg tggatgaggtcaacctgc tggacgaccacctg
CHLI1 Exon 7 (SEQ ID NO: 138):
gtcgatgtgctgctggactcggccgcctccggctggaacaccgtggagcgcgagggt atctccatcagccacccc gcccgcttcatcctggtcggctcgg
CHLI1 Exon 8 (SEQ ID NO: 139):
gcaaccccgaggagggtgagctgcgcccccagctgctggatcgcttcggcatgcacg cccagatcggcaccgtca aggacccccgcctgcgtgtgcagatcgtgtcgcagcgctcgaccttcgacgagaaccccg ccgccttccg
CHLI1 Exon 9 (SEQ ID NO: 140):
caaggactacgaggccggccagatggcgctgacccagcgcatcgtggacgcgcgcaa gctgctgaagcagggcga ggtcaactacgacttccgcgtcaagatcagccagatctgctcggacctgaacgtggacgg catccgcggcgacat cgtgaccaaccgcgccgccaaggccctggccgccttcgagggccgcaccgag
CHLI1 Exon 10 (SEQ ID NO: 141):
gtgacccccgaggacatctaccgtgtcattcccctgtgcctgcgccaccgcctccgg aaagaccccctggctgag atcgacgacggtgaccgcgtgcgtgagatcttcaagcaggtgttcggcatggagtaa
CHLI1 Intron 1 (SEQ ID NO: 142):
gtgtgcagttgcatctaaagaacgtccaattcatggttactgctcgtggatctaagc ggttggctcaccagcgtt ccatggtccccgattcgtgcacgcag
CHLI1 Intron 2 (SEQ ID NO: 143):
gtgagaagccatgatacaaatataaggatttgaagcggtagatctaggacccatcga acttgagcaccgacttgc agtccttgccttgtccggcgactgaacttctgcgcttgctttgcag
CHLI1 Intron 3 (SEQ ID NO: 144):
gtaagtgtcgcgcaaagattttctgccgggacgggtctccctcgcaacatctgaacc catggctcgtttttttgc cccgcag
CHLI1 Intron 4 (SEQ ID NO: 145):
gtgcgcgcctcccccaaccccagtttggcaaatgtgtggttaagcgtcgaaagcgtg aacagaaacaggtgttgc gggggccgcggaatggctgcaatgggtgctgggggcttcggagggtctgggggcgagttt gggtatacacgggcg cgcacacttgaaggaacgctcaaggacgacagcggaggcgtggagacagcgccggcccaa gcagcctgtacttgt agctgctggtcagctgaggcatcacgacttgggaccagcacccggcctcacggttgcaca aggccatcaccgcgc gccaccacccacgcctcttcaaacccatgccggcacctaccgctacccctgtgacacgct ccgcacacgccgccc cgcacaccccaccatgtgacag
CHLI1 Intron 5 (SEQ ID NO: 146):
gtgagagcgaggcgcggggcgtgctctgcaggctagggtgaagatcaggagagccga agcgggcccgaacagcgc agagagaggcaagacgacacccctgccgcgttttgatcacaagattcacacccttgctct ccccaacgctcccgc acatag CHLI1 Intron 6 (SEQ ID NO: 147)
gtgagcaggggcagataggcggtcgggcggctgggcggcaggggctgtgttggctgt gttgggtgtgggctgagg ctggtgggtgggctggcgggtggcagggatagcggtgaggggatggtgatggggcagaat gggcgggtgggcgga cacgtggggtcgttgaagggtgtgtggggacggcaactggtatgcgatatgtcggcttgg ccctggcggggaaag cattcgcagaatggcgcacgaacgaggccggggagcgagcggggatgggagacgcaacct gcgctgcgaagtgcg gcgcgcgctccagttgacacgttgcacgaatgtggccagtgttcgcctgagagttatggg ttagaccgccagatg agccggttaagctggtggtcgcggttgatcggctgcttcccttccggttgcacgcctggc accctaacattaccc tgtccgctgctgccctttgcccacag
CHLI1 Intron 7 (SEQ ID NO: 148):
gtgagtgcagctgccgctgcggctgctgatggtgacctgtgcgaccacggggctccg catttctggacgaagcgt tgtaccatagccgtcttggtccctgatttgggccggctctggtccgaagccttgacatct acagttcaacatggc cgtataacgatcctgtgcccacccacacgccaccccgccag
CHLI1 Intron 8 (SEQ ID NO: 149):
gtgagcgcgcgctctacgatacggcagacatgtacacactgcggcgcactgtagagc ttgcattgcatttcaagg cctcgaaagagtagggtggtcgttctctggtggtgtccggccacaattatgcaccccggt gttggtgcagcagct gtgatgtcacaccttgcatcacccccctactgctgccgcctctcctctcttctcgcccgc ag
CHLI1 Intron 9 (SEQ ID NO: 150):
gtgagcagagcaatattgcagagggaagggtggcggaagggtgataacggttgggga tctagaggggcgagatgg atgcacacagcgcggggttggttatgcatgcctgcatggacgcgtgcacgcacccctgat ctgccggttttccaa ctggcgatgccgtattatgacctgcagctcaccatcctcatgcttgatttgcctcgctca g
CHLI1 Protein sequence (SEQ ID NO: 151):
MALNMRVSSSKVAAKQQGRISAVPWSSKVASSARVAPFQGAPVAAQRAALLVRAAAATEV KAAEGRTEKELGQA RPIFPFTAIVGQDEMKLALILNVIDPKIGGVMIMGDRGTGKSTTIRALADLLPEMQWAND PFNSDPTDPELMSE EVRNRVKAGEQLPVSSKKIPMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANR GILYVDEVNLLDDHL VDVLLDSAASGWNTVEREGISISHPARFILVGSGNPEEGELRPQLLDRFGMHAQIGTVKD PRLRVQIVSQRSTFD ENPAAFRKDYEAGQMALTQRIVDARKLLKQGEVNYDFRVKISQICSDLNVDGIRGDIVTN RAAKALAAFEGRTEV TPEDIYRVIPLCLRHRLRKDPLAEIDDGDRVREIFKQVFGME
Mutant protein sequence RedAlgaeCHLH (SEQ ID NO: 152):
MQTSSLLGRRTAHPAAGATPKPVAPSPRVASTRQVACNVATGPRPPMTTFTGGNKGPAKQ QVSLDLRDEGAGMFT
STSPEMRRWPDDVKGRVKVKVVYWLEAQYQSAISAAVKNINAKNSKVCFEVVGYLLE ELRDQKNLDMLKEDVA
SANIFIGSLIFIEELAEKIVEAVSPLREKLDACLIFPSMPAVMKLNKLGTFSMAQLG QSKSVFSEFIKSARKNND
NFEEGLLKLVRTLPKVLKYLPSDKAQDAKNFVNSLQYWLGGNSDNLENLLLNTVSNY VPALKGVDFSVAEPTAYP
DVGIWHPLASGMYEDLKEYLNWYDTRKDMVFAKDAPVIGLVLQRSHLVTGDEGHYSG WAELESRGAKVIPVFAG
GLDFSAPVKKFFYDPLGSGRTFVDTWSLTGFALVGGPARQDAPKAIEALKNLNVPYL VSLPLVFQTTEEWLDSE
LGVHPVQVALQVALPELDGAMEPIVFAGRDSNTGKSHSLPDRIASLCARAVNWANLR KKRNAEKKLAVTVFSFPP
DKGNVGTAAYLNVFGSIYRVLKNLQREGYDVGALSALGGGSDPVGADPEGGQVQLDR PAHRLQDEGGRVPEAVPL
RRGAGGELGQAPRHPEHQRPGAAGVRPPVRQRLHRRAAHLRLRGRPDAPAVLEVGQP PPRLRRLLHLPGEDLQGR
RRAALRHPRLAGVHARQAGRHVGCVLPRLADRHHPQPLLLRRQQPV
CHLI1 DNA sequence (SEQ ID NO: 153):
atggccctgaacatgcgtgtttcctcttccaaggtcgctgccaagcagcagggccgc atctccgcggtgccggtt gtgtcgagcaaggtggcctcctccgcccgcgtggcccccttccagggcgctcccgtggcc gcgcagcgcgctgct ctgctggtgcgcgccgctgccgctactgaggtcaaggctgctgagggccgcactgagaag gagctgggccaggcc cgccccatcttccccttcaccgccatcgtgggccaggatgagatgaagctggcgctgatt ctgaacgtgatcgac cccaagatcggtggtgtcatgatcatgggcgaccgtggcactggcaagtccaccaccatt cgtgccctggcggat ctgctgcccgagatgcaggtggttgccaacgacccctttaactcggaccccaccgacccc gagctgatgagcgag gaggtgcgcaaccgcgtcaaggccggcgagcagctgcccgtgtcttccaagaagattccc atggtggacctgccc ctgggcgccactgaggaccgcgtgtgcggcaccatcgacatcgagaaggcgctgaccgag ggtgtcaaggcgttc gagcccggcctgctggccaaggccaaccgcggcatcctgtacgtggatgaggtcaacctg ctggacgaccacctg gtcgatgtgctgctggactcggccgcctccggctggaacaccgtggagcgcgagggtatc tccatcagccacccc gcccgcttcatcctggtcggctcgggcaaccccgaggagggtgagctgcgcccccagctg ctggatcgcttcggc atgcacgcccagatcggcaccgtcaaggacccccgcctgcgtgtgcagatcgtgtcgcag cgctcgaccttcgac gagaaccccgccgccttccgcaaggactacgaggccggccagatggcgctgacccagcgc atcgtggacgcgcgc aagctgctgaagcagggcgaggtcaactacgacttccgcgtcaagatcagccagatctgc tcggacctgaacgtg gacggcatccgcggcgacatcgtgaccaaccgcgccgccaaggccctggccgccttcgag ggccgcaccgaggtg acccccgaggacatctaccgtgtcattcccctgtgcctgcgccaccgcctccggaaagac cccctggctgagatc gacgacggtgaccgcgtgcgtgagatcttcaagcaggtgttcggcatggagtaa
[0112] Although the invention has been described with reference to the above examples, it will be understood that modifications and variations are encompassed within the spirit and scope of the invention. Accordingly, the invention is limited only by the following claims.
Next Patent: LATCHING SYSTEM FOR A VEHICLE SEAT