GASSER GILLES (CH)
MINDT THOMAS L (CH)
BAUMAN ANDREAS (DE)
UNIVERSITÄTSSPITAL BASEL (CH)
WO2000004868A2 | 2000-02-03 | |||
WO2014164988A1 | 2014-10-09 |
AMRUTA R. POREDDY ET AL: "Hydroxamate-Based Iron Chelators: Combinatorial Syntheses of Desferrioxamine B Analogues and Evaluation of Binding Affinities", JOURNAL OF COMBINATORIAL CHEMISTRY, vol. 6, no. 2, 1 March 2004 (2004-03-01), pages 239 - 254, XP055195053, ISSN: 1520-4766, DOI: 10.1021/cc030039a
Claims 1.) A ligand characterized by a general formula I: R1-D-X-D-X-D-X-D-E-R2 (I), wherein - DisC(0)N(OH)orN(OH)C(O), or or each X independently of any other X is a linker defined by the structure -(CH2)k-Ya- (CH2)m-Yb-(CH2)n-Yc-(CH2)p- o wherein each Y independently of any other Y can be -O-, -NH-, -CO-NH-, -HN-CO-, -COO- or -OCO-, o k, m, n, and p can have values from 0 to 11, and a, b and c can be 0 or 1 , and wherein each pair of D moieties is separated by 8, 9, 10 or 11 covalent bonds in the linker moiety X between them; R1 is a C1-C5 alkyl, in particular a CH3 or CH2CH3, or a C3-C6 cycloalkyl, an arene, and/or a heteroarene, wherein the arene or heteroarene consists of between five and fifteen carbon or hetero atoms, E is a linear linker and, a) an OH, SH, COOH, SCN, an activated ester, or an ene-one-system or b) a polypeptide, particularly an antibody, that specifically binds to a target site on cells and/or tissues with an association constant of lower than (<) 10"6 mol/l, <10 7mol/l, <10"8 mol/l or<10"9 mol/l. 2.) The ligand according to claim 1, wherein - D is (in text: C(0)N(OH)), - each X is - R1 is methyl, ethyl or propyl and - E is (CH2)5 - NH-. 3.) The ligand according to any one of the above claims, described by the formulae 4. ) The ligand according to any one of the above claims, wherein R2 comprises a polypeptide being a functional homologue of bombesin, somatostatin, gastrin, trans- activator of transcription peptide, prostate-specific antigen, neuropeptide Y, octreotide, gastric inhibitory polypeptide, neurokinin A, neurotensin, exendin-3, exendin-4, or substance P, said peptide comprising an amino acid sequence of at least 80%, 85%, 90%, 95%, 98%, or 99% identity to SEQ ID NO 1 , SEQ ID NO 2, SEQ ID NO 3, SEQ ID NO 4, SEQ ID NO 5, SEQ ID NO 6, SEQ ID NO 7, SEQ ID NO 8, SEQ ID NO 9, SEQ ID NO 10, SEQ ID NO 1 1 , SEQ ID NO 12, or SEQ ID NO 13, respectively. 5. ) A complex comprising a ligand according to any one of the above claims, coordinatively bound to a metal atom, particularly a metal comprised in group 3, 4, 6, 7, 9, 10, 1 1 , 13, 15, the lanthanide group of elements, or the actinide group of elements of the periodic table. 6. ) The complex according to claim 5, wherein the metal is selected from Ga, Tc, In, Cu, Tb, Sc, Lu, Re, Bi, Eu, Gd, Zr, or Y. 7. ) The complex according to any one of claims 5 or 6, wherein the metal is one of 44Sc, 64Cu, 67Ga, 68Ga, 89Zr, 90Y, 99mTc, 111ln, natEu, natGd, 177Lu, 161Tb, 186Re, 188Re, or 213Bi. 8. ) The complex according to any one of claims 5 to 7, wherein the metal - has the oxidation number +1 , +2, +3, +4, +5, +6 or +7, and/or - forms an 8-coordinate complex with the ligand. 9. ) A method of synthesis of a complex according to claims 5 to 8, comprising steps of: (a) providing a ligand according to any one of claims 1 to 4; (b) adding a metal selected from an element of group 3, 4, 6, 7, 9, 10, 1 1 , 13, or 15, the lanthanide group of elements, or the actinide group of elements of the periodic table, in particular a metal selected from Ga, Zr, Lu, or Y, more particularly an isotope selected from 67Ga, 68Ga,89Zr, 177Lu, or 90Y. (c) and optionally, isolating said complex. 10. ) A complex according to any one of claims 5 to 8, or a complex obtained by a method according to claim 9, for use as a pharmaceutical, particularly for use in a method of treatment of neoplastic disease (cancer). 1 1. ) A complex according to any one of claims 5 to 8, or a complex obtained by a method according to claim 9, for use in a method of medical diagnosis or radio- immunotherapy, particularly for use in positron emission tomography and/or single- photon emission computed tomography. 12. ) A complex according to any one of claims 5 to 8, or a complex obtained by a method according to claim 9, for use in diagnosis of neoplastic disease. 13. ) A solid support comprising a ligand covalently attached to said solid support, said ligand being characterized by a general formula I R1 - D - X - D - X - D- X - D - E - R2 (I) wherein D is C(0)N(OH) or N(OH)C(0), or each X independently of any other X is a linker defined by the structure -(CH2)k-Ya- (CH2)m-Yb-(CH2)n-Yc-(CH2)p- o wherein each Y independently of any other Y can be O, -N H-, -CO-N H-, -HN-CO-, -COO- or -OCO-, o k, m, n, and p can have values from 0 to 1 1 , and a, b and c can be 0 or 1 , and each pair of D moieties is separated by 8, 9, 10 or 1 1 covalent bonds in the linker moiety X between them R1 is a C1-C5 alkyl, particularly CH3 or CH2CH3, or a C3-C6 cycloalkyl, an arene, and/or a heteroarene, consisting of between five and fifteen carbon or hetero atoms, E is a linear linker, particularly a saturated or partially unsaturated, substituted or unsubstituted chain comprising 1 - 50 atoms and R2 is the attachment site to said solid support. 14. ) The solid support according to claim 13, wherein said solid support is a nanoparticle. 15. ) The solid support according to claims 13 or 14, wherein said nanoparticle is selected from gold, silica, lipids, polymeric, metal or metal oxide compositions comprising the metals iron, manganese, or titanium. |
FOR RADIONUCLIDE COMPLEXATION IN DIAGNOSTICS AND THERAPY
Description
The present invention relates to multidentate ligand systems and metal complexes thereof, and to their use in diagnostics and therapy.
Background of the invention
89 Zr is a metallic radionuclide with promising characteristics for application in medical diagnosis. For in vivo diagnostics or therapeutic applications where radio-labelled
compositions are employed, it is important that the radionuclide specifically localizes to target tissues. To provide specific binding to, or absorption by, the particular cells or tissue(s) of interest, radionuclides are generally coupled to targeting agents. Typically, metallic radionuclides are bound to a chelating agent, and the chelating agent is coupled to a targeting moiety, which provides the radiolabeled composition with the ability to bind selectively to a specific population of target cells or tissue(s).
8 9 Zr radiolabeled compounds may be employed in a variety of techniques, including PET (positron emission tomography) diagnostics, in particular in the field of immuno-PET, where antibody-based radiotracers are used to image tumours based on the expression of tumour- associated antigens on tumour cells. Radionuclides with suitable half-lives are often employed in nuclear medicine. The half-live of 89 Zr, which is 78.4 h, matches the biological half-lives of antibodies. This makes 89 Zr a favourable radiometal for application in immuno- PET, which often requires imaging at late time points due to slow accumulation (e.g. several days) of the radioconjugate in the target tissue.
Besides PET radionuclides such as 89 Zr, 44 Sc, 64 Cu, and 68 Ga, gamma ray emitting metallic radionuclides such as 67 Ga, 111 ln, or 99m Tc may also be employed for imaging studies in immunodiagnostics, particularly in single-photon emission computed tomography (SPECT). In addition, particle emitting radionuclides such as 177 Lu, 90 Y or 213 Bi may be employed in therapeutic applications.
Chelation describes a process in which a metal ion or a pre-complexed form thereof, reacts with a chelating agent to form a coordinated chelate complex, in which the metal is coordinatively bound to the chelating agent at two or more sites. The sequestration properties of chelating agents are not only exploited in nuclear medicine in form of radiopharmaceuticals, but also in detoxification techniques. It may also be applied to the development of MRI contrast agent based on gadolinium (Gd) or iron (Fe).
Desferrioxamine (DFO, CAS No. 70-51-9) is a hexadentate chelator, which is clinically approved for the treatment of iron poisoning. 89 Zr has been conjugated to a functionalized derivative of DFO (Fischer et al. Molecules 2013, 18, 6469-6490). DFO coordinates only six of the eight available coordination sites of the metal atom, while water molecules occupy the remaining positions. The inability of DFO to bind all coordination sites of Zr 4+ results in an unfavourable stability of the complex in vivo. Dissociation of 89 Zr from the conjugate in vivo results in its accumulation in radiation sensitive tissue (red bone marrow, specifically). Such unspecific deposition of radioactivity in vivo poses serious limitations to 89 Zr-based radiopharmaceuticals for clinical applications due to the radiation burden to the patients.
The objective of the present invention is to provide improved means for delivering radionuclides, particularly 67 Ga, 68 Ga, 89 Zr, 177 Lu, and 90 Y, for diagnostics and/or therapeutic use. This objective is attained by the subject-matter of the independent claims.
Terms and definitions
Amino acid sequences are given from amino to carboxyl terminus. Capital letters for sequence positions refer to L-amino acids in the one-letter code (Stryer, Biochemistry, 3 rd ed. p. 21 ).
A C 1 -C 4 alkyl in the context of the present specification signifies a saturated linear or branched hydrocarbon having 1 , 2, 3 or 4 carbon atoms, wherein one carbon-carbon bond may be unsaturated and one CH 2 moiety may be exchanged for oxygen, sulphur or nitrogen (an ether, thioether, sulfoxide, sulfone or amine bridge). Non-limiting examples for a C 1 -C 4 alkyl are methyl, ethyl, propyl, prop-2-enyl, n-butyl, 2-methylpropyl, fert-butyl, but-3-enyl, prop-2-inyl and but-3-inyl.
A C 1 -C 5 alkyl in the context of the present specification signifies a saturated linear or branched hydrocarbon having 1 , 2, 3, 4 or 5 carbon atoms, wherein one carbon-carbon bond may be unsaturated and one CH 2 moiety may be exchanged for oxygen, sulphur or nitrogen (an ether, thioether, sulfoxide, sulfone or amine bridge). Non-limiting examples for a C 1 -C 5 alkyl include the examples given for C 1 -C 4 alkyl above, and additionally 3-methylbut-2-enyl, 2-methylbut-3-enyl, 3-methylbut-3-enyl, n-pentyl, 2-methylbutyl, 3-methylbutyl, 1 , 1- dimethylpropyl, 1 ,2-dimethylpropyl, 1 ,2-dimethylpropyl and pent-4-inyl.
A C 1 -C 8 alkyl in the context of the present specification signifies a saturated linear or branched hydrocarbon having from one to 8 carbon atoms and includes the definitions for d- C 4 alkyl and C 1 -C 5 alkyl given above.
A saturated alkyl is an alkyl having only saturated carbon-carbon bonds. A partially unsaturated alkyl is an alkyl comprising isolated or conjugated carbon-carbon double bonds, but not aromatic double bonds.
The term arene (or: "aryl") in the context of the present specification signifies a cyclic aromatic C 5 -C 10 hydrocarbon. Examples of arene include, without being restricted to, phenyl, naphtyl and heteroarene. A heteroarene ("heteroaryl") in the context of the present invention is an arene that comprises one or several nitrogen, oxygen, and/or sulphur atoms as part of the aromatic system. Examples for heteroarene include, without being restricted to, pyrrole, thiophene, furan, imidazole, pyrazole, thiazole, oxazole, pyridine, thiazine, quinolone, benzofuran and indole. An arene or a heteroarene in the context of the invention additionally may be substituted by one or more alkyl groups. In certain preferred embodiments, the heteroarene is unsubstituted.
The term "substituted" refers to the addition of a substituent group to a parent compound.
"Substituent groups" can be protected or unprotected and can be added to one available site or to many available sites in a parent compound.
"Protected" substituent groups are reactive substituent groups such as a hydroxyl group, an amine or sulfhydryl group, a carboxylic acid group or an carboxylic acid amide group within an organic molecule, which are derivatized to the effect of decreasing their reactivity during a conversion step of the organic molecule, while retaining the ability to restore the substituent group readily by cleavage of the protecting group. Protecting groups and their use are reviewed in Wuts, Greene's protective groups in organic synthesis, Wiley 5 th edition 2014 (ISBN 978-1 1 18057483).
Substituent groups may also be further substituted with other substituent groups and may be attached directly or by a linking group such as an alkyl or hydrocarbyl group to a parent compound. "Substituent groups" amenable herein include, without limitation, halogen, oxygen, nitrogen, sulphur, hydroxyl, alkyl, alkenyl, alkynyl, acyl (-C(O)R 3 ), carboxyl (- C(O)OR a ), aliphatic groups, alicyclic groups, alkoxy, substituted oxy (-OR a ), aryl, aralkyl, heterocyclic radical, heteroaryl, heteroarylalkyl, amino
(-N(R b )(R c )), imino (=NR b ), amido (-C(O)N(R b )(R c ) or -N(R b )C(O)R a ), hydrazine derivates (-C(NH)NR a R b ), tetrazole (CN 4 H 2 ), azido (-N 3 ), nitro (-NO 2 ), cyano (-CN), isocyano (-NC), cyanato (-OCN), isocyanato (-NCO), thiocyanato (-SCN); isothiocyanato (-NCS); carbamido (-OC(O)N(R b )(R c ) or -N(R b )C(0)OR a ), thiol (-SR b ), sulfinyl (-S(O)R b ), sulfonyl (-S(O) 2 R b ), sulfonamidyl (-S(0) 2 N(R b )(R c )or -N(R b )S(O) 2 R b ) and fluorinated compounds -CF 3 , -OCF 3 , -SCF 3 , -SOCF 3 or -SO 2 CF 3 , wherein each R a , R b and R c is, independently, H or a further substituent group with a preferred list including without limitation, H, alkyl, alkenyl, alkynyl, aliphatic, alkoxy, acyl, aryl, heteroaryl, alicyclic, heterocyclic and heteroarylalkyl.
An unsubstituted linker chain is a chain constituted only of a linear chain of linker atoms N (nitrogen), C (carbon) and O (oxygen), bound to hydrogen atoms where appropriate. Non- limiting examples are methylene (-CH 2 -), ethyl (-CH 2 CH 2 -) or ethoxyethyl (-CH 2 CH 2 -O- CH 2 CH 2 -) linker. A substituted linker chain is a chain constituted of a linear chain of linker atoms N (nitrogen), C (carbon) and O (oxygen), wherein some or all linker atoms are bound to substitute moieties as defined above.
Identity in the context of the present specification is a single quantitative parameter representing the result of a sequence comparison position by position. Methods of sequence comparison are known in the art; the BLAST algorithm available publicly is an example.
Summary of the invention
The present invention relates to a ligand able to coordinate Zirconium ions and other related metal ions by four hydroxamate groups, wherein the hydroxamate moieties are spaced by between 9 and 12 bonds, particularly 10 bonds, in other words the hydroxamates are separated by linkers having between 8 and 1 1 , particularly 9 carbon or hetero atoms between them. The ligand is attached, or attachable, covalently to a moiety conferring targeting specificity onto the ligand. The moiety conferring targeting specificity may be an antibody or a ligand for a tissue-specific receptor.
The invention further relates to a complex between the ligand of the invention, and a metal atom coordinated by the ligand.
The invention further relates to the use of such complex in diagnosis or therapy of disease. Detailed description of the invention
According to a first aspect of the invention, a ligand characterized by a general formula I:
R 1 - D - X - D - X - D - X - D- E - R 2 (I) is provided,
wherein
each D is a hydroxamate moiety, each X is a spacer separating two hydroxamate moieties, R 1 is a non-reactive terminal moiety, R 2 is a moiety conferring tissue specificity or the ability to link the molecule to a tissue specific moiety, and E is an optional spacer separating the ligand and R 2 .
In particular,
each X independently of any other X is a saturated or partially unsaturated, substituted or unsubstituted linker comprising a chain of 8, 9, 10 or 1 1 , in certain embodiments particularly 9, atoms selected from any of N, C and O,
R 1 is or comprises H, a C 1 -C 5 alkyl, a C 3 -C 6 cycloalkyl, an arene, and/or a heteroarene;
E is a saturated or partially unsaturated, substituted or unsubstituted linker comprising a chain of 1 - 50 atoms and
- R 2 is
a) an OH, NH 2 , SH, COOH, CHO, N 3 , SCN, CH 2 X (X = CI, Br, I), activated ester (e.g., NHS, tetra-or pentafluoro phenol derivatives), an ene-one-system (alpha, beta unsaturated carbonyl, a Michael acceptor system (e.g., maleimide)) a diene/dienophile (Diels Alder), an alkene, or an alkyne,
b) a first click moiety capable of selectively forming a covalent bond with a second click moiety R 3 under reaction conditions not leading to a covalent reaction of R 2 or R 3 with natural occurring polypeptides, in particular with proteins, or c) an antibody, an oligopeptide, a polypeptide, a polynucleotide, a liposome, a polymerosome, a phospholipid, a vitamin, a monosaccharide, an
oligosaccharide, a nanoparticle, or a drug-like molecule having a molecular weight less than (<) 3000 U, or a moiety that specifically binds to a target site on cells and/or tissues with an association constant of lower than (<) 10 -6 mol/l,
<10 -7 mol/l, <10 -8 mol/l or <10 -9 mol/l, or
d) a solid support.
In certain embodiments, D is a substituted or unsubstituted pyrimidinone or pyridinone moiety.
In certain embodiments, X is a saturated or partially unsaturated, substituted or unsubstituted linker comprising 8, 9, 10, or 1 1 atoms, particularly 9 atoms within the chain (the counted atoms constituting the chain backbone; i.e. an ethyl group CH 2 -CH 2 counts as two atoms; the chains -C(O)NHCH 2 CH 2 CH 2 - and -C(O)NHCH(CH 3 )CH 2 CH 2 - both count as 5 atoms; counted atoms are underlined) selected from CH 2 , NR, CO and O, with R being H or C 1 -C 4 alkyl. In certain embodiments, R is H.
In certain embodiments, X is unsubstituted. In certain embodiments, X is an unsubstituted linear chain consisting of CrC 5 alkyl moieties bridged (linked) by COO (ester) or CONH (amide) moieties. In certain embodiments, each X independently of any other X is a saturated or unsaturated, substituted or unsubstituted heterocyclic moiety. In certain embodiments, each X independently of any other X is a linker defined by the structure -(CH 2 ) k -Y- (CH2)m-Y-(CH2)n-Y-(CH 2 )p-, wherein each Y independently of any other Y can be an ether bridge (-O-), an amine bridge (-NH- or -NCH 3 -), an amide bridge in either orientation (-CO-NH-, or -HN-CO-), or an ester bridge in either orientation (-COO- or -OCO), with the proviso that the number of covalent links in the linker chain is 7 to 10, in other words, each pair of D moieties is separated by 8, 9, 10 or 1 1 covalent bonds in the linker moiety X between them.
In certain embodiments, each X independently of any other X is a linker defined by the structure -(CH 2 ) k -Y a - (CH2)m-Yb-(CH2)n-Yc-(CH 2 )p-, each Y independently of any other Y is an amide bridge in either orientation (-CO-NH-, or -HN-CO-), or an ester bridge in either orientation (-COO- or -OCO), k, m, n, and p can have values from 0 to 1 1 , a, b and c are either 0 or 1 and the sum of k+m+n+2 (a+b+c) is a number between 8 and 1 1.
In certain embodiments, R 1 is CH 3 , CH 2 CH 3 , or a saturated or partially unsaturated C 3 -C 6 cyclic alkyl moiety, or a monoanular or bianular aryl or heteroaryl moiety, particularly a saturated or partially unsaturated C 3 -C 6 cyclic alkyl moiety, or a monoanular or bianular aryl or heteroaryl moiety consisting of between three and fifteen carbon or hetero (N, C, O, S) atoms (and hydrogen as appropriate).
In certain embodiments, E is a saturated or partially unsaturated, substituted or unsubstituted linker comprising 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 20, 5 to 25, 10 to 30, 20 to 50 or 30 to 50 atoms selected from C, O, N and S (the counted atoms constituting the chain backbone and are counted as exemplified for X above). In certain embodiments, E is integral with R 2 .
In certain embodiments, D is (in text form: C(0)N(OH)),
each X is (all X are)
R 1 is methyl, ethyl or propyl, and
E is (CH 2 ) 5 NH-.
In one embodiment, the ligand is characterized by the following formula:
In another embodiment, the ligand is characterized by the following formula:
In certain embodiments, R 2 comprises, or is, an antibody, an oligopeptide, a polypeptide or protein, a polynucleotide, a liposome, a polymerosome, a phospholipid, a vitamin, a monosaccharide, an oligosaccharide, a nanoparticle, or a drug-like molecule having a molecular mass less than (<) 3000 U, any of which is selective for a disease specific ligand, a cell specific ligand or a tissue specific ligand.
In certain embodiments, R 2 is a vitamin selected from folic acid, biotin, retinol, thiamine, riboflavin, niacin, pantothenic acid, pyridoxine, ascorbic acid, cyanocobalamin,
cholecalciferol, tocopherol, and phylloquinone.
In certain embodiments, R 2 comprises, or is, a biotin molecule. Biotin may be bound to the ligand by conjugation to an amine, sulfhydryl and/or OH via its valeric acid side chain. Non- covalent binding of biotin to avidin or streptavidin, which in turn is covalently linked to a high- specificity ligand such as an antibody, can be employed to enhance the versatility of the ocatadentate ligand of the invention, for example for use in radionuclide-based diagnosis and therapy. In certain embodiments, R 2 comprises an avidin or streptavidin molecule conjugated to the ligand allowing for binding non-covalently to biotin-labelled molecules.
In certain embodiments, R 2 is an OH, SH, COOH, SCN, activated ester, or an ene-one- system (an alpha, beta unsaturated carbonyl, also referred to as a Michael acceptor system).
In certain embodiments, R 2 comprises, or is, one partner of two partners forming a so-called click reaction couple. In such embodiments, R 2 is a first click moiety capable of forming a covalent bond selectively with a second click moiety R 3 under reaction conditions not leading to a covalent reaction of R 2 or R 3 with natural occurring polypeptides, in particular with proteins. The click reactive groups are meant to conjugate the ligand to molecules of interest and at the same time provide the possibility of novel pre-targeting approaches. In certain embodiments, R 2 is selected from an azide, an alkyne, a tetrazine, a cyclooctine and a trans- cyclooctene, Suitable click reaction partners are well known in the art.
In certain embodiments, R 2 comprises, or is, a drug like moiety having a molecular mass of more then 160 u but less than 1000 u, less than 700 u, or less than 500 u, comprises up to five hydrogen bond donators (e.g., oxygen and or nitrogen atoms with one H attached), up to ten hydrogen bond acceptors (e.g., oxygen or nitrogen atoms) and an octanol-water partition coefficient logP of below 5.6 (any of these characteristics applied to the isolated R 2 moiety, without regard to the rest of compound I). These are the so-called "Lipinski" rules of 5 (originally, referring to molecules between 160 and 500 u) for drug-like compounds.
In certain embodiments, R 2 comprises, or is, an antibody, an antibody fragment, an antibodylike molecule, an oligopeptide or a nucleic acid aptamer molecule of 10 to 75 nucleotides in length, capable of binding to a cell specific or tissue specific target, particularly a cancer specific target.
An antibody fragment may be a Fab domain or an Fv domain of an antibody, or a single- chain antibody fragment, which is a fusion protein consisting of the variable regions of light and heavy chains of an antibody connected by a peptide linker. The R 2 moiety may also be a single domain antibody, consisting of an isolated variable domain from a heavy or light chain. Additionally, an antibody may also be a heavy-chain antibody consisting of only heavy chains such as antibodies found in camelids. An antibody-like molecule may be a repeat protein, such as a designed ankyrin repeat protein (Molecular Partners, Zurich).
Methods for generating antibodies against cell specific or tissue specific targets are known in the art. They include, for example, immunization of mice with human isolated targets, or immunization of mice with expression vectors encoding the target (DNA immunization).
Suitable R 2 moieties according to the above aspect of the invention may also be developed by evolutive methods such as phage display, ribosome display or SELEX, wherein polypeptides or oligonucleotides are selected due to their binding affinity to a target of interest. Additionally, the binding affinity of an identified R 2 moiety may be improved by cycles of evolution of the amino acid sequence or nucleotide sequence and selection of the evolved R 2 moiety may be effected based on the required affinity.
In embodiments where R 2 comprises an oligopeptide, R 2 may be a peptide that can bind to a recognition site of a receptor situated on the surface of a tissue-specific cell.
Alternatively, R 2 may comprise a soluble polypeptide comprising a contiguous amino acid sequence of at least 8 amino acid residues taken from the protein sequence of a soluble polypeptide ligand of a cell- or tissue specific receptor, wherein said soluble polypeptide binds to said receptor with a dissociation constant of 10 -6 mol/l or lower, particularly with a dissociation constant of≤10 -8 mol/l.
In certain embodiments, R 2 comprises, or is, a monosaccharide consisting of three to seven carbon atoms. Examples are glyceraldehyde (C3), erythrose or threose (C4), arabinose, ribose or xylose (C5) glucose, mannose, galactose or fructose (C6) or sedoheptulose (C7). The sugar alcohols and amino sugars of C3 to C7 monosaccharides are included in the group of monosaccharides according to the definition used herein.
An oligosaccharide is a molecule consisting of two to ten of the same or different monosaccharides according to the above definition. A polysaccharide comprises more than ten monosaccharides.
In certain embodiments, R 2 comprises, or is, a vesicle-like molecule enclosing a solution comprising nutrients and/or drugs, which is used for administration of said nutrients and/or drugs (see Mishra et al., Journal of Biomedical Materials Research, Part A (2013), 101A(12), 3646-3660).
In certain embodiments, R 2 comprises, or is, a lipid structure with amphipathic character used as vesicular carrier for enhanced delivery of nutrients and/or drugs, thereby improving bioavailability and reducing toxicity.
In certain embodiments, R 2 is an alkyne or azide moiety, an alkyne, a tetrazine, a cyclooctine, a trans-cyclooctene, a carboxy group, an amino group, iodine, bromine, chlorine, succinimide, thiol group, a cyclooctyne moiety, biotin, avidin, or streptavidin.
In certain embodiments, R 2 is a nanomaterial, more particularly a nanoparticle. Nanoparticles may be selected from gold, silica, lipids, polymeric, metal or metal oxide compositions, wherein said metals are selected from iron, manganese, or titanium. The sizes of nanoparticles cover a range between 1 and 500 nanometers. They have unique physicochemical properties due to their large surface area to mass ratio and high activity, which differs from bulk materials of the same composition. For diagnostic and therapeutic applications, nanoparticles may be covalently linked to amino acids, antibodies, aptamers, avidin, streptavidin, peptides, polypeptides, polynucleotides, and/or nucleotides, which specifically bind to their biological targets. Drug-coated or liposomal nanoparticles may be used as carrier particles for targeted drug delivery. Metal oxide nanoparticles conjugated to radioisotopes enable monitoring of their biodistribution in vivo.
"Nucleotides" in the context of the present specification are nucleic acid or nucleic acid analogue building blocks, oligomers of which are capable of forming selective hybrids with DNA or RNA oligomers or artificial nucleic acid oligomers on the basis of base pairing. The term nucleotides in this context includes the classic ribonucleotide building blocks adenosine, guanosine, uridine (and ribosylthymin), cytidine, the classic deoxyribonucleotides deoxyadenosine, deoxyguanosine, thymidine, deoxyuridine and deoxycytidine. It further includes analogues of nucleic acids such as phosphotioates, 2'0-methylphosphothioates, peptide nucleic acids (PNA; N-(2-aminoethyl)-glycine units linked by peptide linkage, with the nucleobase attached to the alpha-carbon of the glycine) or locked nucleic acids (LNA; 2Ό, 4'C methylene bridged RNA building blocks). The hybridizing sequence may be composed of any of the above nucleotides, or mixtures thereof.
Targeting moieties:
In certain embodiments, R 2 is bombesin (CAS No. 31362-50-2). In certain embodiments, R 2 comprises a functional homologue of bombesin, having an amino acid sequence of at least 80%, 85%, 90%, 95%, 98%, 99% identity to SEQ ID NO 1 (bombesin)
SEQ ID NO 1 : QQRLGNQWAVGHLM
In certain embodiments, R 2 is somatostatin (CAS No. 38916-34-6). In certain embodiments, R 2 comprises a functional homologue of somatostatin, having an amino acid sequence of at least 80%, 85%, 90%, 95%, 98%, 99% identity to SEQ ID NO 2 (somatostatin).
SEQ ID NO 2:
MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQ TENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
In certain embodiments, R 2 is gastrin (UniProt ID: P01350). In certain embodiments, R 2 comprises a functional homologue of gastrin, having an amino acid sequence of at least 80%, 85%, 90%, 95%, 98%, 99% identity to SEQ ID NO 3 (gastrin).
SEQ ID NO 3:
MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQL GPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN
In certain embodiments, R 2 comprises a peptide sequence of trans-activator of transcription protein (tat) (Pfam ID: PF00539). In certain embodiments, R 2 comprises the amino acid sequence of the protein transduction domain identical to SEQ ID NO 4 (tat peptide transduction domain).
SEQ ID NO 4: YGRKKRRQRRR
In certain embodiments, R 2 is prostate-specific antigen (PSA) (UniProt ID: P07288). In certain embodiments, R 2 comprises a functional homologue of PSA, having an amino acid sequence of at least 80%, 85%, 90%, 95%, 98%, 99% identity to SEQ ID NO 5 (PSA).
SEQ ID NO 5:
MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWV LTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHD LM LLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISND VC AQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLY TKVVH YRKWI KDTI VAN P
In certain embodiments, R 2 is neuropeptide Y (NPY) (UniProt ID: P01303). In certain embodiments, R 2 comprises a functional homologue of NPY, having an amino acid sequence of at least 80%, 85%, 90%, 95%, 98%, 99% identity to SEQ ID NO 6 (NPY).
SEQ ID NO 6:
MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLIT RQ RYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW
In certain embodiments, R 2 is octreotide (CAS No. 83150-76-9), also known as "Sandostatin" (Novartis Pharmaceuticals), identical to SEQ NO 7. Octreotide is an octapeptide that pharmacologically mimics natural somatostatin, though it is a more potent inhibitor of growth hormone, glucagon, and insulin than somatostatin.
SEQ ID NO 7: FCFWKYCT-ol (Disulfide bridge: 2-7)
In certain embodiments, R 2 is gastric inhibitory polypeptide (GIP) (UniProt ID: P09681 ). In certain embodiments, R 2 comprises a functional homologue of GIP, having an amino acid sequence of at least 80%, 85%, 90%, 95%, 98%, 99% identity to SEQ ID NO 8 (GIP).
SEQ ID NO 8:
MVATKTFALLLLSLFLAVGLGEKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTF ISDYSI AMDKIHQQDFVNWLLAQKGKKNDWKHNITQREARALELASQANRKEEEAVEPQSSPAKNP SDEDLLRDLLIQELLACLLDQTNLCRLRSR
In certain embodiments, R 2 is neurokinin A (NKA) (UniProt ID: P20366). In certain
embodiments, R 2 comprises a functional homologue of NKA, having an amino acid sequence of at least 80%, 85%, 90%, 95%, 98%, 99% identity to SEQ ID NO 9 (NKA).
SEQ ID NO 9:
MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEHLLQRIARRPK PQ QFFGLMGKRDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERSAM QNYERRR
In certain embodiments, R 2 is neurotensin (UniPro ID: P30990). In certain embodiments, R 2 comprises a functional homologue of neurotensin, having an amino acid sequence of at least 80%, 85%, 90%, 95%, 98%, 99% identity to SEQ ID NO 10 (NKA).
SEQ ID NO 10:
MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLN V CSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWEL IQ EDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY
In certain embodiments, R 2 is exendin-3 (CAS No. 130357-25-4). In certain embodiments, R 2 comprises a functional homologue of exendin-3, having an amino acid sequence of at least 80%, 85%, 90%, 95%, 98%, 99% identity to SEQ ID NO 1 1 (exendin-3).
SEQ ID NO 1 1 : HGGGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH 2
In certain embodiments, R 2 is exendin-4 (CAS No. 141758-74-9). In certain embodiments, R 2 comprises a functional homologue of exendin-4, having an amino acid sequence of at least 80%, 85%, 90%, 95%, 98%, 99% identity to SEQ ID NO 12 (exendin-4).SEQ ID NO 12: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
In certain embodiments, R 2 is substance P (SP) comprising the amino acid sequence identical to SEQ ID NO 13 (substance P).
SEQ ID NO 13: RPKPQQFFGLM
According to a second aspect of the invention, a compound formed by complex formation between the ligand according to the first aspect of the invention and a metal atom is provided. The metal atom is coordinatively bound to the D moieties of the ligand. In certain embodiments, the metal atom is octa-coordinated, i.e. eight atoms of the ligand collaborate in complex formation with the atom (the coordination number is 8), particularly where the metal is Zr or Y, more particularly where the metal is 89 Zr or 90 Y.
In certain embodiments, the metal atom is hexa-coordinated, i.e. six atoms of the ligand collaborate in complex formation with the atom, particularly where the metal is Ga or In, more particularly where the metal is 111 ln, 67 Ga or 68 Ga. In certain embodiments, the metal atom is tetra-coordinated. In certain embodiments, the metal atom is penta-coordinated.
In certain embodiments, the metal has the oxidation number +1 , +2, +3, +4, + 5, +6, or +7. In certain embodiments, the metal has the oxidation number +3, +4, +5 or +6. In certain embodiments, the metal has a coordination number from 4 to 8.
In certain embodiments, the metal is comprised in any one of the groups 3, 4, 6, 7, 9, 10, 1 1 , 13, 15, the lanthanide group of elements, or the actinide group of elements of the periodic table of the elements. Groups are assigned in accordance to current lUPAC practice, older designations refer to the "scandium group" (MIA) for group 3, "titanium group" (IVA) for group 4, "actinides group" for group 6, "manganese group" for group 7, "lanthanides group" comprising group, 9, 10, and 1 1 , "boron group" for group 13, and "nitrogen group" for group 15. In certain embodiments, the metal is selected from zirconium (Zr), yttrium (Y), gallium (Ga), technetium (Tc), indium (In), copper (Cu), terbium (Tb), scandium (Sc), lutetium (Lu), rhenium (Re), bismuth (Bi), europium (Eu), gold (Au), iron (Fe), magnesium (Mg) or gadolinium (Gd).
In certain embodiments, the metal is a metallic radionuclide. A radionuclide, or a radioactive nuclide, is an atom with an unstable nucleus, which undergoes radioactive decay, resulting in the emission of gamma ray(s) or subatomic particles such as positrons, alpha or beta particles, or Auger electrons. These emissions constitute ionizing radiation. Radionuclides occur naturally, or can be produced artificially. Radionuclides are often referred to as radioactive isotopes or radioisotopes.
In certain embodiments, the metal is selected from 44 Sc, 64 Cu, 67 Ga, 68 Ga, 89 Zr, 90 Y, 99m Tc, 111 ln, nat Gd, nat Eu, 177 Lu, 186 Re, 188 Re, or 213 Bi. In certain embodiments, the metal is 67 Ga, 68 Ga, 89 Zr, or 90 Y.
In certain embodiments, the complex is an octadentate complex and the metal is selected from 67 Ga, 68 Ga, 89 Zr, or 90 Y.
The invention is not limited to octadentate coordinated complexes. In certain embodiments, the complex may comprise Ga or In and may be 6-coordinate. In certain embodiments, the complex may comprise Zr or Y and may be 8-coordinate. In certain embodiments, the complex may comprise Tc and may be 4-coordinate. Even if a metal does not require all coordination sites provided by the ligand system, the ligand will increase the stability of the complex simply by providing higher "concentration" of coordinating groups in the near vicinity of the metal which will protect it from trans-chelation.
According to a third aspect of the invention, a method for the synthesis of a complex according to the second aspect of the invention is provided, wherein a ligand according to the first aspect of the invention is reacted with a metal, particularly a metal of group 3, 4, 6, 7, 9, 10, 1 1 , 13, 15, the lanthanide group of elements, or the actinide group of elements of the periodic table is reacted with the ligand.
In certain embodiments, the complex is formed by providing a ligand according to the invention, and adding a metal. In certain embodiments, the metal is selected from Ga, Tc, In, Cu, Tb, Sc, Lu, Re, Bi, Eu, Gd, Zr, or Y.
In certain embodiments, the metal is selected from the isotopes 67 Ga, 68 Ga, 89 Zr, or 90 Y.
In certain embodiments, the complex is isolated after synthesis by high-performance liquid chromatography (HPLC).
In certain embodiments, an octa co-ordinated complex I (b) is formed by reaction of a ligand I (a) with a metal comprised in any one of the groups 3, 4, 6, 7, 9, 10, 1 1 , 13, or 15 of the periodic table of the elements. In certain embodiments the metal is zirconium. In certain embodiments, said complex I is formed by reaction of said ligand (a) with zirconium chloride (ZrCI 4 ) (CAS No. 10026-1 1-6). Figure 2 shows the calculated structure of the octa coordinated complex I.
In another embodiment, an octa co-ordinated complex II (d) is formed by reaction of a ligand II (c) with a metal comprised in any one of the groups 3, 4, 6, 7, 9, 10, 1 1 , 13, or 15 of the periodic table of the elements. In certain embodiments the metal is zirconium. In certain embodiments, said complex II is formed by reaction of said ligand II with zirconium (IV) acetylacetonate (CAS No. 10026-1 1 -6).
In yet another embodiment, ligand III (e) is synthesised from a peptide precursor compound. In certain embodiments, said peptide precursor compound is a modified amino acid sequence of bombesin.
SEQ ID NO 14: (3-A) 3 -QWAVGHL-14Nle-CONH 2
In certain embodiments, complex III is formed by reaction of said ligand III (e) with a metal comprised in any one of groups 3, 4, 6, 7, 9, 10, 1 1 , 13, or 15 of the periodic table of the elements. In certain embodiments the metal is zirconium. In certain embodiments, ligand III is radiolabeled using commercial 89 zirconium oxalate. Figure 1 shows stability of complex III in comparison to a hexadentate 89 zirconium-complex.
Particular embodiments of this aspect of the invention are:
ligand I
a. N-[5-[[4-[5-[[4-[5-[acetyl(hydroxy)amino]pentylamino]-4-oxo- butanoyl]-hydroxy- amino]pentylamino]-4-oxo-butanoyl]-hydroxy-amino]pentyl]-N'- (5-aminopentyl)-N'- hydroxy-butanediamide (ligand I) and its Zr complex I:
ligand II
4-[5-[[4-[5-[[4-[5-[[4-[5-[acetyl(hydroxy)amino]pentylami no]-4-oxo-butanoyl]-hydroxy- amino]pentylamino]-4-oxo-butanoyl]-hydroxy-amino]pentylamino ]-4-oxo-butanoyl]- hydroxy-amino]pentylamino]-4-oxo-butanoic acid (ligand II) and its Zr complex II:
compl
Octa co-ordinated complex II
(Ligand III) (amide hydrogens not shown)
e. (2S)-2-[3-[3-[3-[[4-[5-[[4-[5-[[4-[5-[[4-[5-[acetyl(hydroxy) amino]pentylamino]-4-oxo- butanoyl]-hydroxy-amino]pentylamino]-4-oxo-butanoyl]-hydroxy -amino]pentylamino]- 4-oxo-butanoyl]-hydroxy-amino]pentylamino]-4-oxo- butanoyl]amino]propanoylamino]propanoylamino]propanoylamino] -N-[(1 S)-2-[[(1 S)-2- [[1 -[[2-[[(1 S)-2-[[(1 S)-1-[[(1 S)-1-carbamoylpentyl]carbamoyl]-3-methyl-butyl]amino]-1 - (1 H-imidazol-4-ylmethyl)-2-oxo-ethyl]amino]-2-oxo-ethyl]carbam oyl]-2-methyl- propyl]amino]-1 -methyl-2-oxo-ethyl]amino]-1-(1 H-indol-3-ylmethyl)-2-oxo- ethyl]pentanediamide. (Ligand III)
f. Octa co-ordinated complex III (see structure under Example h).
Other particular embodiments relate to molecules comprising ligand I, II or III complexed to 8 9 Zr, and covalently linked to any of the above named targeting moieties.
According to an alternative aspect, the invention provides a ligand characterized by the features as outlined in the following items:
Item 1 : a ligand characterized by a general formula I:
R 1 - D - X - D - X - D- X - D - E - R 2 (I), wherein
each X independently of any other X is a saturated or partially unsaturated, substituted or unsubstituted linker comprising a chain of 2, 3, 4, 5, 6, 7, 8, 9, 10 or 1 1 , in some embodiments particularly 9 atoms selected from any of N, C, O, in particular CH 2 , NH, CO, O, with R being H or C1-C4 alkyl, or each X independently of any other X is a saturated or unsaturated, substituted or unsubstituted heterocyclic moiety, R 1 is or comprises a CrC 5 alkyl, a C 3 -C 6 cycloalkyl, an arene, and/or a heteroarene,
E is a saturated or partially unsaturated, substituted or unsubstituted linker comprising a chain comprising 1 - 50 atoms and
- R 2 is
a) an OH, SH, COOH, SCN, activated ester, or an ene-one-system ; b) a first click moiety capable of forming a covalent bond selectively with a
second click moiety R 3 under reaction conditions not leading to a covalent reaction of R 2 or R 3 with natural occurring polypeptides, in particular with proteins, or
c) a targeting moiety that specifically binds to a target site on cells and/or tissues with an association constant of lower than (≤) 10 -6 mol/l, <10 -7 mol/l, <10 -8 mol/l or <10 -9 mol/l, particularly an antibody, an oligopeptide, a polypeptide, a polynucleotide, a liposome, a polymerosome, a phospholipid, a vitamin, a monosaccharide, an oligosaccharide, a nanoparticle, or a drug-like molecule having a molecular weight less than (<) 3000 U, or
d) a solid support.
Item 2: The ligand according to item 1 , wherein
- R 2 is
i. an alkyne or azide moiety, an alkyne, a tetrazine, a cyclooctine, a trans-cyclooctene, a carboxy group, an amino group, iodine, bromine, chlorine, succinimide, thiol group, a cyclooctyne moiety, biotin, avidin, or streptavidin,
ii. an antibody, a polypeptide, a polypeptide, a polynucleotide, a
liposome, a polymerosome, a phospholipid, a vitamin, a
monosaccharide, an oligosaccharide, a nanoparticle, or a drug-like molecule having a molecular weight less than (<) 3000 U;
- each X is
- R 1 is methyl, ethyl or propyl and
- E is (CH 2 ) 5 - NH-.
Item 3: The ligand according to any one of the above items, wherein R 2 comprises a polypeptide being a functional homologue of bombesin, somatostatin, gastrin, trans-activator of transcription peptide, prostate-specific antigen, neuropeptide Y, octreotide, gastric inhibitory polypeptide, neurokinin A, neurotensin, exendin-3, exendin-4, or substance P, said peptide comprising an amino acid sequence of at least 80%, 85%, 90%, 95%, 98%, or 99% identity to SEQ ID NO 1 , SEQ ID NO 2, SEQ ID NO 3, SEQ ID NO 4, SEQ ID NO 5, SEQ ID NO 6, SEQ ID NO 7, SEQ ID NO 8, SEQ ID NO 9, SEQ ID NO 10, SEQ ID NO 1 1 , SEQ ID NO 12, or SEQ ID NO 13, respectively.
Item 4: A complex comprising a ligand according to any one of the above items,
coordinatively bound to a metal atom, particularly a metal comprised in group 3, 4, 6, 7, 9, 10, 1 1 , 13, 15, the lanthanide group of elements, or the actinide group of elements of the periodic table.
Item 5: The complex according to item 4, wherein the metal is selected from Ga, Tc, In, Cu, Tb, Sc, Lu, Re, Bi, Eu, Gd, Zr, or Y.
Item 6: The complex according to any one of items 4 or 5, wherein the metal is one of 44 Sc, 6 4 Cu, 67 Ga, 68 Ga, 89 Zr, 90 Y, 99m Tc, 111 ln, nat Eu, nat Gd, 177 Lu, 161 Tb, 186 Re, 188 Re, or 213 Bi.
Item 7: The complex according to any one of items 4 to 6, wherein the metal
- has the oxidation number +1 , +2, +3, +4, +5, +6 or +7, and/or
- forms an 8-coordinate complex with the ligand.
Item 8: A complex according to any one of items 4 to 7 for use as a pharmaceutical, particularly for use in a method of treatment of neoplastic disease (cancer).
Item 9: A complex according to any one of items 4 to 7, for use in a method of medical diagnosis or radio-immunotherapy, particularly for use in positron emission tomography and/or single-photon emission computed tomography.
Item 10: A complex according to any one of item 4 to 7 for use in diagnosis of
neoplastic disease.
Item 1 1 : A solid support comprising a ligand covalently attached to said solid support, said ligand being characterized by a general formula I
R 1 - D - X - D - X - D- X - D - E - R 2 (I)
each X independently of any other X is a saturated or partially unsaturated, substituted or unsubstituted linker comprising 2, 3, 4, 5, 6, 7, 8, 9, 10 or 1 1 , in some embodiments particularly 9 atoms selected from any of N, C, O, in particular CH 2 , NH, CO, O, with R being H or C1-C4 alkyl, or each X independently of any other X is a saturated or unsaturated, substituted or unsubstituted heterocyclic moiety,
R 1 comprises a Ci-C 5 alkyl, a C 3 -C 6 cycloalkyl, an arene, and/or a heteroarene, and
E is a saturated or partially unsaturated, substituted or unsubstituted chain comprising 1 - 50 atoms and R 2 is the attachment site to said solid support.
Item 12: The solid support according to item 1 1 , wherein said solid support is a nanoparticle.
In certain embodiments, the complex is purified via liquid chromatography, high-performance liquid chromatography (HPLC), size exclusion chromatography (gel permeation
chromatography), affinity chromatography, or ion exchange chromatography.
According another aspect of the invention, the complex according to the invention is used as a diagnostic, particularly for cancer diagnostics.
In certain embodiments, the complex is used in radioimmunotherapy.
In certain embodiments, the complex comprising 44 Sc, 67 Ga, 68 Ga, 89 Zr nat Eu, and nat Gd, nat Fe is provided for use in diagnostic imaging, particularly for cancer diagnostics.
In certain embodiments, the complex is used in positron emission tomography or in single- photon emission computed tomography (SPECT or SPET).
In radioimmunotherapy, an antibody or an antibody fragment, which is labelled with a radionuclide, is used to deliver cytotoxic radiation to a target cell or to image a cell for targeting by an external radiation source. In its specific application to cancer therapy, an antibody, which is specific for a tumour-associated antigen, is used to deliver a lethal dose of radiation to the tumour cells or to specifically image radiation dosimetry at the tumour cell. Radioimmunotherapy requires a tumour cell to express an antigen that is unique to the neoplasm or that is not accessible in normal cells.
According another aspect of the invention, the complex according to the invention is used as a pharmaceutical.
In certain embodiments, the complex is used in cancer therapy. In certain embodiments, the complex is conjugated to receptor-specific molecules comprising an antibody, an oligopeptide, a polypeptide, or a small molecule compound for targeting cancer-type specific receptors and/or receptors overexpressed in certain cancer types.
Breast cancer-specific receptors comprise estrogen / progesterone receptor and human epidermal growth factor 2 receptor (HER2). In certain embodiments, the complex is conjugated to estrogen receptor agonists comprising "indene-based molecules". These molecules have a common "indene" building block as part of their chemical structure. In certain embodiments, the complex is conjugated to molecules selected from 17-beta- estradiol, estrone, raloxifene, estriol, genistein, the monoclonal antibody trastuzumab known as "Herceptin" (Roche), or selective estrogen receptor modulators (SERMs).
Pancreatic cancer and lung cancer are characterised by overexpression of various specific receptors and polypeptides. In certain embodiments, the complex is conjugated to an epidermal growth factor receptor (EGFR)-specific polypeptide or polypeptides comprising epidermal growth factor (EGF), transforming growth factor-alpha (TGF-alpha), the EGFR antagonist potato carboxypeptidase inhibitor (PCI), amphiregulin, insulin-like growth factor 1 (IGF1 ), or insulin-like growth factor 2 (IGF2). In certain embodiments, the complex is conjugated to compounds comprising gefitinib (CAS No. 184475-35-2), erlotinib (CAS No. 183321 -74-6), erlotinib-hydrochloride (CAS No. 183319-69-9), cetuximab (CAS No. 205923- 56-4), rituximab or compounds capable of specifically binding to insulin-like growth factor receptors (IGFRs).
Gastric cancer-specific receptors comprise HER2 and CXC chemokine receptors (CXCR1 to CXCR7). In certain embodiments, the complex is conjugated to HER2 -specific monoclonal antibodies comprising trastuzumab (CAS No. 180288-69-1 ) or pertuzumab (CAS No.
380610-27-5). In certain embodiments, the complex is conjugated to CXC chemokine receptor-specific agonists or antagonists.
Prostate cancer development and progression has been shown to correlate with
overexpression of androgen receptor (AR) and/or epidermal growth factor receptor (EGFR). In certain embodiments, the complex is conjugated to prostate-specific antigen (PSA) or to an antibody capable of specifically binding to extracellular signal-regulated protein kinases (ERKs). It has also been shown that some prostate cancer types develop and progress independently of androgen receptor signalling. In another embodiment, the complex is conjugated to an antibody capable of specifically binding to B-cell lymphoma 2 (BCL-2) (UniProt ID: P10415) for targeting androgen-independent prostate cancer cells in patients. In certain embodiments, the complex is conjugated to polypeptides or compounds capable of specifically binding to vitronectin receptors (Alpha-v beta-3) (UniProt ID: P04004), selected from angiogenesis inhibitors comprising vitaxin (CAS No. 892553-42-3), or bevacizumab (CAS No. 216974-75-3). In certain embodiments, the complex is conjugated to glycosylated RGD-containing peptides (RGD-peptides) (Haubner et al., J. Nucl. Med. 2001 , 42(2), 326- 336; Zhao et al., Plos ONE 8(4), 2013, e61043; Zhang et al., Cancer Res. 2007, 67(4), 1555- 1562).
Matrix metalloproteinases (MMPs) are zinc-dependent endopeptidases. These enzymes can break down connective tissue and overexpression of MMPs has been observed in pathological conditions comprising inflammation, cancer invasion, metastasis and
angiogenesis. In certain embodiments, the complex is conjugated to a matrix
metalloproteinase inhibiting compound, in particular an MMP inhibitor selected from the group comprising marimastat (CAS No. 154039-60-8), doxycycline (CAS No. 24390-14-5), or cipemastat (CAS No. 190648-49-8). In certain embodiments, the complex is conjugated to specific tissue inhibitors of metalloproteinases (TIMPs). TIMPs are polypeptides comprising TIMP1 , TIMP2, TIMP3, and TIMP4.
Positron emission tomography (PET) is a functional imaging technique applied in nuclear medicine, whereby a three-dimensional image (e.g. of functional processes) in the body is produced. The system detects pairs of gamma rays emitted indirectly by a positron-emitting radionuclide, which is introduced into the body in form of a pharmaceutical compound.
Similar to PET, single-photon emission computed tomography (SPECT) is also applied as a three-dimensional diagnostic imaging technique using gamma rays emitted by radioisotopes. In contrast with PET, the tracer used in SPECT emits gamma radiation that is measured directly, whereas a PET tracer emits positrons that annihilate with near-by electrons, which are a few milimeters away, causing two gamma photons to be emitted in opposite directions. Therefore, PET scanners detect emissions that occur coincidently in time, thereby providing more radiation event localisation information and thus resulting in higher resolution images compared to SPECT.
Similarly, a dosage form comprising a complex according to the present invention is provided. In certain embodiments, the dosage form is for intravenous administration or subcutaneous administration.
Wherever alternatives for single separable features such as, for example, a metal or radionuclide, ligand element or medical indication are laid out herein as "embodiments", it is to be understood that such alternatives may be combined freely to form discrete
embodiments of the invention disclosed herein. Thus, any of the alternative embodiments for a D or X may be combined with any of the alternative embodiments of metal or radionuclide, and these combinations may be combined with any instance of R 3 mentioned herein. The invention is further illustrated by the following examples and figures, from which further embodiments and advantages can be drawn. These examples are meant to illustrate the invention but not to limit its scope.
Short description of the figures
Fig. 1 shows a stability profile of the octa co-ordinated complex III (ligand-conjugated
complex; top two lines) in comparison to the hexadentate complex known in the art (DFO-conjugated complex; bottom two curves). The graph shows results of competition experiments using 300-fold excess of free DFO in a 24 hour time (Challenging against 0.1 mM DFO-mesylate in 0.5 M HEPES (pH 7.3)). X axis: time; Y axis: percentage of intact complex.
Fig. 2 shows the calculated structure of the complex formed by reaction of ligand I with zirconium chloride. The atoms are depicted in different colours comprising zirconium (center), oxygen (gray), nitrogen (white with bold line), and carbon (white).
Fig. 3 shows the synthesis of complex III
General Methods
Materials: All chemicals were of reagent grade quality or better, obtained from commercial suppliers and used without further purification. Solvents were used as received or dried over molecular sieves. All preparations were carried out using standard Schlenk techniques.
Instrumentation and methods: Instrumentation and Methods. 1 H and 13 C NMR spectra were recorded in deuterated solvents on 400 ( 1 H: 400 MHz, 13 C: 100.6 MHz) or 500 ( 1 H: 500 MHz, 13 C: 126 MHz) MHz spectrometers at room temperature. The chemical shifts, δ, are reported in ppm (parts per million). The residual solvent peaks have been used as an internal reference. The abbreviations for the peak multiplicities are as follows: s (singlet), d (doublet), dd (doublet of doublets), t (triplet), q (quartet), m (multiplet), and br (broad). The 1 H and 13 C signals were assigned with the help of 2D NMR techniques. Elemental microanalyses were performed on a LecoCHNS-932 elemental analyser. ESI-MS were performed using a Bruker Daltonics HCT 6000 mass spectrometer. LC-MS spectra were recorded on a HPLC apparatus (Acquity Ultra Performance LC, Waters) that was connected to a mass spectrometer (Bruker Esquire 6000) operated in ESI mode. A Nucleosil 100-5 C18 (250 χ 3 mm) reverse phase column was used with a flow rate of 0.5 ml. min "1 and UV-absorption was measured at 254 nm. The runs were performed with a linear gradient of A (acetonitrile (Sigma-Aldrich HPLC-grade) and B (distilled water containing 0.02% TFA and 0.05% HCOOH): t = 0-3 min, 5% A; t = 17 min, 100% A; t = 20 min, 100% A; t = 21 min, 5% A; t = 25 min, 5% A.
Synthesis of the peptide precursor compound characterising a modified amino acid sequence of bombesin (SEQ ID NO. 14) was performed on an Applied Biosystem automatic peptide synthesizer using Rink Amide resin and standard Fmoc-protocoll. Analysis of peptide precursor, ligand I and ligand II were performed on a HPLC system using a Phenomenex Jupiter column, 4μ Proteo 90A, 250 x 4.6 mm, with a flow rate of 2 ml. / min. Analysis of peptide precursor compound and ligand I were performed with a linear gradient of HPLC- grade solvent A (acetonitrile) from Sigma-Aldrich and B (distilled water containing 0.1 %
TFA). Peptide precursor: t = 0 min, 5% A; t = 12.5 min, 50% A; t = 13.5 min, 95% A; t = 14.5 min, 95% A; t = 15 min, 5% A; t = 17 min, 5% A. Ligand I: t = 0 min, 10% A; t = 12.5 min, 40% A; t = 13.5 min, 95% A; t = 14.5 min, 95% A; t = 15 min, 10% A; t = 17 min, 10% A. Ligand II: t = 0 min, 15% A; t = 12.5 min, 40% A; t = 13.5 min, 95% A; t = 14.5 min, 95% A; t = 15 min, 15% A; t = 17 min, 15% A. MS acquisitions were performed in the full scan mode in the mass range from m/z 100 to 2000 at 20Ό00 resolution and 1 scan per second. Masses were calibrated with a 2 mmol/l solution of sodium formate over m/z 158 to 1450 mass range with accuracy below 2 ppm.
Examples
a. Synthesis of compound a ( 4-[benzyloxy-[5-(benzyloxycarbonylamino)pentyl] amino]-
4-oxo-butanoic acid) was synthesised following the procedures described in Na. Chem. Biol., 2007, 3, 652-656, and Na. Chem. Biol., 2007, 3, 652-656.
t-butyl N-benzyloxy-N-[5-(benzyloxycarbonylamino)pentyl]carbamate
Compound a b. Synthesis of compound b [(benzyl N-[5-[[4-[5-[[4-[5-[[4-[5-
[acetyl(hydroxy)amino]pentylamino]-4-oxo-butanoyl]-hydrox y-amino]pentylamino]-4- oxo-butanoyl]-hydroxy-amino]pentylamino]-4-oxo-butanoyl]-ben zyloxy- amino]pentyl]carbamate)]:
To a stirred solution of carboxylic acid (1.13 g, 2.6 mmol), addition of HATU (1.46 g, 3.8 mmol) in DMF (10 mL), and DIPEA (0.66 g, 5.1 mmol) was carried out under N 2 atmosphere. After stirring the mixture for 40 min at room temperature, deferoxamine mesylate salt (1 .68 g, 2.6 mmol) followed by DIPEA (0.66 g, 5.1 mmol) and 4-methyl morpholine (2 mL) were added. The mixture was then stirred for 48 h at room temperature. The solvent was removed using a high vacuum pump. Addition of 50 mL ice cold acetone to the resulting paste resulted in a white solid, which was isolated by centrifugation, followed by decantation of the acetone. This procedure was repeated twice. Then a similar washing procedure was followed using double distilled water instead of acetone (3x30 mL). The wet white solid was lyophilized to give result to a white powder.
Data: 1 H NMR (400 MHz, DMSO-d6): δ (ppm) 1.16-1.27 (m, 8H), 1.32-1 .43 (m, 8H), 1 .41 - 1.56 (m, 8H), 1.97 (s, 3H), 2.24-2.33 (m, 6H), 2.54-2.65 (m, 6H), 2.94-3.03 (m, 8H), 3.43- 3.48 (m, 6H), 3.53-3.58 (m, 2H), 4.87 (s, 2H), 4.99 (s, 2H), 7.17-7.47 (m, 1 1 H), 7.76 (s, br, 3H), 9.56-9.67 (m, 3H). 13C{1 H} NMR (100 MHz, DMSO-d6): δ (ppm) 20.8, 23.8, 23.9, 26.5, 26.6, 27.7, 28.1 , 29.3, 29.4, 30.1 , 30.4, 38.9, 45.1 , 47.3, 47.6, 65.5, 75.9, 128.2, 128.7, 128.9, 129.1 , 129.7, 135.4, 137.8, 156.8, 170.6, 171 .4, 171.7, 172.4. ESI-MS (positive detection mode): m/z (%) 1007.3 (100) [M+Na]+. Anal. Calcd for C49H76N8O13: C 59.74, H 7.78, N 1 1.37. Found: C 59.99, H 7.67, N 1 1 .73.
Compound b
c. Synthesis of ligand I:
A mixture of compound b (125 mg, 0.13 mmol) and 100 ml. of MeOH was sonicated for 10 min in an ultrasonic bath. To the resulting suspension, 10% Pd/C (38 mg) was added and hydrogenation was carried out for 6 h under H 2 (1 bar) atmosphere. The reaction mixture was then filtered by cotton plug followed by a filter paper. The solution was evaporated to give a white solid that was washed with 10 mL of acetonitrile and 20 ml. of Et 2 0 and dried.
Data: 1 H NMR (500 MHz, DMSO-d6): δ (ppm) 1.19-1.28 (m, 8H), 1.33-1 .39 (m, 7H), 1 .46- 1.53 (m, 9H), 1.97 (s, 3H), 2.24-2.33 (m, 8H), 2.55-2.60 (m, 6H), 2.73-2,76 (m, 2H), 2.97- 3.03 (m, 6H), 3.41-3.49 (m, 8H), 7.77 (s, br, 4H), 9.60 (s, br, 3H). 13C{1 H} NMR (125 MHz, DMSO-d6): δ (ppm) 20.8, 23.3, 23.9, 26.2, 26.5, 27.1 , 27.9, 28.1 , 29.2, 30.2, 30.3, 38.9, 39.2, 47.2, 47.5, 170.6, 171 .7, 172.4, 172.5. ESI-MS (positive detection mode): m/z (%) 761.5 (100) [M+H]+. Anal. Calcd for C 3 4H 64 N 8 O 1 1 : C 53.67, H 8.48, N 14.73. Found: C 53.60, H 8.25, N 14.66.
H 2 (1 atm)
Ligand I
Synthesis of complex I
600 uL (0.0072 mM) of a solution of the ligand I in 0.1 M HCI was added to 200 uL of the solution of ZrCI 4 in 0.1 M HCI. The pH of the mixture was then slowly adjusted to ca. 8 by slow addition of 0.1 M K 2 CO 3 solution and stirred for addition 40 min. Then the mixture was lyophilized to give white solid. Formation of the desired product was confirmed by the single peak observed in the LC-MS analysis that has the expected mass.
For scaling up, to a suspension of the ligand (21 .8 mg) in 667 uL of 0.1 mM HCI, a solution (667 uL, 10 mg/mL) of ZrCI 4 in 0.1 M HCI was added and stirred for 10 min. The suspension slowly disappears during this time. The pH of the mixture was then slowly adjusted to ca. 8 by slow addition of 0.1 M K 2 C0 3 solution, stirred for additional 1 .5 h and then lyophilized to give a white solid powder.
Data: t R (LC-MS) 9.3 min. Mass 847.3 [M+H]+.
Complex I e. Synthesis of ligand II To a stirred mixture of ligand I (20 mg, 0.03 mmol) and succinic anhydride (3.9 mg, 0.04 mmol) in 2 ml. DMF, NEt 3 (7.6 mg, 0.07 mmol) was added under N 2 atmosphere. After 48 h, DMF was removed in vacuum and the white solid obtained was washed with small portions acetone and Et 2 0.
Data: 1 H NMR (500 MHz, DMSO-d6): δ (ppm) 1.18-1.26 (m, 8H), 1.34-1 .42 (m, 8H), 1 .46- 1.54 (m, 8H), 1.97 (s, 3H), 2.24-2.33 (m, 8H), 2.39-2.43 (m, 2H), 2.56-2.61 (m, 6H), 2.97- 3.03 (m, 8H), 3.41-3.49 (m, 8H), 7.77 (s, br, 4H), 9.64 (s, br, 3H), 12.04 (s, br, 1 H). 13C{1 H} NMR (125 MHz, DMSO-d6): δ (ppm) 20.8, 23.9, 26.4, 28.1 , 29.2, 29.6, 30.3, 30.4, 38.9, 47.2, 47.4, 170.6, 171 .2, 171 .7, 172.4, 174.3. ESI-MS (positive detection mode): m/z (%) 883.4 (100) [M+Na]+. Anal. Calcd for C 38 HesNsOu: C 53.01 , H 7.96, N 13.01 . Found: C 52.89, H 7.73, N 12.88.
1 H NMR (500 MHz, DMSO-d6)
N Et3, DMF
Ligand II f. Synthesis of complex II
Ligand II is not soluble either in 0.1 M HCI or in H 2 O. The complexation was carried out in MeOH using zirconium (IV) acetylacetonate [Zr(acac) 4 ]. A mixture of ligand II (50 mg, 0.058 mmol) and Zr(acac) 4 (28.3 mg, 0.058 mmol) in 15 mL MeOH was heated at reflux for 15 h with continuous stirring under N 2 atmosphere. The solvent was then removed and the residue was then washed with Et 2 O (20 mL) and acetone (10 mL). The compound was obtained as off white solid (48 mg, 87 %). The compound is it not soluble in common organic solvents including DMSO. When trying to dissolve in 0.5 % NaOD in D 2 O, decomposition of the complex was observed. Therefore due to the limited solubility NMR spectra of the compound could not be obtained. However, the formation of the complex can be confirmed using LC- MS. Elemental analysis calculated for C 44.19, H 7.42, N 10.06. Found C 44.1 1 , H 7.04, N 10.16.
Data: t R (LC-MS) 8.7 and 8.8 min. Mass 947.3 [M+H]+
Complex II
g. Synthesis of a modified amino acid sequence of bombesin BBN A go(beta-Ala) 3 ,
identical to SEQ ID NO 14: (B-Ala) 3 -Gln-Trp-Ala--Val-Gly-Hi-Leu-14Nle-CONH 2
Synthesis was performed on a solid phase synthesis using an Applied Biosystem automatic peptide synthesizer with low-loaded Rink Amid resin (on a Phenomenex
Jupiter 250 x 4.6 mm column) and standard Fmoc-protocoll, followed by HPLC analysis to test for chemical purity. Molecular Weight: 1 135.32 g/mol; Chemical Formula:
h. Synthesis of ligand III
Coupling of ligand II to BBN A go(beta-Ala) 3 was done by manual synthesis. 50-60 mg (9-12 pmol) of peptide resin was Fmoc-deprotected with 20% Piperidine/DMF (5x 2 mL, 3-5 min each). MP-Zr-19 (2 eq.) was dissolved in 1 mL DMF (peptide grade) and shortly warmed up in a heating block at 60-70 °C, then vortexed and sonicated. The solution was transfered to an eppendorff tube containing HATU (2 eq), and DIPEA (4 eq.) was added. The mixture was transfered to a syringe reactor containing the swollen peptide resin. After 3 h the reaction was stopped and the coupling procedure repeated over night. The peptide conjugate was cleaved from the resin with ~ 0.6 mL TFA/phenol/TIS/water (87.5/5/2.5/5) for 3 h and afterwards precipitated in ice cold Et 2 0. The pellet was broken and washed three times with Et 2 0. The remaining pellet was purified by preparative HPLC. Combined HPLC fractions were concentrated and lyophilized. ESI-MS spectra were recorded at positive electrospray ionization mode on a Bruker Esquire 3000 plus (Bruker Daltonics GmbH, Bremen, Germany) at the University of Basel. MALDI-MS analysis was performed on an Applied Biosystem 4800 TOF-TOF.
Characterization HPLC: t R = 9.6 min (85_60, analyt.); t R = 8.9 min (75_68, analyt.), t R = 14.8 min (75_65, prep.)
Characterization ESI-MS: m/z= 990.1 [M+2H] 2+ , 1979.8 [M+H]+
Characterization MALDI-MS: m/z= 1978.1 [M+H] + , additional signals due to degradation of chelator during measurement (e.g. 1333.7, 1533.8 break of Hydroxamate-bonds).
Molecular Weight: 1978.29 g/mol; Chemical Formula: CCH H
Formula of ligand III and reaction: see Fig. 3
Radiolabelling and Quality Control of 89 Zr-ABP-27 and 89 Zr-ABP-28
i) Synthesis of complex III
Zr-89 was obtained in 1 M oxalic acid from Perkin Elmer. ABP-27 (M w = 1978,29 g/mol) was prepared in lyophilized aliquots of 50 pg/50 pL and dissolved with deionized water upon starting the labeling. 10-30 pL (1 1 .2-28.1 MBq) was taken from the Zr-89 stock solution and filled up to 200 pL with 1 .0 M oxalic acid. 90 pL of 2.0 M Na 2 C0 3 was added and incubated for 3 min at RT. 300 pL 0.5 M HEPES (pH 7.3), 710 pL of peptide solution (10 pg/10 pL (5 nmol) + 700 pL H 2 0) and 300 pL 0.5 M HEPES (pH 7.3) were added. The pH was checked with pH-strips and ranged from pH 7.0-7.3. The reaction solution was incubated for 240 min at ambient temperature. Quality control of radiolabelling reactions were performed by means of HPLC and ITLC. Reversed phase HPLC was done on a Bischof system equipped with HPLC pumps 2250, a λ-1010 UV-detector, a Berthold LB509 radioflow detector and a Jupiter, 4p Proteo 90A, 250 x 4.6 mm column from Phenomenex. The column was eluted with mixtures of acetonitrile (solvent A) and water with 0.1 % trifluoroacetic acid (TFA) (solvent B) at a flow rate of 2 mL/min and a linear gradient: 0 min 80% B, 12.5 min 60% B, 13.5 min 5% B, 14.5 min 5% B, 15 min 80% B, 17 min 80% B. 20 pL of labeling solution were diluted in 50 pL 0.1 mM Desferrioxamine in 0.5 M HEPES solution (pH 7.3) and 10 pL were injected into HPLC. Radiochemical purity was determined by manual integration and determined to be between 94-97 %. ITLC was done using Biodex green ITLC-Strips. 2 pL of labelling solution were spotted directly on the strip and developed with citric acid solution (20 mM, pH 4.8) as eluent. The strip was read out with a Cyclone Plus Phosphorimager and a MultiSensitive storage phosphor screen from Perkin Elmer. Radiochemical yield was determined by manual integration and determined to be >95 %
j) Synthesis and Characterisation of DFO*-NCS:
Method:
DFO* (50 mg, 0.066 mmol) was dissolved in a mixture isopropanol/water (4:1 , 8 ml.) by means of sonication and heating. The solution was then added at room temperature drop wise to a solution of phenylenediisothiocyanate (126 mg, 0.66 mmol) in chloroform (8 ml.) containing triethylamine (0.079 mmol, 0.01 1 ml_). The reaction was stirred at room temperature. After 24h UPLC-MS indicated complete conversion of DFO*. The solvents were concentrated under reduced pressure and the resulting white solid was washed with diethylether (4 x 10 ml_). The product was further purified by preparative HPLC (Nucleodur Preparative column (ISIS-C18 16 x 250 mm 5 μm )) at a flow rate of 8 ml. min -1 with a linear gradient of A (acetonitrile (Sigma-Aldrich HPLC-grade) and B (distilled water containing 0.1 % TFA): t=0 min A 36% B 64%, t=15 min A 44% B 56%, t=17 min A 36% B 64%. After lyophilisation, the product was obtained as a white powder (6 mg, 10 %).
1 H NMR (600 MHz, DMSO-d 6 ): 5(ppm) 9.57-9.71 (m, br, 5H), 7.90 (s, br, 1 H), 7.77 (s, br, 3H), 7.52-7.56 (d, 2H), 7.34-7.38 (d, 2H), 3.41-3.49 (m, 10H), 2.97-3.03 (m, 6H), 2.55-2.60 (m, 6H), 2.23-2.3 (m, 6H), 1 .97 (s, 3H), 1 .48-1.51 (m, 10H), 1 .36-1.39 (m, 6H), 1.19-1.21 (m, 8H). 13 C{ 1 H} NMR (125 MHz, DMSO-d6): 5(ppm) 180.1 , 172.0, 171.3, 170.2, 139.3, 132.6, 126.2, 124.6, 123.1 , 47.1 , 46.8, 43.7, 38.4, 29.9, 28.8, 28.0, 27.6, 27.1 , 26.0, 23.6, 23.5,
20.4. Some carbon signals were not observed due to overlapping signals. HR-ESI-MS: calcd for C 42 H 68 N 10 O 11 S 2 /z [M+H + ] + 953.45887, found 953.45832, calcd for C42H68N10O1 1 NaS2/z [M+Na + ] + 975.44027, found 975.44027.
1 H and 13 C NMR measurements were carried out on Bruker AV-600 (CP-TCI (CryoPorbe)) spectrometer and referenced to residual solvent peaks. High resolution ESI-MS spectra were recorded using a Bruker ESQUIRE-LC quadrupole ion trap instrument.
k) Synthesis of PEG complex:
R1 = Methyl
D= Hydroxymate
X= [CH 2 ] 5 -N-[C=0]-[CH 2 ]2