Related Art Streptococci are a large and varied set of gram-positive bacteria which have been ordered into several groups based on the antigenicity and structure of their cell wall polysaccharide (Lancefield, R. C., J Exp. Med 57 : 571-595 (1933); Lancefield, R. C., Proc. Soc. Exp. Biol. and Med 38 : 473-478 (1938)). Two of these groups have been associated with serious human infections. Those that have been classified into Group A streptococci are the bacteria that people are most familiar and are the organisms which cause"strep throat."Organisms of Group A streptococci also are associated with the more serious infections of rheumatic fever, streptococcal impetigo, and sepsis.

Group B streptococci were not known as a human pathogen in standard medical textbooks until the early 1970's. Since that time, studies have shown that Group B streptococci are an important perinatal pathogen in both the United States as well as the developing countries (Smith, A. L. and J. Haas, Infections of the Central Nervous System, Raven Press, Ltd., New York. (1991) p. 313-333).

Systemic Group B streptococcal infections during the first two months of life affect approximately three out of every 1000 births (Dillon, H. C., Jr., et al., J.

Pediat. 110 : 31-36 (1987)), resulting in 11,000 cases annually in the United States. These infections cause symptoms of congenital pneumonia, sepsis, and

meningitis. A substantial number of these infants die or have permanent neurological sequelae. Furthermore, these Group B streptococcal infections may be implicated in the high pregnancy-related morbidity which occurs in nearly 50,000 women annually. Others who are at risk from Group B streptococcal infections include those who either congenitally, chemotherapeutically, or by other means, have an altered immune response.

Group B streptococci can be further classified into several different types based on the bacteria's capsular polysaccharide. The most pathogenically important of these different types are streptococci having types Ia, Ib, II, or III capsular polysaccharides. Group B streptococci of these four types represent over 90% of all reported cases. The structure of each of these various polysaccharide types has been elucidated and characterized (Jennings, H. J., et al., Biochemistry 22: 1258-1263 (1983); Jennings, H. J., et al., Can. J Biochem. 58 : 112-120 (1980); Jennings, H. J., etal., Proc. Nat. Acad. Sci USA. 77: 2931-2935 (1980); Jennings, H. J., etal., J. Biol. Chem. 258 : 1793-1798 (1983); Wessels, M. R., et al., J. Biol.

Chem. 262 : 8262-8267 (1987)). As is found with many other human bacterial pathogens, it has been ascertained that the capsular polysaccharides of Group B streptococci, when used as vaccines, provide very effective, efficacious protection against infections with these bacteria. This was first noted by Lancefield (Lancefield, R. C., et al., J. Exp. Med. 142 : 165-179 (1975)) and more recently in the numerous studies of Kasper and coworkers (Baker, C. J., et al., N. Engl. J : Med. 319 : 1180-1185 (1988); Baltimore, R. S., et al., J. Infect. Dis. 140 : 81-86 (1979); Kasper, D. L., et al., J. Exp. Med. 149 : 327-339 (1979); Madoff, L. C., et al., J. Clin. Invest. 94 : 286-292 (1994); Marques, M. B., et al., Infect. Immun.

62 : 1593-1599 (1994); Wessels, M. R., et aL, J Clin. Invest. 86 : 1428-1433 (1990); Wessels, M. R., et al., Infect. Immun. 61 : 4760-4766 (1993); Wyle, S. A., et al., J.

Infect. Dis. 126 : 514-522 (1972)). However, much like many other capsular polysaccharide vaccines (Anderson, P., et al., J. Clin. Invest. 51 : 39-44 (1972); Gold, R., et al., J. Clin. Invest. 56 : 1536-1547 (1975); Gold, R., et al., J. Infect.

Dis. 136S : S31-S35 (1977); Gold, R. M., et al., J. Infect. Dis. 138 : 731-735 (1978);

Makela, P. R. H., et al., J. Infect. Dis. 136 : S43-50 (1977); Peltola, A., et al., Pediatrics 60 : 730-737 (1977); Peltola, H., et al. N. Engl. J. Med. 297 : 686-691 (1977)), vaccines formulated from pure type la, Ib, II, and III capsular carbohydrates are relatively poor immunogens and have very little efficacy in children under the age of 18 months (Baker, C. J. and D. L. Kasper. Rev. Inf. Dis.

7: 458-467 (1985); Baker, C. J., et aL, N. Engl. J Med. 319 : 1180-1185 (1988); Baker, C. J., et al., New Engl. J. Med. 322: 1857-1860 (1990)). These pure polysaccharides are classified as T cell independent antigens because they induce a similar immunological response in animals devoid of T lymphocytes (Howard, J. G., et al., Cell. Immunol. 2: 614-626 (1971)). It is thought that these polysaccharides do not evoke a secondary booster response because they do not interact with T cells, and therefore fail to provoke a subsequent"helper response" via the secretion of various cytokines. For this reason, each consecutive administration of the polysaccharide as a vaccine results in the release of a constant amount of antibodies, while a T cell dependent antigen would elicit an ever increasing concentration of antibodies each time it was administered.

Goebel and Avery found in 1931 that by covalently linking a pure polysaccharide to a protein that they could evoke an immune response to the polysaccharide which could not be accomplished using the polysaccharide alone (Avery, O. T. and W. F. Goebel, J. Exp. Med. 54 : 437-447 (1931) ; Goebel, W. F. and O. T. Avery, J Exp. Med. 54 : 431-436 (1931)). These observations initiated and formed the basis of the current conjugate vaccine technology. Numerous studies have followed and show that when polysaccharides are coupled to proteins prior to their administration as vaccines, the immune response to the polysaccharides changes from a T independent response to a T dependent response (see (Dick, W. E., Jr. and M. Beurret, Glycoconjugates of bacterial carbohydrate antigens In: Contributions to Microbiology and Immunology. Cruse et al., eds., (1989) p. 48-114; Jennings, H. J. and R. K. Sood, Neoglycoconjugates : Preparation and Applications. Y. C. Lee and R. T. Lee, eds., Academic Press, New York. (1994) p. 325-371 ; Robbins, J. B. and R. Schneerson, J. Infect. Dis.

161 : 821-832 (1990)) for reviews). Currently, most of these polysaccharide- protein conjugate vaccines are formulated with well known proteins such as tetanus toxoid and diphtheria toxoid or mutants thereof. These proteins were originally used because they were already licensed for human use and were well characterized. However, as more and more polysaccharides were coupled to these proteins and used as vaccines, interference between the various vaccines which used the same protein became apparent. For example, if several different polysaccharides were linked to tetanus toxoid and given sequentially, the immune response to the first administered polysaccharide conjugate would be much larger than the last. If, however, each of the polysaccharides were coupled to a different protein and administered sequentially, the immune response to each of the polysaccharides would be the same. Carrier suppression is the term used to describe this observed phenomenon. One approach to overcome this problem is to match the protein and polysaccharide so that they are derived from the same organism.

Among the various antigens used to classify and subgroup Group B streptococci, one was a protein known as the Ibc antigen. This protein antigen was first described by Wilkinson and Eagon in 1971 (Wilkinson, H. W. and R. G.

Eagon, Infect. Immun. 4 : 596-604 (1971)) and was known to be made up of two distinct proteins designated as alpha and beta. Later, the Ibc antigen was shown to be effective when used as a vaccine antigen in a mouse model of infection by Lancefield and co-workers (Lancefield, R. C., et al., J. Exp. Med. 142 : 165-179 (1975)). The isolation, purification and functional characterization of the beta antigen (Cp) protein of Group B streptococci was accomplished by Russell-Jones, et al. (Russell-Jones, G. J. and E. C. Gotschlich, J Exp. Med. 160 : 1476-1484 (1984); Russell-Jones, G. J., et al., J. Exp. Med. 160 : 1467-1475 (1984)) [see U. S.

Patent No. 4,757,134]. They could demonstrate that one of the properties of the Cp protein was to bind specifically to human IgA immunoglobulin. The binding site on the IgA molecule was localized to the Fc portion of the heavy chain of this immunoglobulin. They further showed that the Cp protein consisted of a single

polypeptide having an estimated molecular weight of 130,000 daltons. The gene responsible for the expression of the Cp protein was cloned (Cleat, P. H. and K. N.

Timmis, Infect. Immun. 55 : 1151-1155 (1987)) and sequenced (Jerlström, P. G., et al., Molec. Microbiol. 5 : 843-849 (1991)) by a group led by Timmis. His later study demonstrated that the IgA binding activity could be assigned to a 746 bp DNA fragment of the gene defined by a leading BgIII restriction endonuclease cleavage site and ending with a HpaI restriction endonuclease cleavage site.

As stated previously, the 1975 Lancefield study showed that the Ibc antigen was an effective vaccine antigen in a mouse model of Group B streptococcal infection (Lancefield, R. C., et al., J. Exp. Med. 142 : 165-179 (1975)). It was not clear at the time whether the alpha or beta protein component of the Ibc antigen was responsible for this protection. Madoff et al., began to shed light on this question and demonstrated that the purified Cp protein used as a vaccine could protect infant mice from experimental infection with Group B streptococci expressing this protein (Madoff, L. C., et al., Infect. Immun.

60 : 4989-4994 (1992)). Madoff et al., then went on to show that when they coupled a Type III streptococcal capsular polysaccharide to the Cp protein, producing a conjugate vaccine, this vaccine would protect infant mice against infection with either a Type III Group B streptococci (expressing no Cß) or a Type Ib Group B streptococci (expressing C (3 but lacking a Type III capsular polysaccharide) (Madoff, L. C., et al., J Clin. Invest. 94 : 286-292 (1994)). Thus, such a Cp protein conjugate vaccine served several functions : the polysaccharide elicited protective antibodies to the polysaccharide capsule and the Cß protein evoked protective antibodies to the protein as well as modified the immune response to the polysaccharide from a T independent response to a T dependent response.

This polysaccharide-Cp protein conjugate strategy works well in mice.

But clearly, the goal is to protect humans against Group B streptococcal infections. The only caveat with using the same strategy in humans is that the Cp protein binds human IgA immunoglobulins non-specifically (Cp does not bind

mouse IgA). This human IgA binding activity of Cß could diminish the efficacy of a polysaccharide-C (3 protein conjugate vaccine for humans, as antigens bound to IgA can be cleared from the system so rapidly that an antigen-specific antibody response is not produced. Furthermore, potentially protective epitopes on the Cß protein could be hidden when the human IgA binds to the Cp molecule. Thus, it would be advantageous to obtain a mutant C P protein which lacks the IgA binding capacity but retains as much of the native structure as possible.

With this goal in mind, several groups have attempted to determine the IgA binding region of the Cp protein. Jerlström et al. (Molec. Microbiol. 5 : 843-849 (1991)) used experiments wherein subfragments of the Cp protein were expressed as fusion proteins to identify two regions of the Cß protein capable of binding IgA.

These experiments localized the IgA binding domains to a 747 bp BglII-HpaI fragment and a 1461 bp HpaI-HindIII fragment of the Cp protein. Furthermore, International Patent Application No. PCT/US/06111 describes the isolation of a Cß protein bearing a deletion of a region that binds IgA.

Summary of the Invention The invention relates to a mutant Cp protein, wherein the IgA binding by the Cp protein is reduced or eliminated, while the antigenicity of the protein when administered either alone or as part of a polysaccharide-protein conjugate is substantially retained.

In particular, the invention relates to a mutant Cß protein comprising the amino acid sequence A-X, Xz X3 X4 XS X6 X X 8 X9 X, o X"X, 2-B, wherein A comprises amino acids 1-164 of the sequence shown in Figures 1 A-1 D (SEQ ID NO: 2), B represents a sequence starting from amino acid 177 and terminating at an amino acid between residue 1094 and 1127, inclusive, of the sequence shown in Figures 1A-1D (SEQ ID NO : 2), and X,-X, 2 are each selected independently from the group consisting of Ala, Val, Leu, Ile, Pro, Met, Phe, Trp, a bond, and the wild

type amino acid found at the corresponding position of the sequence shown in Figures IA-ID (SEQ ID NO: 2), wherein said amino acid positions are numbered from the first amino acid of the native amino acid sequence encoding said protein, with the proviso that at least one of X, through X, zu inclusive, is other than the wild type amino acid.

The invention also relates to a polynucleotide molecule encoding a mutant Cp protein, as well as vectors comprising such polynucleotide molecules, and host cells transformed therewith.

The invention also relates to a conjugate comprising the mutant Cp protein covalently conjugated to a capsular polysaccharide.

The invention also relates to a vaccine comprising the mutant Cß protein of the invention and a pharmaceutically acceptable carrier.

The invention also relates to a method of inducing an immune response in an animal, comprising administering the vaccine of the invention to an animal in an effective amount.

Brief Description of the Figures Figures 1 A-1 D show the DNA sequence and deduced amino acid sequence of wild type Cpl (Jerlström, P. G., et al., Molec. Microbiol. 5 : 843-849 (1991)).

The BgIII and PstI sites shown in Figures 2,3 and 4 are identified.

Figure 2 is a map of the region of the Cp gene which encodes the IgA binding site of the Cp protein; 2 amino acid substitutions are indicated, generating mutant dgb2 (see Table 1).

Figure 3 is a map of the region of the Cp gene which encodes the IgA binding site of the C (3 protein; 2 amino acid substitutions are indicated, generating mutant nv34qp (see Table 1).

Figure 4 is a map of the region of the Cp gene which encodes the IgA binding site of the Cp protein; 6 amino acids have been deleted from this region in the mutant protein, generating mutant dgbl (see Table 1).

Figure 5 is a graph showing the competitive inhibition of ELISA reactivity by Cp proteins.

Figures 6A-6G show the complete DNA sequence of the gene encoding Cß mutant dgb2 (see Table 1), as well as the deduced amino acid sequence of this mutant. The mutations are underlined.

Figures 7A-7F show the complete DNA sequence of the gene encoding Cß mutant nv34qp (see Table 1), as well as the deduced amino acid sequence of this mutant. The mutations are underlined.

Figures 8A-8G show the complete DNA sequence of the gene encoding Cß mutant dgbl (see Table 1), as well as the deduced amino acid sequence of this mutant.

Figures 9A-9G show the complete DNA sequence of the gene encoding Cp mutant pnv231 (see Table 1), as well as the deduced amino acid sequence of this mutant. The mutations are underlined.

Detailed Description of the Preferred Embodiments The invention relates to a mutant Cß protein of the group B streptococcal (GBS) beta antigen, wherein IgA binding by the Cp protein is reduced or eliminated and wherein at least a majority of the antigenicity of the protein is retained.

It has been discovered that mutation of a region of the C ? protein located between about amino acid residues 163 and 176 of the wildtype Cp sequence shown in Figures IA-LD (SEQ ID NO : 2) results in a Cß protein which has reduced or eliminated IgA binding properties, but which retains enough of its tertiary structure to maintain the majority of its antigenicity (see Examples 4 and 5).

As the region of the Cß polypeptide has been found which is responsible for IgA binding, and as it has been demonstrated in the Examples below that amino acid substitutions or deletions in this region reduce or eliminate IgA binding while maintaining antigenicity of the protein, those of ordinary skill in

the art will understand how to alter the amino acid sequence of the Cp polypeptide so as to achieve the objects of the invention. Appropriate amino acid substitutions which eliminate IgA binding will include replacement of one or more residues with an amino acid having different properties. For example, a strongly hydrophilic amino acid can be replaced with a strongly hydrophobic amino acid. Amino acids which can be grouped together include the aliphatic amino acids Ala, Val, Leu and Ile ; the hydroxyl residues Ser and Thr, the acidic residues Asp and Glu, the amide residues Asn and Gln, the basic residues Lys and Arg and the aromatic residues Phe and Tyr. Thus, those of ordinary skill in the art will understand how to determine suitable amino acid substitutions or deletions in the region between about residues 163 and 176 in the Cp protein in order to reduce or eliminate IgA binding.

Further guidance concerning which amino acid changes are likely to have a significant deleterious effect on a function can be found in Bowie, J. U., et al., "Deciphering the Message in Protein Sequences: Tolerance to Amino Acid Substitutions,"Science 247 : 1306-1310 (1990).

Thus, in particular, the invention relates to a mutant group B streptococcal (GBS) beta antigen, Cp, comprising the amino acid sequence A-X, X2 X3 X4 X5 X6 X7X8 X9 Xlo Xtl X12-B, wherein A comprises amino acids 1-164 of the sequence shown in Figures lA-1D (SEQ ID NO: 2), B represents a sequence starting from amino acid 177 and terminating at an amino acid between residue 1094 and 1127, inclusive, of the sequence shown in Figures I A-I D (SEQ ID NO: 2), and X,-X, 2 are each selected independently from the group consisting of Ala, Arg, Asp, Val, Leu, Ile, Pro, Met, Phe, Trp, a bond, and the wild type amino acid found at the corresponding position of the sequence shown in Figures lA-1D (SEQ ID NO: 2), wherein said amino acid positions are numbered from the first amino acid of the native amino acid sequence encoding said protein, with the proviso that at least one of X, through X, 2, inclusive, is other than the wild type amino acid. In a particularly preferred mutant Cp protein, amino acids X7 and X, 2 are Ala (SEQ ID NO: 3). In another preferred mutant, amino acids X4 and X"are Pro (SEQ ID NO: 4).

In another preferred mutant, amino acid X is Thr and amino acid X, 2 is Leu (SEQ ID NO: 5). In a more preferred mutant, amino acids XsS X7, Xg, XIOx X"and Xl2 are each replaced with a bond (SEQ ID NO: 6).

As the Cp protein is, in its wild type state, membrane bound, it is possible to improve purification of the above-mentioned Cß mutants by eliminating the hydrophobic residues of the transmembrane domain of the Cß protein (the transmembrane domain corresponds to residues 1095-1127 of the sequence shown in Figures lA-1D (SEQ ID NO: 2)). This can be accomplished by substitution of non-hydrophobic residues for the hydrophobic residues (residues 1108-1116 of the sequence shown in Figures lA-1D (SEQ ID NO: 2)) or by deletion of the hydrophobic residues. While purification of membrane- bound Cp requires the use of detergent, a mutant Cß which lacks the hydrophobic membrane spanning region can be purified without using detergent. Thus, the invention also relates to a mutant Cp wherein the nine hydrophobic residues making up the transmembrane domain are deleted or replaced by non-hydrophobic amino acids.

It has been discovered that the IgA-binding ability of Cß may require dimerization of Cp. Thus, even where the IgA-binding region of Cß is not mutated as described above, mutation of the region of Cß which is believed to be required for dimerization can result in a form of Cß that cannot bind IgA.

Deletion of a portion of Cß from residue 729 to the C-terminus of the sequence shown in Figures lA-1D (SEQ ID NO: 2) eliminates dimerization of Cß. The results of experiments supporting this finding may be found in Table 1. Several fragments of Cp were inserted into each of two different vectors. Where sequences shown in the table are preceded or followed by an outward facing bracket, this indicates that the Cp sequence does not extend further on that end of the fragment., i. e. that the nucleotide sequence inserted into the vector encodes only those amino acids shown, and no more of the Cp sequence. Where sequences shown in the table are preceded or followed by ellipses, this indicates that the remainder of the Cp sequence at that end of the fragment is also included in the vector. Nucleotide sequences encoding the peptides shown in the upper part of the table were

inserted into either the vector pTOPE or the vector pET17b. Both of these vectors allow expression of inserted fragments from the T7 promoter, and both produce fusion proteins containing a fragment of the ¢10 capsid protein N terminal to the amino acid sequence encoded by the insert. However, while pET17b encodes only 8 amino acids of the 4) 10 protein, pTOPE encodes a 288 amino acid fragment of the (t) 10 protein.

As shown in Table 1, certain fragments of Cß produced from pET17b exhibit reduced IgA-binding, while the same fragment produced by pTOPE is capable of binding IgA. The fragments tested lack the region of Cp predicted to be involved in dimerization, but do not contain any mutations in the putative IgA binding domain (note that the Cp fragments inserted into vector pET24b, shown at the bottom of Table 1, contain the putative dimerization region but nonetheless exhibit reduced IgA binding due to mutations in the IgA binding domain, as described above). It is postulated that these Cp fragments bind DNA when produced from pTOPE because the 288 amino acid fragment of the 10 protein allows dimerization of the Cp fragment. This may be due to the fact that the ¢10 capsid protein normally forms oligomers; the region responsible for oligomerization may thus allow dimerization of the inserted Cß fragments, and thus IgA-binding. Thus, the invention also relates to a mutant Cp protein having a mutation in the dimerization domain of Cp, wherein the mutant Cp protein is incapable of binding IgA. Of course, in the interest of producing a non-IgA binding Cp protein retaining as much of the antigenicity of the wild type Cp protein as possible, dimerization of Cß should not be interrupted.

It has also been discovered that production of Cß protein from E. coli can be problematic because the protein is cleaved at a specific region, presumably by an E. coli signal peptidase. This cleavage results in a truncated protein, which obviously is not ideal for a vaccine, as it lacks many antigenic epitopes of the wildtype Cp protein. The cleavage site has been predicted by sequence analysis and by matrix assisted laser desorption initiated time of flight (MALDI-TOF) mass spectrometry (von Heijne, Nucleic Acids Res. 14 : 4683-4690 (1986)). The

cleavage site is between amino acid residues 538 and 539 (after alanine and before glutamine) ofthe amino acid sequence shown in Figures 1A-1D (SEQ ID NO : 2). The signal peptidase recognition site is located within a 20 amino acid stretch located between residues 521 and 541 of the amino acid sequence shown in Figures IA-LD (SEQ ID NO : 2). Therefore, by deleting this region, the C (3 protein or a non-IgA binding mutant thereof can successfully be produced in E. coli. Furthermore, as signal peptidases have very strict sequence specificity, alteration of the signal peptidase recognition sequence, including even a single, conservative amino acid substitution in this region, may eliminate cleavage of Cp by E. coli. The recognition sequence required for cleavage by this signal peptidase is believed to be GluLeuIleLysSerAlaGInGlnGlu (SEQ ID NO : 11), corresponding to amino acid residues 533-541 of the sequence shown in Figures lA-lD (SEQ ID NO : 2). Alteration of either the serine or the alanine residue of this sequence by either deletion or non-conservative substitution is expected to eliminate cleavage by the signal peptidase. Of course, ideally, the mutagenesis of Cp will be kept to a minimum so as to retain the tertiary structure of the wildtype antigen for the purposes of eliciting an immunogenic response.

Thus, the invention also relates to a mutant Cp protein of the group B streptococcal (GBS) beta antigen, wherein IgA binding by the Cß protein is reduced or eliminated by any of the mutations described above, and wherein at least one of amino acid residues 521-541 of the amino acid sequence shown in Figures IA-LD (SEQ ID NO : 2) is either (a) deleted or (b) altered, so that the protein is not cleaved in this region when Cp is produced in E. coli. In a preferred embodiment, at least one of amino acid residues 533-541 of the sequence shown in Figures 1 A-1 D (SEQ ID NO : 2) is either (a) deleted or (b) altered. In a more preferred embodiment, at least one of amino acid residues 537 and 538 is either (a) deleted or (b) altered. Of course, one of ordinary skill will be able to determine other suitable amino acid substitutions by routine experimentation, and by reference to the article by von Heijne (Nucleic Acids Res.

14 : 4683-4690 (1986)).

The invention also relates to polynucleotide molecules encoding the mutant proteins of the invention, vectors comprising those polynucleotide molecules, and host cells transformed therewith.

The invention also relates to the expression of novel mutant Cp polypeptides, wherein IgA binding by the Cp protein is reduced or eliminated, in a cellular host.

Prokaryotic hosts that may be used for cloning and expressing the polypeptides of the invention are well known in the art. Vectors which replicate in such host cells are also well known.

Preferred prokaryotic hosts include, but are not limited to, bacteria of the genus Escherichia, Bacillus, Streptomyces, Pseudomonas, Salmonella, Serratia, Xanthomonas, etc. Two such prokaryotic hosts are E. coli DH1OB and DH5aF'IQ (available from LTI, Gaithersburg, MD). The most preferred host for cloning and expressing the polypeptides of the invention is E. coli BL21 (Novagen, WI), which is lysogenic for DE3 phage.

The present invention also relates to vectors which include the isolated DNA molecules of the present invention, host cells which are genetically engineered with the recombinant vectors, and the production of the polypeptides of the invention by recombinant techniques.

Host cells can be genetically engineered to incorporate nucleic acid molecules and express polypeptides of the present invention. For instance, recombinant constructs may be introduced into host cells using well known techniques of infection, transduction, transfection, and transformation. The polynucleotides may be introduced alone or with other polynucleotides. Such other polynucleotides may be introduced independently, co-introduced or introduced joined to the polynucleotides of the invention.

Thus, for instance, the polynucleotides may be joined to a vector containing a selectable marker for propagation in a host. The vector construct may be introduced into host cells by the aforementioned techniques. Generally, a plasmid vector is introduced as DNA in a precipitate, such as a calcium

phosphate precipitate, or in a complex with a charged lipid. Electroporation also may be used to introduce polynucleotides into a host. If the vector is a virus, it may be packaged in vitro or introduced into a packaging cell and the packaged virus may be transduced into cells. A wide variety of techniques suitable for making polynucleotides and for introducing polynucleotides into cells in accordance with this aspect of the invention are well known and routine to those of skill in the art. Such techniques are reviewed at length in Sambrook et al. cited above, which is illustrative of the many laboratory manuals that detail these techniques.

In accordance with this aspect of the invention the vector may be, for example, a plasmid vector, a single or double-stranded phage vector, a single or double-stranded RNA or DNA viral vector. Such vectors may be introduced into cells as polynucleotides, preferably DNA, by well known techniques for introducing DNA and RNA into cells. The vectors, in the case of phage and viral vectors also may be and preferably are introduced into cells as packaged or encapsulated virus by well known techniques for infection and transduction.

Viral vectors may be replication competent or replication defective. In the latter case viral propagation generally will occur only in complementing host cells.

Preferred among vectors, in certain respects, are those for expression of polynucleotides and polypeptides of the present invention. Generally, such vectors comprise cis-acting control regions effective for expression in a host operatively linked to the polynucleotide to be expressed. Appropriate trans- acting factors either are supplied by the host, supplied by a complementing vector or supplied by the vector itself upon introduction into the host.

In certain preferred embodiments in this regard, the vectors provide for specific expression. Such specific expression may be inducible expression or expression only in certain types of cells or both inducible and cell-specific.

Particularly preferred among inducible vectors are vectors that can be induced for expression by environmental factors that are easy to manipulate, such as temperature and nutrient additives. A variety of vectors suitable to this aspect of

the invention, including constitutive and inducible expression vectors for use in prokaryotic and eukaryotic hosts, are well known and employed routinely by those of skill in the art (see U. S. Patent No. 5,464,758).

The engineered host cells can be cultured in conventional nutrient media, which may be modified as appropriate for, inter alia, activating promoters, selecting transformants or amplifying genes. Culture conditions, such as temperature, pH and the like, previously used with the host cell selected for expression generally will be suitable for expression of polypeptides of the present invention as will be apparent to those of skill in the art.

A great variety of expression vectors can be used to express a polypeptide of the invention. Such vectors include chromosomal, episomal and virus-derived vectors e. g., vectors derived from bacterial plasmids, from bacteriophage, from yeast episomes, from yeast chromosomal elements, from viruses such as baculoviruses, papova viruses, such as SV40, vaccinia viruses, adenoviruses, fowl pox viruses, pseudorabies viruses and retroviruses, and vectors derived from combinations thereof, such as those derived from plasmid and bacteriophage genetic elements, such as cosmids and phagemids, all may be used for expression in accordance with this aspect of the present invention. Generally, any vector suitable to maintain or propagate, polynucleotides, or to express a polypeptide, in a host may be used for expression in this regard.

The appropriate DNA molecule may be inserted into the vector by any of a variety of well-known and routine techniques. In general, a DNA molecule for expression is joined to an expression vector by cleaving the DNA sequence and the expression vector with one or more restriction endonucleases and then joining the restriction fragments together using T4 DNA ligase. Procedures for restriction and ligation that can be used to this end are well known and routine to those of skill in the art. Suitable procedures in this regard, and for constructing expression vectors using alternative techniques, which also are well known and routine to those skill, are set forth in great detail in Sambrook et al. cited above.

The DNA molecule inserted in the expression vector is operatively linked to appropriate expression control sequence (s), including, for instance, a promoter to direct mRNA transcription. Representatives of such promoters include the phage lambda PL promoter, the E. coli lac, trp and tac promoters, the SV40 early and late promoters and promoters of retroviral LTRs, to name just a few of the well-known promoters. It will be understood that numerous promoters not mentioned are suitable for use in this aspect of the invention are well known and readily may be employed by those of skill in the art in the manner illustrated by the discussion and the examples herein.

In general, expression constructs will contain sites for transcription initiation and termination, and, in the transcribed region, a ribosome binding site for translation. The coding portion of the mature transcripts expressed by the constructs will include a translation initiating AUG at the beginning and a termination codon appropriately positioned at the end of the polypeptide to be translated.

In addition, the constructs may contain control regions that regulate as well as engender expression. Generally, in accordance with many commonly practiced procedures, such regions will operate by controlling transcription, such as repressor binding sites and enhancers, among others.

Vectors for propagation and expression generally will include selectable markers. Such markers also may be suitable for amplification or the vectors may contain additional markers for this purpose. In this regard, the expression vectors preferably contain one or more selectable marker genes to provide a phenotypic trait for selection of transformed host cells. Preferred markers include dihydrofolate reductase or neomycin resistance for eukaryotic cell culture, and tetracycline or ampicillin resistance genes for culturing E. coli and other bacteria.

The vector containing the appropriate DNA sequence as described elsewhere herein, as well as an appropriate promoter, and other appropriate control sequences, may be introduced into an appropriate host using a variety of well known techniques suitable to expression therein of a desired polypeptide.

Representative examples of appropriate hosts include bacterial cells, such as E. coli, Streptomyces and Salmonella typhimurium cells. Hosts for of a great variety of expression constructs are well known, and those of skill will be enabled by the present disclosure readily to select a host for expressing a polypeptides in accordance with this aspect of the present invention.

More particularly, the present invention also includes recombinant constructs, such as expression constructs, comprising one or more of the sequences described above. The constructs comprise a vector, such as a plasmid or viral vector, into which such a sequence of the invention has been inserted.

The sequence may be inserted in a forward or reverse orientation. In certain preferred embodiments in this regard, the construct further comprises regulatory sequences, including, for example, a promoter, operably linked to the sequence.

Large numbers of suitable vectors and promoters are known to those of skill in the art, and there are many commercially available vectors suitable for use in the present invention.

As the invention concerns the construction of a protein having a reduced or eliminated ability to bind human IgA, the invention thus relates to using in vitro mutagenesis methods to generate the mutant Cp proteins of the invention.

A number of in vitro mutagenesis methods are well known to those of skill in the art; several are provided here as examples.

One such method introduces deletions or insertions into a polynucleotide molecule inserted into a plasmid by either partially or completely digesting the plasmid with an appropriate restriction enzyme, and then ligating the ends to again generate a plasmid. Very short deletions can be made by first cutting a plasmid at a restriction site, and then subjecting the linear DNA to controlled nuclease digestion to remove small groups of bases at each end. Precise insertions may also be made by ligating double stranded oligonucleotide linkers to a plasmid cut at a single restriction site.

Chemical methods can also be used to introduce mutations to a single stranded polynucleotide molecule. For example, single base pair changes at

cytosine residues can be created using chemicals such as bisulfite, which deaminates cytosine to uracil, thus converting GC base pairs to AT base pairs.

Preferably, oligonucleotide directed mutagenesis will be used so that all possible classes of base pair changes at any determined site along a DNA molecule can be made. In general, this technique involves annealing a oligonucleotide complementary (except for one or more mismatches) to a single stranded nucleotide sequence of interest. The mismatched oligonucleotide is then extended by DNA polymerase, generating a double stranded DNA molecule which contains the desired change in sequence on one strand. The changes in sequence can of course result in the deletion, substitution, or insertion of an amino acid if the change is made in the coding region of a gene. The double stranded polynucleotide can then be inserted into an appropriate expression vector, and a mutant polypeptide can thus be produced. The above-described oligonucleotide directed mutagenesis can of course be carried out via PCR. An example of such a system is the Ex-Site PCR site-directed mutagenesis technique (Stratagene, CA) used in Example 4.

Using the Ex-Site"'PCR site-directed mutagenesis technique, several different oligonucleotides were made to induce different changes in the DNA sequence in the region of interest. In one particular example, overlapping primers were obtained, wherein both primers contained the sequence required to change lysine to alanine at amino acids 170 and 175 in the sequence shown in Figures lA-lD (SEQ ID NO: 2) (see Fig. 2 and Table 1). The forward primer, designated Cp 613, had the sequence (SEQ ID NO: 6) 5'-GTT GAA GCA ATG GCA GAG CAA GCG GGA ATC ACA AAT GAA G-3'and the reverse primer, designated Cp 642R had the sequence (SEQ ID NO: 7) 5'-GAT TCC CGC TTG CTC TGC CAT TGC TTC AAC TTG ACT TTT TTG-3' (the substitutions are noted in BOLD). These oligonucleotides were combined with pNV222 template, which consists of the Cp gene inserted into the pSP76 vector. PCR was performed, and the products were ligated and introduced into E. coli strain DH5a, thus generating clones containing the mutant Cp gene.

The following vectors, which are commercially available, may be used in the practice of the invention. Among vectors preferred for use in bacteria are pQE70, pQE60 and pQE-9, available from Qiagen; pBS vectors, Phagescript vectors, Bluescriptvectors, pNH8A, pNH16a, pNH18A, pNH46A, available from Stratagene ; ptrc99a, pKK223-3, pKK233-3, pDR540, pRIT5 available from Pharmacia ; pUC18, pUC19 and pPROEX-1, available from LTI, and pTOPE, pET17b, and pET24a (Novagen, Madison, WI). These vectors are listed solely by way of illustration of the many commercially available and well known vectors that are available to those of skill in the art for use in accordance with this aspect of the present invention. It will be appreciated that any other plasmid or vector suitable for, for example, introduction, maintenance, propagation or expression of a polynucleotide or polypeptide of the invention in a host may be used in this aspect of the invention.

Promoter regions can be selected from any desired gene using vectors that contain a reporter transcription unit lacking a promoter region, such as a chloramphenicol acetyl transferase ("CAT") transcription unit, downstream of restriction site or sites for introducing a candidate promoter fragment ; i. e., a fragment that may contain a promoter. As is well known, introduction into the vector of a promoter-containing fragment at the restriction site upstream of the CAT gene engenders production of CAT activity, which can be detected by standard CAT assays. Vectors suitable to this end are well known and readily available. Two such vectors are pKK232-8 and pCM7. Thus, promoters for expression of polynucleotides of the present invention include not only well known and readily available promoters, but also promoters that readily may be obtained by the foregoing technique, using a reporter gene.

Among known bacterial promoters suitable for expression of polynucleotides and polypeptides in accordance with the present invention are the E. coli lad and lacZ and promoters, the T3 and T7 promoters, the gpt promoter, the lambda PR, PL promoters and the trp promoter.

Selection of appropriate vectors and promoters for expression in a host cell is a well known procedure and the requisite techniques for expression vector construction, introduction of the vector into the host and expression in the host are routine skills in the art.

The present invention also relates to host cells containing the constructs discussed above. The host cell can be a prokaryotic cell, such as a bacterial cell.

Constructs in host cells can be used in a conventional manner to produce the gene product encoded by the recombinant sequence. Alternatively, the polypeptides of the invention can be synthetically produced by conventional peptide synthesizers.

Following transformation of a suitable host strain and growth of the host strain to an appropriate cell density, where the selected promoter is inducible, it is induced by appropriate means (e. g., temperature shift or exposure to chemical inducer) and cells are cultured for an additional period.

Cells typically are then harvested by centrifugation, disrupted by physical or chemical means, and the resulting crude extract retained for further purification.

Microbial cells employed in expression of proteins can be disrupted by any convenient method, including freeze-thaw cycling, sonication, mechanical disruption, or use of cell lysing agents; such methods are well know to those skilled in the art.

The invention also relates to a vaccine comprising a mutant Cp protein, wherein IgA binding by the Cp protein is reduced or eliminated as described herein, together with a pharmaceutically acceptable carrier. In a preferred embodiment, the protein is conjugated to a polysaccharide.

The conjugates of the invention may be formed by reacting the reducing end groups of the polysaccharide to primary amino groups (that is, lysine residues) of the Cp protein by reductive amination. The polysaccharide may be conjugated to any or all of the primary amino groups of the protein. The reducing groups may be formed by selective hydrolysis or specific oxidative cleavage, or

a combination of both. Preferably, the Cp protein is conjugated to the polysaccharide by the method of Jennings et al., U. S. Patent No. 4,356,170, which involves controlled oxidation of the polysaccharide with periodate followed by reductive animation with the Cp protein of the invention.

In a preferred embodiment, the polysaccharide is one of the Group B streptococcal capsular polysaccharides selected from types la, II, III and V. See Baker, C. J. and D. L. Kasper. Rev. Inf Dis. 7: 458-467 (1985); Baker, C. J., et al., N. Engl. J. Med. 319 : 1180-1185 (1988); Baker, C. J., etal., NewEngl. J. Med.

322 : 1857-1860 (1990). The vaccine may also be a combination vaccine comprising one or more of the Cp protein-polysaccharide conjugates selected from the group consisting of Cp conjugated to Group B capsular polysaccharide type la (Cp-Ia) ; Cp conjugated to Group B capsular polysaccharide type II (Cp- II) ; Cp conjugated to Group B capsular polysaccharide type III (Cß-III) ; and Cp conjugated to Group B capsular polysaccharide type V (Cß-V). Most preferably, the vaccine is a combination vaccine comprising Cp-Ia, Cl-11, C (3-III and Cß-V.

Such a combination vaccine will elicit antibodies to Group B streptoccoci of Types la, II, III, V, and Ib (as Type Ib Group B streptococci also express Cp).

Furthermore, the immune response to the polysaccharides of the combination vaccine will be a T dependent response.

The vaccine of the present invention comprises one or more of the Cp protein vaccines or conjugate vaccines in amounts effective depending on the route of administration. Although subcutaneous or intramuscular routes of administration are preferred, the vaccine of the present invention can also be administered by an intraperitoneal or intravenous route. One skilled in the art will appreciate that the amounts to be administered for any particular treatment protocol can be readily determined without undue experimentation. With respect to each conjugate, suitable amounts are expected to fall within the range of 2 micrograms of the protein per kg body weight to 100 micrograms per kg body weight. In a preferred embodiment, the vaccine comprises about 2 pg of the Cp protein or an equivalent amount of the protein-polysaccharide conjugate. In

another preferred embodiment, the vaccine comprises about 5 llg of the Cp protein or an equivalent amount of the protein-polysaccharide conjugate.

The vaccine of the present invention may be employed in such forms as capsules, liquid solutions, suspensions or elixirs for oral administration, or sterile liquid forms such as solutions or suspensions. Any inert carrier is preferably used, such as saline, phosphate-buffered saline, or any such carrier in which the non-IgA Fc binding group B streptococcal Cp protein or conjugate vaccine have suitable solubility properties. The vaccines may be in the form of single dose preparations or in multi-dose flasks which can be used for mass vaccination programs. Reference is made to Remington's Pharmaceutical Sciences, Mack Publishing Co., Easton, PA, Osol (ed.) (1980); and New Trends and Developments in Vaccines, Voller et al. (eds.), University Park Press, Baltimore, MD (1978), for methods of preparing and using vaccines.

The vaccines of the present invention may further comprise adjuvants which enhance production of C (3-specific antibodies. Such adjuvants include, but are not limited to, various oil formulations such as Freund's complete adjuvant (CFA), stearyl tyrosine (ST, see U. S. Patent No. 4,258,029), the dipeptide known as MDP, saponin (see U. S. Patent No. 5,057,540), aluminum hydroxide, and lymphatic cytokine.

Freund's adjuvant is an emulsion of mineral oil and water which is mixed with the immunogenic substance. Although Freund's adjuvant is powerful, it is usually not administered to humans. Instead, the adjuvant alum (aluminum hydroxide) or ST may be used for administration to a human. The Cp protein vaccine or a conjugate vaccine thereof may be absorbed onto the aluminum hydroxide from which it is slowly released after injection. The vaccine may also be encapsulated within liposomes according to Fullerton, U. S. Patent No.

4,235,877.

In another preferred embodiment, the present invention relates to a method of inducing an immune response in an animal comprising administering

to the animal the vaccine of the invention, produced according to methods described, in an amount effective to induce an immune response.

Having now generally described the invention, the same will be more readily understood through reference to the following Examples which are provided by way of illustration, and are not intended to be limiting of the present invention, unless specified.

Examples Example 1 Cloning and expression of the gene encoding C/3 To locate the IgA binding site on the Cp protein, two oligonucleotides were synthesized. The first oligonucleotide, oligo 1, corresponds to the 5'end of the mature protein, and has the sequence (SEQ ID NO: 8) 5'- AAGGATCCAAGTGAGCTTGTAAAGGACGAT-3', which includes a BamHI site. The second oligonucleotide falls just short of the 3'end of the gene, and has the sequence (SEQ ID NO: 9) 5'-AAAACTCGAGTTTCTTTTCCGTTGTTG- ATGTA-3', and includes a XhoI site. The oligonucleotide for the 3'end of the gene was chosen to eliminate the LPXTG motif found in most gram positive cell wall proteins. This sequence motif has been shown to be involved in the processing of these cell wall proteins and is the part of these proteins which eventually becomes covalently bound to peptidoglycan (Navarre, W. W. and O.

Schneewind, Molec. Microbiol. 14 : 115-121 (1994); Schneewind, O., et al., Science 268 : 103-106 (1995)). Using chromosomal DNA from Strain A909 Group B streptococci containing the gene for the Cp protein as a template, and standard PCR procedures, a product of approximately 3.2 kb was produced as observed when electrophoresed on a 1% agarose gel. The PCR product containing the Cp protein gene was cleaved with the endonuclease restriction enzymes BamHI and XhoI. This BamHI-XhoI DNA fragment contained the

sequence for the entire Cp protein except for the last 33 amino acids at the carboxyl terminus, including the putative IgA binding site. The DNA fragment was then ligated into the appropriately restricted T7 expression plasmid pET17b (Novagen Inc., Madison WI) using a standard T4 ligase procedure. The plasmid was then transformed into the E. coli strain BL21 (DE3) using the manufacturer's suggested protocols (Novagen Inc.). E. coli cells containing the plasmid were selected on LB plates containing 50, ug/ml carbenicillin. These plates were incubated overnight at 37°C. The transformant colonies were carefully lifted onto nitrocellulose filters saturated with IPTG. After 30 min, the bacteria were lysed by placing the filters into a chloroform vapor chamber for 15 min at room temperature.

After the filters were removed from the chamber, they were placed, colony-side up, onto a Whatman 3MM filter which had been previously saturated with 20 mM Tris-HCl, pH 7.9,6 M urea, and 0.5 M NaCl. After 15 min, the filters were washed three times in PBS and incubated for 1 hr with purified human IgA in PBS-Tween. The filters were then rewashed in the PBS-Tween and developed by standard procedures (Blake, M. S., et al., Analyt. Biochem.

136 : 175-17 (1984)) using a goat antihuman IgA-alkaline phosphatase conjugate (Cappel Research Products, West Chester, PA). Several colonies demonstrating high IgA binding activity were selected and grown overnight in 1 ml LB broth containing carbenicillin at 30°C. These cultures were then diluted 1 to 100 with fresh LB-carbenicillin broth and incubated at 30°C for an addition 6 hr.

Expression was then induced by the addition of IPTG and the culture continued for an addition 2 hr at 30°C. The cells were collected by centrifugation, resuspended in water and subjected to several freeze-thaw cycles. The cells were once again collected by centrifugation and the supernatants saved for examination of their IgA binding activity.

Example 2 Identification of the IgA binding domain of C, 3 Once certain a stable plasmid producing a recombinant Cß protein had been achieved and that the expressed protein bound human IgA, a strategy similar to that of the Novatope System (Novagen, Inc.) was utilized to locate the IgA binding region of Cp. This procedure was performed according to the manufacturer's instructions. Briefly, the purified plasmid containing the Cp gene was randomly digested with DNase I and electrophoresed in a 2% low melting point agarose gel. Fragments of the DNA corresponding to sizes between 100 to 300 base pairs were excised from the gel, purified, and resuspended in TE buffer. A single dA was added to the fragments using the recommended reaction mixture and the fragments ligated into the pETOPET vector which contained single dT ends. After the standard ligation procedure, the plasmids were transformed into competent NovaBlue (DE3) cells (Novagen, Inc.) and plated on LB plates containing 50, ug/ml carbenicillin. These plates were incubated overnight at 37°C. The transformant colonies were tested for IgA binding activity as described in Example 1. Several clones were selected on the bases of their binding to the IgA. The bacteria from each of these clones were inoculated separately onto fresh LB plates and retested for their IgA binding ability as before. Plasmid preparations were made from each by standard means and sequenced.

The nucleotide sequences of the cloned Cp protein gene fragments were determined by the dideoxy method using denatured double stranded plasmid DNA template as described (Current Protocols in Molecular Biology, John Wiley & Sons, New York, N. Y. (1993)). Sequenase II kits (United States Biochemical Corp., Cleveland, OH) were used in accordance with the manufacturer's instructions. The smallest fragment of DNA obtained that included part of the Cp gene is shown in Figures 1A-1D. The translation of this sequence corresponds to amino acid 101 to 230 of the mature Cp protein shown in Figures IA-LD (SEQ ID NO: 2).

Attempts to further shorten this DNA fragment failed to give any IgA binding activity.

Example 3 ELISA inhibition assays : peptide binding studies Several synthetic peptides were made corresponding to the amino acid sequence contained within this region of the Cp protein. Peptides were synthesized using NMP t-butoxycarbonyl chemistry on an ABI 430A peptide synthesizer (Applied Biosystems, Foster City, CA) and were deprotected.

Peptides from a sample of the resin were removed from the resin by treatment with HF in the presence of anisole (0°C/lh). Preparative purification of these peptides were performed using a C18 column (2.14 ID x 30 cm) (Dynamax- Rainin, Woburn, Ma). The peptides were quantitated by PTC amino acid analysis using Waters Picotag system (Waters, Milord, MA). The synthesized peptides eluted from the C18 column as a major peak consisting of usually 75-85% of the total elution profile. The amino acid composition of the purified peptides were in good agreement with the sequence which was used to synthesize the peptides. These peptides were used in ELISA inhibition assays to block the binding of human IgA to the purified Cß protein as follows. Microtiter plates (Nunc- Immuno Plate IIF, Vangard International, Neptune, N. J.) were sensitized by adding 0.1 ml per well of purified Cß at a concentration of 2.0 pg/ml in 0.1 M Carbonate buffer, pH 9.6 with 0.02% azide. The plates were incubated overnight at room temperature. The plates were washed five times with 0.9% NaCl, 0.05% Brij 35, 10 mM sodium acetate pH 7.0,0.02% azide. A purified human IgA myeloma protein was purchased from Cappel Laboratories, was diluted in PBS with 0.5% Brij 35 and added to the plate and incubated for 1 hr at room temperature. The plates were again washed as before and the secondary antibody, alkaline phosphatase conjugated goat anti-human IgA (Tago Inc., Burlingame, CA), was diluted in PBS-Brij, added to the plates and incubated for 1 h at room

temperature. The plates were washed as before and p-nitrophenyl phosphate (Sigma phosphatase substrate 104) (1 mg/ml) in 0.1 M diethanolamine, 1 mM MgCl2, 0. 1 mM ZnCl2, 0. 02% azide, pH 9.8 added. The plates were incubated at 37°C for 1 h and the absorbance at 405 nm determined using an Elida-5 microtiter plate reader (Physica, New York, NY). Control wells lacked either the primary and/or secondary antibody. This was done to obtain a titer of the human IgA myeloma protein which would give a half-maximal reading in the ELISA assay. This titer would be used in the inhibition ELISA. The microtiter plate were sensitized and washed as before. Purified synthetic peptides were added and diluted in PBS-Brig. The dilution of the human IgA myeloma protein which gave the half maximal reading was then added. The mixture was then incubated for 1 hr at room temperature. The plates were rewashed and the conjugated second antibody added as stated. The plates were then processed and read as described.

The percentage of inhibition would be calculated as follows: 1- (ELISA value with the peptide added)/ (ELISA value without the peptide added).

The peptide which inhibited in this ELISA assay contained the sequence Asn- His-Gln-Lys-Ser-Gln-Val-Glu-Lys-Met-Ala-Glu-Gln-Lys-Gly (SEQ ID NO : 10).

This suggested that at least part of the IgA binding domain of the Cp was comprised within the region of the protein containing this sequence.

Example 4 Oligonucleotide directed mutagenesis of the gene encoding C, 6 In order to confirm the importance of this region in the C) protein for IgA binding activity and to begin to generate the mutant proteins that in the end would be used in the vaccine formulation, a modification of the Ex-Site PCR site- directed mutagenesis protocol was employed as developed by Stratagene (Stratagene, CA). The template used was a plasmid called pNV222 which consisted of the Cß gene inserted into the pSP76 vector (Promega, Madison, WI).

DNA oligonucleotides were synthesized on an Applied Biosystems model 292 DNA Synthesizer (Foster City, CA). The oligonucleotides were manually cleaved from the column by treatment with 1.5 ml of ammonium hydroxide for 2 hours with gentle mixing every 15 minutes. They were deprotected at 55°C for 16-18 hours. After deprotection they were dried down and used directly or purified using oligonucleotide purification columns (Applied Biosystems, Foster City CA). Several different oligonucleotides were made to induce different changes in the DNA sequence in the region of interest. An example of which is the following. The primers, in this particular example, were overlapping primers, both containing the sequence required to change lysine to alanine at amino acids 170 and 175 in the sequence shown in Figures 1A-1D (SEQ ID NO: 2). The forward primer, designated Cp 613, had the sequence (SEQ ID NO: 6) 5'-GTT GAA GCA ATG GCA GAG CAA GCG GGA ATC ACA AAT GAA G-3'and the reverse primer, designated Cp 642R had the sequence (SEQ ID NO: 7) 5'- GAT TCC CGC TTG CTC TGC CAT TGC TTC AAC TTG ACT TTT TTG-3' (the substitutions are noted in BOLD). The reaction conditions were as follows: 10 ng pNV222 template, 15 pmol. of each primer, 1 mM of each dNTP, 1X VENT Polymerase Buffer (20 mM Tris-HCl, pH 7.5; 10 mM KCI ; 10 mM (NH4) 2 S04 ; 2 mM MgS04 0. 1% (v/v) Triton X-100 ; 0.1 mg/ml bovine serum albumin (BSA)), 10 units of Vent Polymerase, and H20 to 100 ul. The reactions were prepared with PCR Gem 10 wax beads as per the Hot Start Protocol (Perkin Elmer, Foster City, CA). The reactions were run in a Perkin Elmer Thermocycler (Perkin Elmer, Foster City, CA) under the following conditions: 1 cycle of 94°C for 5 minutes; 10 cycles of 94°C for 30 seconds, 37°C for 2 minutes, 72°C for 10 minutes; 30 cycles of 94'C for 30 seconds, 55°C for 2 minutes, 72°C for 10 minutes; and 1 cycle of 72°C for 12 minutes. The reaction was treated with 10 units of DpnI at 37°C for 30 minutes to destroy the template DNA, followed by a 60 minute treatment at 72°C with PfuI polymerase to fill in any remaining overhangs. The reaction was diluted 1 : 4.6 in 1 X Vent Buffer plus 0.38 mM dATP. The diluted reaction was ligated for 24 hours at 25°C and transformed

into competent DH5a cells (Gibco/BRL, Gaithersburg, MD). Selected colonies were grown in 3 ml of LB plus kanamycin (50 mg/ml) at 37 °C for 16-18 hours.

DNA was prepared using QIAspin columns (Qiagen, Chatsworth, CA). The clones were analyzed for insert size on 0.8 % agarose gels and then sequenced.

Selected clones were then grown in 100 ml LB plus kanamycin (50 mg/ml) at 37 °C for 16-18 hours. DNA was prepared using the Qiagen-tip 100 (Qiagen, Chatsworth, CA). They were then digested with MM and PstI and run on 0.8% agarose gels to separate the mutated region. The 2300 bp fragment was isolated and purified from the gel using the Gene-Clean Spin Kit (Bio 101, Vista, CA).

A clone named pNV34 which consisted of the expression vector pET 24a (Novagen) and the native Cp gene, was also digested with NdeI and PstI and run on a 0.8% agarose gel. The large band (6300 bp) containing the pET vector and the remainder of the Cß gene was isolated and purified from the gel using the Gene-Clean Spin Kit (Bio 101). These two fragments were ligated at 4°C for 24 hours and transformed into competant BL21 (DE3) cells. Selected colonies were grown in 3 ml of LB plus kanamycin (50 mg/ml) at 37°C for 16-18 hours.

DNA was prepared using QIAspin columns (Qiagen) and the clones were analyzed for insert size on 0.8% agarose gels.

Also constructed were clones encoding mutant Cß proteins wherein two glutaminyl residues are replaced by prolinyl residues (Fig. 3), and wherein a deletion in the Cß gene had occurred resulting in a 6 amino acid deletion in the region of interest (Fig. 4).

Clones expressing a Cp protein which lacked or had reduced IgA binding activity but still reacted with the anti-pag antiserum were selected (see Example 5) and grown in 100 ml LB plus kanamycin (50 mg/ml) at 37°C for 16-18 hours.

Plasmid DNA from these clones was prepared using Qiagen tip 100 (Qiagen) and the mutated Cß gene entirely sequenced.

Example 5 Western blot and ELISA analysis of IgA bindng by C, 13 mutants The proteins encoded by the mutated genes were expressed and subjected to SDS-PAGE and western blot analysis in order to determine if mutations in the gene encoding the Cp protein reduced or eliminated IgA binding, while retaining Cp antigenicity. Two western blots were made for each sample and reacted with either the purified human IgA myeloma protein or hyperimmune rabbit anti-pag protein antiserum. The clone expressing a Cp protein wherein lysine is changed to alanine at amino acids 170 and 175 in the sequence shown in Figures 1A-1D (SEQ ID NO: 2) demonstrated almost no IgA binding activity, but the ability of the protein to react with anti-Cp antiserum remained high. IgA binding activity was also substantially eliminated in the clone expressing a C (3 protein wherein two glutaminyl residues are replaced by prolinyl residues (Fig 3) and in the clone encoding a Cß protein having a six amino acid deletion (Fig. 4), while reactivity with the anti-Cp antiserum was maintained for both. The data for the clone having a six amino acid deletion suggested that the residues responsible for the IgA binding activity of the Cp protein were located within this region of the protein, and that other possible mutations within this area would effect the IgA binding activity.

A competitive inhibition ELISA was used to more precisely determine the amount of antigenic and/or structure change the sequence modifications had on the Cp protein. Microtiter plates (Nunc-Immuno Plate IIF, Vangard International, Neptune, N. J.) were sensitized by adding 0.1 ml per well of purified Cß at a concentration of 2.0 llg/ml in 0.1 M carbonate buffer, pH 9.6 with 0.02% azide.

The plates were incubated overnight at room temperature. The plates were washed five times with 0.9% NaCl, 0.05% Brij 35,10 mM sodium acetate pH 7.0,0.02% azide. Hyperimmune rabbit antiserum to the Cp protein was diluted in PBS with 0.5% Brij 35 and added to the plate and incubated for 1 hr at room temperature. The plates were again washed as before and the secondary antibody,

alkaline phosphatase conjugated goat anti-rabbit IgG (Tago Inc., Burlingame, CA), was diluted in PBS-Brij, added to the plates and incubated for 1 h at room temperature. The plates were washed as before and p-nitrophenyl phosphate (Sigma Phosphatase Substrate 104) (1 mg/ml) in 0.1 M diethanolamine, 1 mM MgCl2, 0. 1 mM ZnCl2, 0.02% azide, pH 9.8, was added. The plates were incubated at 37°C for 1 h and the absorbance at 405 nm determined using an Elida-5 microtiter plate reader (Physica, New York, NY). Control wells lacked either the primary and/or secondary antibody. This was done to obtain a titer of the rabbit anti-Cp protein which would give a half-maximal reading in the ELISA assay. This titer would be used in the inhibition ELISA. The microtiter plate were sensitized and washed as before. Purified Cß protein or mutations of the Cß protein were added and diluted in PBS-Brig. The dilution of the rabbit anti-Cp protein which gave the half maximal reading was then added. The mixture was then incubated for 1 hr at room temperature. The plates were rewashed and the conjugated second antibody added as stated. The plates were then processed and read as described. The percentage of inhibition would be calculated as follows: 1- (ELISA value with the protein added)/ (ELISA value without the proteins added).

Figure 4 shows the results of one of these inhibition ELISA assays. In this assay the inhibition of the wildtype Cß protein from streptococci is compared with the recombinant Cß protein and the glutaminyl to prolinyl mutants, both expressed in E. coli. As can be seen from the figure, this assay is sensitive enough to detect the absence of the membrane spanning region in the recombinants of the Cß proteins. However, when the recombinant Cß protein containing the wildtype sequence is compared to the substitution mutant lacking IgA binding activity, the antigenic differences are minimal. This would suggest that such substitution mutants maintain most of the antigenic character of the Cp protein but lack the unwanted the IgA binding activity.

Although the foregoing refers to particular preferred embodiments, it will be understood that the present invention is not so limited. It will occur to those of ordinary skill in the art that various modifications may be made to the disclosed embodiments and that such modifications are intended to be within the scope of the present invention, which is defined by the following Claims. All patents and publications cited herein are incorporated by reference herein in their entirety. % wild- Name Sequence Vector type lgAbs+ ]LLHIKQHEEVEKDKKAKQQKTLKQSDTKVDLSNIDKELNHQKSQVEKMAEQKITNEDKD SMLKKIEDIRKQAQQADKKEDAEVKVREELGKLFSSTKAGLDQEIQ[ pTOPE 100 dgb5 ]DSDALLELENQFNETNRLLHIKQHEEVEKDKKAKQQKTLKQSDTKVDLSNIDKELNHQK SQVEKMAEQKGITNEDKDSMLKKIEDIRKQAQQADKKEDAEVKVREELGKLFSSTKAGLD QEIQEHVKKETSSEENTQKVDEHYANSL[ 17b 20 dgb6p ]DSDALLELENQFNETNRLLHIKQHEEVEKDKKAKQQKTLKQSDTKVDLSNIDKELNHQK SQVEKMAEQKGITNEDKDSMLKKIEDIRKQAQQADKKEDAEVKVREELGKLFSSTKAGLD QEIQEHVKKETSSEENTQKVDEHYANSL[ pTOPE 100 dgb7 ]VDLSNIDKELNHQKSQVEKMAEQKGITNEDKDSMLKKIEDIRKQAQQADKKEDAEVKVR EELGKLFSSTKAGLDQEIQEHVKKETSSEENTQKVDEHYANSLQNLAQKSLE[ 17b 0 dgb7p ]VDLSNIDKELNHQKSQVEKMAEQKGITNEDKDSMLKKIEDIRKQAQQADKKEDAEVKVR EELGKLFSSTKAGLDQEIQEHVKKETSSEENTQKVDEHYANSLQNLAQKSLE[ pTOPE 100 dgb8 ]VDLSNIDKELNHQKSQVEKMAEQKGITNEDKDSMLKKIEDIRKQAQQADKKEDAEVKVR EELGKLFSSTKAGLDQEIQEHVKKETSSEENTQKVDEHYANSLQNLAQKSLEELDKATTN E[ 17b 0 dgb8p ]VDLSNIDKELNHQKSQVEKMAEQKGITNEDKDSMLKKIEDIRKQAQQADKKEDAEVKVR EELGKLFSSTKAGLDQEIQEHVKKETTSSEENTQKVDEHYANSLQNLAQKSLEELDKATT NE[ pTOPE 100 dgb10 ]VDLSNIDKELNHQSKQVEKMAEQKGITNEDKDSMLKKIEDIRKQAQQADKKEDAEVKV[ 17b 10 dgb12 ....VDLSNIDKELNHQKSQVEKMAEQKGITNEDKDSMLKKIEDIRKQAQQADKKEDAEV KV[ 17b 20 dgb11 .....VDLSNIDKELNHQKSQVEKMAEQKGITNEDKDSMLKKIEDIRKQAQQADKKEDAE VKVREELGKLFSSTKAGLDQEIQEHVKKETSSEENTQKVDEHYANSL[ 17b 20 nv34qp ....VDLSNIDKELNHQKSPVEKMAEPKGITNEDKDSMLKKIEDIRKQAQQADKKEDAEV KVREELGKLFSSTKAGLDQEIQ.... 24a 10 dgb2 ....VDLSNIDKELNHQKSQVEAMAEQAGITNEDKDSMLKKIEDIRKQAQQADKKEDAEV KVREELGKLFSSTKAGLDQEIQ.... 24a 60 dgb1 ....VDLSNIDKELNHQKSQE(-#-)#GITNEDKDSMLKKIEDIRKQAQQADKKEDAEVK VREELGKLFSSTKAGLDQEIQ.... 24a 0 prrv231 ....VDLSNIDKELNHQKSQVEIMAEQLGITNEDKDSMLKKIEDIRKQAQQADKKEDAEV KVREELGKLFSSTKAGLDQEIQ... 24a 60 SEQUENCE LISTING (1) GENERAL INFORMATION: APPLICANT : North American Vaccine, Inc.

12103 Indian Creek Court Beltsville, MD 20705 United States of America INVENTORS: Tai, Joseph Y.

Blake, Milan S.

(ii) TITLE OF INVENTION: Non-IgA Fc Binding Forms of the Group B Streptococcal Beta Antigens (iii) NUMBER OF SEQUENCES: 30 (iv) CORRESPONDENCE ADDRESS: (A) ADDRESSEE: Sterne, Kessler, Goldstein & Fox P. L. L. C.

(B) STREET: 1100 New York Avenue, N. W., Suite 600 (C) CITY: Washington (D) STATE: D. C.

(E) COUNTRY: USA (F) ZIP: 20005 (v) COMPUTER READABLE FORM: (A) MEDIUM TYPE: Floppy disk (B) COMPUTER: IBM PC compatible (C) OPERATING SYSTEM: PC-DOS/MS-DOS (D) SOFTWARE: PatentIn Release #1. 0, Version #1. 30 (vi) CURRENT APPLICATION DATA: (A) APPLICATION NUMBER: PCT/US97/15319 (B) FILING DATE: 05-SEP-1997 (C) CLASSIFICATION: (vii) PRIOR APPLICATION DATA: (A) APPLICATION NUMBER: US 60/024,707 (B) FILING DATE: 06-SEP-1996 (viii) ATTORNEY/AGENT INFORMATION: (A) NAME: Esmond, Robert W.

(B) REGISTRATION NUMBER: 32,893 (C) REFERENCE/DOCKET NUMBER : 1438.014PC00 (ix) TELECOMMUNICATION INFORMATION: (A) TELEPHONE: (202) 371-2600 (B) TELEFAX: (202) 371-2540 (2) INFORMATION FOR SEQ ID NO : 1 : (i) SEQUENCE CHARACTERISTICS : (A) LENGTH: 4200 base pairs (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE-TYPE: cDNA (ix) FEATURE: (A) NAME/KEY: CDS (B) LOCATION: 320.. 3811 (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 1 : AAGCTTATGC TTGTCAATAA TCACAAATTT GTAGATCACT TCCTTTTTAG GACTGTAAAG 60 CATCCTAATT ACTTTTTAAA TATATTACCA GAACTAGTTG GTTTGGCCCT GGTGAGTCAT 120 GCTTATGTGA CATTCATCTT TATTTTTCCT GTCTATGCGG TTATTCTTTA TCAAAGAATA 180 GCAGAGGAAG AAAAATTATT GCAGGAAGTT ATTATTCCGA ATGGAAGAAT GAAAGGTTAA 240 AAATAATATA CCCAATTTAA TATGCAGTTC ATATTGGAAG GGTATACTGT AGATAAATAA 300 AATATTGGAG GATATCGAT ATG TTT AAA TCT AAT TAT GAA AGA AAA ATG CGT 352 Met Phe Lys Ser Asn Tyr Glu Arg Lys Met Arg 1 5 10 TAT TCC ATT CGT AAA TTT AGT GTA GGA GTA GCT AGT GTA GCG GTA GCT 400 Tyr Ser Ile Arg Lys Phe Ser Val Gly Val Ala Ser Val Ala Val Ala 15 20 25 AGT TTG TTC ATG GGA AGC GTT GCT CAT GCA AGT GAG CTT GTA AAG GAC 448 Ser Leu Phe Met Gly Ser Val Ala His Ala Ser Glu Leu Val Lys Asp 30 35 40 GAT AGT GTG AAG ACT ACC GAG GTT GCA GCT AAG CCC TAT CCA AGT ATG 496 Asp Ser Val Lys Thr Thr Glu Val Ala Ala Lys Pro Tyr Pro Ser Met 45 50 55 GCT CAA ACA GAT CAA GGA AAT AAT TCA TCA TCC TCG GAA CTT GAG ACA 544 Ala Gln Thr Asp Gln Gly Asn Asn Ser Ser Ser Ser Glu Leu Glu Thr 60 65 70 75 ACA AAG ATG GAA ATT CCT ACA ACA GAC ATA AAA AAA GCT GTT GAA CCG 592 Thr Lys Met Glu Ile Pro Thr Thr Asp Ile Lys Lys Ala Val Glu Pro 80 85 90 GTC GAG AAA ACA GCT GGG GAA ACA TCT GCC ACT GAT ACT GGA AAA CGA 640 Val Glu Lys Thr Ala Gly Glu Thr Ser Ala Thr Asp Thr Gly Lys Arg 95 100 105 GAG AAA CAA TTA CAA CAA TGG AAA AAT AAT CTA AAA AAT GAT GTG GAT 688 Glu Lys Gln Leu Gln Gln Trp Lys Asn Asn Leu Lys Asn Asp Val Asp 110 115 120 AAC ACA ATT CTA TCT CAT GAA CAG AAA AAT GAG TTT AAA ACA AAA ATT 736 Asn Thr Ile Leu Ser His Glu Gln Lys Asn Glu Phe Lys Thr Lys Ile 125 130 135 GAT GAA ACA AAT GAT TCT GAT GCA TTA TTA GAA TTA GAA AAT CAA TTT 784 Asp Glu Thr Asn Asp Ser Asp Ala Leu Leu Glu Leu Glu Asn Gln Phe 140 145 150 155 AAC GAA ACT AAT AGA CTG TTA CAC ATC AAA CAA CAT GAA GAA GTT GAG 832 Asn Glu Thr Asn Arg Leu Leu His Ile Lys Gln His Glu Glu Val Glu 160 165 170 AAA GAT AAG AAA GCT AAG CAA CAG AAA ACT CTG AAA CAG TCA GAT ACG 880 Lys Asp Lys Lys Ala Lys Gln Gln Lys Thr Leu Lys Gln Ser Asp Thr 175 180 185 AAA GTA GAT CTA AGC AAT ATT GAC AAA GAG CTT AAT CAT CAA AAA AGT 928 Lys Val Asp Leu Ser Asn Ile Asp Lys Glu Leu Asn His Gln Lys Ser 190 195 200 CAA GTT GAA AAA ATG GCA GAG CAA AAG GGA ATC ACA AAT GAA GAT AAA 976 Gln Val Glu Lys Met Ala Glu Gln Lys Gly Ile Thr Asn Glu Asp Lys 205 210 215 GAT TCT ATG CTG AAA AAA ATC GAA GAT ATT CGT AAA CAA GCT CAA CAA 1024 Asp Ser Met Leu Lys Lys Ile Glu Asp Ile Arg Lys Gln Ala Gln Gln 220 225 230 235 GCA GAT AAA AAA GAA GAT GCC GAA GTA AAG GTT CGT GAA GAA CTA GGT 1072 Ala Asp Lys Lys Glu Asp Ala Glu Val Lys Val Arg Glu Glu Leu Gly 240 245 250 AAA CTC TTT AGT TCA ACT AAA GCT GGT CTG GAT CAA GAA ATT CAA GAG 1120 Lys Leu Phe Ser Ser Thr Lys Ala Gly Leu Asp Gln Glu Ile Gln Glu 255 260 265 CAT GTG AAG AAA GAA ACG AGT AGT GAG GAA AAT ACT CAG AAA GTT GAT 1168 His Val Lys Lys Glu Thr Ser Ser Glu Glu Asn Thr Gln Lys Val Asp 270 275 280 GAA CAC TAT GCT AAT AGC CTT CAG AAC CTT GCT CAA AAA TCT CTT GAA 1216 Glu His Tyr Ala Asn Ser Leu Gln Asn Leu Ala Gln Lys Ser Leu Glu 285 290 295 GAA CTA GAT AAG GCA ACT ACC AAT GAA CAA GCT ACA CAA GTT AAA AAT 1264 Glu Leu Asp Lys Ala Thr Thr Asn Glu Gln Ala Thr Gln Val Lys Asn 300 305 310 315 CAA TTC TTA GAA AAC GCT CAA AAG CTC AAA GAA ATA CAA CCT CTT ATC 1312 Gln Phe Leu Glu Asn Ala Gln Lys Leu Lys Glu Ile Gln Pro Leu Ile 320 325 330 AAA GAA ACG AAT GTG AAA TTG TAT AAG GCT ATG AGT GAG AGC TTG GAG 1360 Lys Glu Thr Asn Val Lys Leu Tyr Lys Ala Met Ser Glu Ser Leu Glu 335 340 345 CAG GTT GAG AAG GAA TTA AAA CAT AAT TCG GAA GCT AAT TTA GAA GAT 1408 Gln Val Glu Lys Glu Leu Lys His Asn Ser Glu Ala Asn Leu Glu Asp 350 355 360 TTG GTT GCG AAA TCT AAA GAA ATC GTA AGA GAA TAC GAA GGA AAA CTT 1456 Leu Val Ala Lys Ser Lys Glu Ile Val Arg Glu Tyr Glu Gly Lys Leu 365 370 375 AAT CAA TCT AAA AAT CTT CCA GAA TTA AAG CAA CTA GAA GAG GAA GCT 1504 Asn Gln Ser Lys Asn Leu Pro Glu Leu Lys Gln Leu Glu Glu Glu Ala 380 385 390 395 CAT TCG AAG TTG AAA CAA GTT GTG GAG GAT TTT AGA AAA AAA TTT AAA 1552 His Ser Lys Leu Lys Gln Val Val Glu Asp Phe Arg Lys Lys Phe Lys 400 405 410 ACG TCA GAG CAA GTG ACA CCA AAA AAA CGT GTC AAA CGA GAT TTA GCT 1600 Thr Ser Glu Gln Val Thr Pro Lys Lys Arg Val Lys Arg Asp Leu Ala 415 420 425 GCT AAT GAA AAT AAT CAA CAA AAG ATT GAG TTA ACA GTT TCA CCA GAG 1648 Ala Asn Glu Asn Asn Gln Gln Lys Ile Glu Leu Thr Val Ser Pro Glu 430 435 440 AAT ATC ACT GTA TAT GAA GGT GAA GAC GTG AAA TTT ACA GTC ACA GCT 1696 Asn Ile Thr Val Tyr Glu Gly Glu Asp Val Lys Phe Thr Val Thr Ala 445 450 455 AAA AGT GAT TCG AAG ACG ACG TTG GAC TTC AGT GAT CTT TTA ACA AAA 1744 Lys Ser Asp Ser Lys Thr Thr Leu Asp Phe Ser Asp Leu Leu Thr Lys 460 465 470 475 TAT AAT CCG TCT GTA TCA GAT AGA ATT AGT ACA AAT TAT AAG ACT AAC 1792 Tyr Asn Pro Ser Val Ser Asp Arg Ile Ser Thr Asn Tyr Lys Thr Asn 480 485 490 ACG GAT AAT CAT AAG ATT GCC GAA ATC ACT ATC AAG AAT TTG AAG CTA 1840 Thr Asp Asn His Lys Ile Ala Glu Ile Thr Ile Lys Asn Leu Lys Leu 495 500 505 AAT GAA AGT CAA ACA GTG ACT CTA AAA GCT AAA GAT GAT TCT GGC AAT 1888 Asn Glu Ser Gln Thr Val Thr Leu Lys Ala Lys Asp Asp Ser Gly Asn 510 515 520 GTA GTT GAA AAA ACA TTC ACT ATT ACA GTG CAA AAG AAA GAG GAG AAA 1936 Val Val Glu Lys Thr Phe Thr Ile Thr Val Gln Lys Lys Glu Glu Lys 525 530 535 CAA GTT CCT AAA ACA CCA GAG CAG AAA GAT TCT AAA ACG GAA GAA AAG 1984 Gln Val Pro Lys Thr Pro Glu Gln Lys Asp Ser Lys Thr Glu Glu Lys 540 545 550 555 GTT CCT CAA GAA CCA AAA TCA AAT GAC AAG AAT CAA TTA CAA GAG TTG 2032 Val Pro Gln Glu Pro Lys Ser Asn Asp Lys Asn Gln Leu Gln Glu Leu 560 565 570 ATT AAA TCA GCT CAA CAA GAA CTG GAA AAG TTA GAA AAA GCA ATA AAA 2080 Ile Lys Ser Ala Gln Gln Glu Leu Glu Lys Leu Glu Lys Ala Ile Lys 575 580 585 GAA TTA ATG GAG GAA CCA GAG ATT CCA TCC AAT CCA GAG TAT GGT ATT 2128 Glu Leu Met Glu Gln Pro Glu Ile Pro Ser Asn Pro Glu Tyr Gly Ile 590 595 600 CAA AAA TCT ATT TGG GAG TCA CAA AAA GAG CCT ATC CAG GAA GCC ATA 2176 Gln Lys Ser Ile Trp Glu Ser Gln Lys Glu Pro Ile Gln Glu Ala Ile 605 610 615 ACA AGT TTT AAG AAG ATT ATT GGT GAT TCA TCT TCA AAA TAC TAC ACA 2224 Thr Ser Phe Lys Lys Ile Ile Gly Asp Ser Ser Ser Lys Tyr Tyr Thr 620 625 630 635 GAG CAC TAT TTT AAC AAA TAT AAA TCT GAT TTT ATG AAT TAT CAA CTT 2272 Glu His Tyr Phe Asn Lys Tyr Lys Ser Asp Phe Met Asn Tyr Gln Leu 640 645 650 CAT GCA CAA ATG GAG ATG CTG ACT AGA AAA GTG GTT CAG TAT ATG AAC 2320 His Ala Gln Met Glu Met Leu Thr Arg Lys Val Val Gln Tyr Met Asn 655 660 665 AAA TAT CCT GAT AAT GCA GAA ATT AAA AAG ATA TTT GAG TCA GAT ATG 2368 Lys Tyr Pro Asp Asn Ala Glu Ile Lys Lys Ile Phe Glu Ser Asp Met 670 675 680 AAG AGA ACG AAA GAA GAT AAT TAC GGA AGT TTA GAA AAT GAT GCT TTG 2416 Lys Arg Thr Lys Glu Asp Asn Tyr Gly Ser Leu Glu Asn Asp Ala Leu 685 690 695 AAA GGC TAT TTT GAG AAA TAT TTC CTT ACA CCA TTT AAT AAA ATT AAG 2464 Lys Gly Tyr Phe Glu Lys Tyr Phe Leu Thr Pro Phe Asn Lys Ile Lys 700 705 710 715 CAG ATT GTA GAT GAT TTG GAT AAA AAA GTA GAA CAA GAT CAG CCA GCA 2512 Gln Ile Val Asp Asp Leu Asp Lys Lys Val Glu Gln Asp Gln Pro Ala 720 725 730 CCA ATT CCG GAA AAT TCA GAA ATG GAT CAG GCT AAG GAA AAG GCT AAG 2560 Pro Ile Pro Glu Asn Ser Glu Met Asp Gln Ala Lys Glu Lys Ala Lys 735 740 745 ATT GCT GTA TCG AAG TAT ATG AGT AAG GTT TTA GAT GGA GTT CAT CAA 2608 Ile Ala Val Ser Lys Tyr Met Ser Lys Val Leu Asp Gly Val His Gln 750 755 760 CAT CTG CAG AAG AAA AAT AAC AGT AAA ATT GTT GAT CTT TTT AAG GAA 2656 His Leu Gln Lys Lys Asn Asn Ser Lys Ile Val Asp Leu Phe Lys Glu 765 770 775 CTT GAA GCG ATT AAA CAA CAA ACT ATT TTT GAT ATT GAC AAT GCA AAG 2704 Leu Glu Ala Ile Lys Gln Gln Thr Ile Phe Asp Ile Asp Asn Ala Lys 780 785 790 795 ACT GAA GTA GAG ATT GAT AAC TTA GTA CAC GAT GCA TTC TCA AAA ATG 2752 Thr Glu Val Glu Ile Asp Asn Leu Val His Asp Ala Phe Ser Lys Met 800 805 810 AAT GCT ACT GTT GCT AAA TTT CAA AAA GGT CTA GAG ACA AAT ACG CCA 2800 Asn Ala Thr Val Ala Lys Phe Gln Lys Gly Leu Glu Thr Asn Thr Pro 815 820 825 GAA ACT CCA GAT ACA CCG AAG ATT CCA GAG CTA CCT CAA GCC CCA GAT 2848 Glu Thr Pro Asp Thr Pro Lys Ile Pro Glu Leu Pro Gln Ala Pro Asp 830 835 840 ACA CCG CAG GCT CCA GAC ACA CCG CAT GTT CCG GAA TCA CCA AAG GCC 2896 Thr Pro Gln Ala Pro Asp Thr Pro His Val Pro Glu Ser Pro Lys Ala 845 850 855 CCA GAA GCA CCG CGT GTT CCG GAA TCA CCA AAG ACT CCA GAA GCA CCG 2944 Pro Glu Ala Pro Arg Val Pro Glu Ser Pro Lys Thr Pro Glu Ala Pro 860 865 870 875 CAT GTT CCG GAA TCA CCA AAG GCC CCA GAA GCA CCG CGT GTT CCG GAA 2992 His Val Pro Glu Ser Pro Lys Ala Pro Glu Ala Pro Arg Val Pro Glu 880 885 890 TCA CCA AAG ACT CCA GAA GCA CCG CAT GTT CCG GAA TCA CCA AAG ACT 3040 Ser Pro Lys Thr Pro Glu Ala Pro His Val Pro Glu Ser Pro Lys Thr 895 900 905 CCA GAA GCA CCA AAG ATT CCG AAA CCC CCT AAG ACT CCA GAC GTC CCT 3088 Pro Glu Ala Pro Lys Ile Pro Lys Pro Pro Lys Thr Pro Asp Val Pro 910 915 920 AAG CTT CCA GAC GTC CCT AAG CTT CCA GAC GTC CCT AAG CTT CCA GAT 3136 Lys Leu Pro Asp Val Pro Lys Leu Pro Asp Val Pro Lys Leu Pro Asp 925 930 935 GCA CCG AAG TTA CCA GAT GGG TTA AAT AAA GTT GGA CAA GCA GTA TTT 3184 Ala Pro Lys Leu Pro Asp Gly Leu Asn Lys Val Gly Gln Ala Val Phe 940 945 950 955 ACA TCA ACT GAT GGA AAT ACT AAG GTT ACG GTT GTA TTT GAT AAA CCT 3232 Thr Ser Thr Asp Gly Asn Thr Lys Val Thr Val Val Phe Asp Lys Pro 960 965 970 ACA GAT GCT GAT AAG TTA CAT CTC AAG GAA GTA ACG ACG AAA GAG TTG 3280 Thr Asp Ala Asp Lys Leu His Leu Lys Glu Val Thr Thr Lys Glu Leu 975 980 985 GCT GAT AAA ATT GCT CAT AAA ACA GGA GGA GGA ACA GTT CGT GTG TTT 3328 Ala Asp Lys Ile Ala His Lys Thr Gly Gly Gly Thr Val Arg Val Phe 990 995 1000 GAC TTA TCT CTT TCT AAA GGA GGC AAG GAA ACA CAT GTC AAT GGA GAA 3376 Asp Leu Ser Leu Ser Lys Gly Gly Lys Glu Thr His Val Asn Gly Glu 1005 1010 1015 CGA ACT GTT CGG CTC GCG CTT GGG CAG ACT GGC TCA GAT GTT CAC GTC 3424 Arg Thr Val Arg Leu Ala Leu Gly Gln Thr Gly Ser Asp Val His Val 1020 1025 1030 1035 TAT CAC GTA AAG GAA AAT GGC GAC CTT GAG CGT ATT CCT TCT AAA GTT 3472 Tyr His Val Lys Glu Asn Gly Asp Leu Glu Arg Ile Pro Ser Lys Val 1040 1045 1050 GAA AAT GGG CAA GTT GTT TTT AAA ACG AAC CAC TTC AGT TTG TTT GCG 3520 Glu Asn Gly Gln Val Val Phe Lys Thr Asn His Phe Ser Leu Phe Ala 1055 1060 1065 ATT AAG ACA CTT TCT AAG GAT CAA AAT GTT ACT CCA CCG AAG CAG ACT 3568 Ile Lys Thr Leu Ser Lys Asp Gln Asn Val Thr Pro Pro Lys Gln Thr 1070 1075 1080 AAA CCT TCT ACC CAA GGC AGT CAA GTA GAG ATT GCA GAG AGT CAA ACT 3616 Lys Pro Ser Thr Gln Gly Ser Gln Val Glu Ile Ala Glu Ser Gln Thr 1085 1090 1095 GGA AAA TTC CAG AGT AAA GCA GCT AAT CAT AAA GCA CTG GCT ACT GGA 3664 Gly Lys Phe Gln Ser Lys Ala Ala Asn His Lys Ala Leu Ala Thr Gly 1100 1105 1110 1115 AAT GAA ACA GTG GCA AAA GGA AAT CCT ACA TCA ACA ACG GAA AAG AAA 3712 Asn Glu Thr Val Ala Lys Gly Asn Pro Thr Ser Thr Thr Glu Lys Lys 1120 1125 1130 TTG CCA TAT ACA GGA GTG GCA TCT AAT CTA GTT CTT GAA ATT ATG GGT 3760 Leu Pro Tyr Thr Gly Val Ala Ser Asn Leu Val Leu Glu Ile Met Gly 1135 1140 1145 CTC CTT GGT TTG ATT GGA ACT TCA TTC ATC GCA ATG AAA AGA AGA AAA 3808 Leu Leu Gly Leu Ile Gly Thr Ser Phe Ile Ala Met Lys Arg Arg Lys 1150 1155 1160 TCA TGATTCAGTT TTTTAAAAAT ATCCACTTTC GATATCTAGC ATTTGATTGG 3861 Ser TTATCTGTGG ATGATTCTAA AGATGTTACC TATCGTTGGT ATGTAACAAT TATAAGTCAT 3921 TTCATATAAA AGAGGCTCTT TGTCAACTGT AGTTGGTTGA AACAAGGCTA CAAACTAGAA 3981 AGGACGCATT TTGTCCTTTC TTTTTGATGT TGAGGGCAAT GAAAATACGC TTTTTGAAGT 4041 TTTCAAAATT CCGAAAACTA AAGATATTGT ATTTGAAAAG TTTAATGAGA TGATTAGTTG 4101 CTTCCAATTT TGCGTTGGAG TAGGTTTACT GAAGGACGTT GACGATATTC TCTTTGCTTT 4161 TGAGAATGAT TTTAAAGATA GTCTGAAAAA GAGGATGAA 4200 (2) INFORMATION FOR SEQ ID NO : 2: (i) SEQUENCE CHARACTERISTICS: (A) LENGTH : 1164 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: protein (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 2: Met Phe Lys Ser Asn Tyr Glu Arg Lys Met Arg Tyr Ser Ile Arg Lys 1 5 10 15 Phe Ser Val Gly Val Ala Ser Val Ala Val Ala Ser Leu Phe Met Gly 20 25 30 Ser Val Ala His Ala Ser Glu Leu Val Lys Asp Asp Ser Val Lys Thr 35 40 45 Thr Glu Val Ala Ala Lys Pro Tyr Pro Ser Met Ala Gln Thr Asp Gln 50 55 60 Gly Asn Asn Ser Ser Ser Ser Glu Leu Glu Thr Thr Lys Met Glu Ile 65 70 75 80 Pro Thr Thr Asp Ile Lys Lys Ala Val Glu Pro Val Glu Lys Thr Ala 85 90 95 Gly Glu Thr Ser Ala Thr Asp Thr Gly Lys Arg Glu Lys Gln Leu Gln 100 105 110 Gln Trp Lys Asn Asn Leu Lys Asn Asp Val Asp Asn Thr Ile Leu Ser 115 120 125 His Glu Gln Lys Asn Glu Phe Lys Thr Lys Ile Asp Glu Thr Asn Asp 130 135 140 Ser Asp Ala Leu Leu Glu Leu Glu Asn Gln Phe Asn Glu Thr Asn Arg 145 150 155 160 Leu Leu His Ile Lys Gln His Glu Glu Val Glu Lys Asp Lys Lys Ala 165 170 175 Lys Gln Gln Lys Thr Leu Lys Gln Ser Asp Thr Lys Val Asp Leu Ser 180 185 190 Asn Ile Asp Lys Glu Leu Asn His Gln Lys Ser Gln Val Glu Lys Met 195 200 205 Ala Glu Gln Lys Gly Ile Thr Asn Glu Asp Lys Asp Ser Met Leu Lys 210 215 220 Lys Ile Glu Asp Ile Arg Lys Gln Ala Gln Gln Ala Asp Lys Lys Glu 225 230 235 240 Asp Ala Glu Val Lys Val Arg Glu Glu Leu Gly Lys Leu Phe Ser Ser 245 250 255 Thr Lys Ala Gly Leu Asp Gln Glu Ile Gln Glu His Val Lys Lys Glu 260 265 270 Thr Ser Ser Glu Glu Asn Thr Gln Lys Val Asp Glu His Tyr Ala Asn 275 280 285 Ser Leu Gln Asn Leu Ala Gln Lys Ser Leu Glu Glu Leu Asp Lys Ala 290 295 300 Thr Thr Asn Glu Gln Ala Thr Gln Val Lys Asn Gln Phe Leu Glu Asn 305 310 315 320 Ala Gln Lys Leu Lys Glu Ile Gln Pro Leu Ile Lys Glu Thr Asn Val 325 330 335 Lys Leu Tyr Lys Ala Met Ser Glu Ser Leu Glu Gln Val Glu Lys Glu 340 345 350 Leu Lys His Asn Ser Glu Ala Asn Leu Glu Asp Leu Val Ala Lys Ser 355 360 365 Lys Glu Ile Val Arg Glu Tyr Glu Gly Lys Leu Asn Gln Ser Lys Asn 370 375 380 Leu Pro Glu Leu Lys Gln Leu Glu Glu Glu Ala His Ser Lys Leu Lys 385 390 395 400 Gln Val Val Glu Asp Phe Arg Lys Lys Phe Lys Thr Ser Glu Gln Val 405 410 415 Thr Pro Lys Lys Arg Val Lys Arg Asp Leu Ala Ala Asn Glu Asn Asn 420 425 430 Gln Gln Lys Ile Glu Leu Thr Val Ser Pro Glu Asn Ile Thr Val Tyr 435 440 445 Glu Gly Glu Asp Val Lys Phe Thr Val Thr Ala Lys Ser Asp Ser Lys 450 455 460 Thr Thr Leu Asp Phe Ser Asp Leu Leu Thr Lys Tyr Asn Pro Ser Val 465 470 475 480 Ser Asp Arg Ile Ser Thr Asn Tyr Lys Thr Asn Thr Asp Asn His Lys 485 490 495 Ile Ala Glu Ile Thr Ile Lys Asn Leu Lys Leu Asn Glu Ser Gln Thr 500 505 510 Val Thr Leu Lys Ala Lys Asp Asp Ser Gly Asn Val Val Glu Lys Thr 515 520 525 Phe Thr Ile Thr Val Gln Lys Lys Glu Glu Lys Gln Val Pro Lys Thr 530 535 540 Pro Glu Gln Lys Asp Ser Lys Thr Glu Glu Lys Val Pro Gln Glu Pro 545 550 555 560 Lys Ser Asn Asp Lys Asn Gln Leu Gln Glu Leu Ile Lys Ser Ala Gln 565 570 575 Gln Glu Leu Glu Lys Leu Glu Lys Ala Ile Lys Glu Leu Met Glu Gln 580 585 590 Pro Glu Ile Pro Ser Asn Pro Glu Tyr Gly Ile Gln Lys Ser Ile Trp 595 600 605 Glu Ser Gln Lys Glu Pro Ile Gln Glu Ala Ile Thr Ser Phe Lys Lys 610 615 620 Ile Ile Gly Asp Ser Ser Ser Lys Tyr Tyr Thr Glu His Tyr Phe Asn 625 630 635 640 Lys Tyr Lys Ser Asp Phe Met Asn Tyr Gln Leu His Ala Gln Met Glu 645 650 655 Met Leu Thr Arg Lys Val Val Gln Tyr Met Asn Lys Tyr Pro Asp Asn 660 665 670 Ala Glu Ile Lys Lys Ile Phe Glu Ser Asp Met Lys Arg Thr Lys Glu 675 680 685 Asp Asn Tyr Gly Ser Leu Glu Asn Asp Ala Leu Lys Gly Tyr Phe Glu 690 695 700 Lys Tyr Phe Leu Thr Pro Phe Asn Lys Ile Lys Gln Ile Val Asp Asp 705 710 715 720 Leu Asp Lys Lys Val Glu Gln Asp Gln Pro Ala Pro Ile Pro Glu Asn 725 730 735 Ser Glu Met Asp Gln Ala Lys Glu Lys Ala Lys Ile Ala Val Ser Lys 740 745 750 Tyr Met Ser Lys Val Leu Asp Gly Val His Gln His Leu Gln Lys Lys 755 760 765 Asn Asn Ser Lys Ile Val Asp Leu Phe Lys Glu Leu Glu Ala Ile Lys 770 775 780 Gln Gln Thr Ile Phe Asp Ile Asp Asn Ala Lys Thr Glu Val Glu Ile 785 790 795 800 Asp Asn Leu Val His Asp Ala Phe Ser Lys Met Asn Ala Thr Val Ala 805 810 815 Lys Phe Gln Lys Gly Leu Glu Thr Asn Thr Pro Glu Thr Pro Asp Thr 820 825 830 Pro Lys Ile Pro Glu Leu Pro Gln Ala Pro Asp Thr Pro Gln Ala Pro 835 840 845 Asp Thr Pro His Val Pro Glu Ser Pro Lys Ala Pro Glu Ala Pro Arg 850 855 860 Val Pro Glu Ser Pro Lys Thr Pro Glu Ala Pro His Val Pro Glu Ser 865 870 875 880 Pro Lys Ala Pro Glu Ala Pro Arg Val Pro Glu Ser Pro Lys Thr Pro 885 890 895 Glu Ala Pro His Val Pro Glu Ser Pro Lys Thr Pro Glu Ala Pro Lys 900 905 910 Ile Pro Lys Pro Pro Lys Thr Pro Asp Val Pro Lys Leu Pro Asp Val 915 920 925 Pro Lys Leu Pro Asp Val Pro Lys Leu Pro Asp Ala Pro Lys Leu Pro 930 935 940 Asp Gly Leu Asn Lys Val Gly Gln Ala Val Phe Thr Ser Thr Asp Gly 945 950 955 960 Asn Thr Lys Val Thr Val Val Phe Asp Lys Pro Thr Asp Ala Asp Lys 965 970 975 Leu His Leu Lys Glu Val Thr Thr Lys Glu Leu Ala Asp Lys Ile Ala 980 985 990 His Lys Thr Gly Gly Gly Thr Val Arg Val Phe Asp Leu Ser Leu Ser 995 1000 1005 Lys Gly Gly Lys Glu Thr His Val Asn Gly Glu Arg Thr Val Arg Leu 1010 1015 1020 Ala Leu Gly Gln Thr Gly Ser Asp Val His Val Tyr His Val Lys Glu 1025 1030 1035 1040 Asn Gly Asp Leu Glu Arg Ile Pro Ser Lys Val Glu Asn Gly Gln Val 1045 1050 1055 Val Phe Lys Thr Asn His Phe Ser Leu Phe Ala Ile Lys Thr Leu Ser 1060 1065 1070 Lys Asp Gln Asn Val Thr Pro Pro Lys Gln Thr Lys Pro Ser Thr Gln 1075 1080 1085 Gly Ser Gln Val Glu Ile Ala Glu Ser Gln Thr Gly Lys Phe Gln Ser 1090 1095 1100 Lys Ala Ala Asn His Lys Ala Leu Ala Thr Gly Asn Glu Thr Val Ala 1105 1110 1115 1120 Lys Gly Asn Pro Thr Ser Thr Thr Glu Lys Lys Leu Pro Tyr Thr Gly 1125 1130 1135 Val Ala Ser Asn Leu Val Leu Glu Ile Met Gly Leu Leu Gly Leu Ile 1140 1145 1150 Gly Thr Ser Phe Ile Ala Met Lys Arg Arg Lys Ser 1155 1160 (2) INFORMATION FOR SEQ ID NO : 3: (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 3405 base pairs (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE: cDNA (ix) FEATURE: (A) NAME/KEY: CDS (B) LOCATION: 1.. 3405 (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 3: AGA TCT CGA TCC CGC GAA ATT AAT ACG ACT CAC TAT AGG GGA ATT GTG 48 Arg Ser Arg Ser Arg Glu Ile Asn Thr Thr His Tyr Arg Gly Ile Val 1 5 10 15 AGC GGA TAA CAA TTC CCC TCT AGA AAT AAT TTT GTT TAA CTT TAA GAA 96 Ser Gly OCH Gln Phe Pro Ser Arg Asn Asn Phe Val OCH Leu OCH Glu 20 25 30 GGA GAT ATA CAT ATG AGT GAG CTT GTA AAG GAC GAT AGT GTG AAG ACT 144 Gly Asp Ile His Met Ser Glu Leu Val Lys Asp Asp Ser Val Lys Thr 35 40 45 ACC GAG GTT GCA GCT AAG CCC TAT CCA AGT ATG GCT CAA ACA GAT CAA 192 Thr Glu Val Ala Ala Lys Pro Tyr Pro Ser Met Ala Gln Thr Asp Gln 50 55 60 GGA AAT AAT TCA TCA TCC TCG GAA CTT GAG ACA ACA AGG ATG GAA ATT 240 Gly Asn Asn Ser Ser Ser Ser Glu Leu Glu Thr Thr Arg Met Glu Ile 65 70 75 80 CCT ACA ACA CAC ATA AAA AAA GCT GTT GAA CCG GTC GAG AAA ACA GCT 288 Pro Thr Thr His Ile Lys Lys Ala Val Glu Pro Val Glu Lys Thr Ala 85 90 95 GGG GAA ACA TCT GCC ACT GAT ACT GGA AAA CGA GAG AAA CAA TTA CAA 336 Gly Glu Thr Ser Ala Thr Asp Thr Gly Lys Arg Glu Lys Gln Leu Gln 100 105 110 CAA TGG AAA AAT AAT CTA AAA AAT GAT GTG GAT AAC ACA ATT CTA TCT 384 Gln Trp Lys Asn Asn Leu Lys Asn Asp Val Asp Asn Thr Ile Leu Ser 115 120 125 CAT GAA CAG AAA AAT GAG TTT AAA ACA AAA ATT GAT GAA ACA AAT GAT 432 His Glu Gln Lys Asn Glu Phe Lys Thr Lys Ile Asp Glu Thr Asn Asp 130 135 140 TCT GAT GCA TTA TTA GAA TTA GAA AAT CAA TTT AAC GAA ACT AAT AGA 480 Ser Asp Ala Leu Leu Glu Leu Glu Asn Gln Phe Asn Glu Thr Asn Arg 145 150 155 160 CTG TTA CAC ATC AAA CAA CAT GAA GAA GTT GAG AAA CAT AAC AAA CCT 528 Leu Leu His Ile Lys Gln His Glu Glu Val Glu Lys His Asn Lys Pro 165 170 175 AAC CAA CAG AAA ACT CTG AAA CAG TCA GAT ACG AAA GTA GAT CTA AGC 576 Asn Gln Gln Lys Thr Leu Lys Gln Ser Asp Thr Lys Val Asp Leu Ser 180 185 190 AAT ATT GAC AAA GAG CTT AAT CAT CAA AAA AGT CAA GTT GAA GCA ATG 624 Asn Ile Asp Lys Glu Leu Asn His Gln Lys Ser Gln Val Glu Ala Met 195 200 205 GCA GAG CAA GCG GGA ATC ACA AAT GAA GAT AAA GAT TCT ATC CTG AAA 672 Ala Glu Gln Ala Gly Ile Thr Asn Glu Asp Lys Asp Ser Ile Leu Lys 210 215 220 AAA ATC GAA GAT ATT CGT AAA CAA GCT CAA CAA GCA GAT AAA AAA GAA 720 Lys Ile Glu Asp Ile Arg Lys Gln Ala Gln Gln Ala Asp Lys Lys Glu 225 230 235 240 GAT GCC GAA GTA AAG GTT CGT GAA GAA CTA GGT AAA CTC TTT AGT TCA 768 Asp Ala Glu Val Lys Val Arg Glu Glu Leu Gly Lys Leu Phe Ser Ser 245 250 255 ACT AAA GCT GGT CTG GAT CAA CAA ATT CAA GAG CAT GTG AAG AAA GAA 816 Thr Lys Ala Gly Leu Asp Gln Gln Ile Gln Glu His Val Lys Lys Glu 260 265 270 ACG AGT AGT GAG GAA AAT ACT CAG AAA GTT GAT GAA CAC TAT GCT AAT 864 Thr Ser Ser Glu Glu Asn Thr Gln Lys Val Asp Glu His Tyr Ala Asn 275 280 285 AGC CTT CAG AAC CTT GCT CAA AAA TCT CTT GAA GAA CTA GAT AAG GCA 912 Ser Leu Gln Asn Leu Ala Gln Lys Ser Leu Glu Glu Leu Asp Lys Ala 290 295 300 ACT ACC AAT GAA CAA GCT ACA CAA GTT AAA AAT CAA TTC TTA GAA AAC 960 Thr Thr Asn Glu Gln Ala Thr Gln Val Lys Asn Gln Phe Leu Glu Asn 305 310 315 320 GCT CAA AAG CTC AAA GAA ATA CAA CCT CTT ATC AAA GAA ACG AAT GTG 1008 Ala Gln Lys Leu Lys Glu Ile Gln Pro Leu Ile Lys Glu Thr Asn Val 325 330 335 AAA TTG TAT AAG GCT ATG AGT GAG AGC TTG GAG CAG GTT GAG AAG GAA 1056 Lys Leu Tyr Lys Ala Met Ser Glu Ser Leu Glu Gln Val Glu Lys Glu 340 345 350 TTA AAA CAT AAT TCG GAA GCT AAT TTA CAA GAT TTG GTT GCG AAA TCT 1104 Leu Lys His Asn Ser Glu Ala Asn Leu Gln Asp Leu Val Ala Lys Ser 355 360 365 AAA GAA ATC GTA AGA GAA TAC GAA GGA AAA CTT AAT CAA TCT AAA AAT 1152 Lys Glu Ile Val Arg Glu Tyr Glu Gly Lys Leu Asn Gln Ser Lys Asn 370 375 380 CTT CCA GAA TTA AAG CAA CTA GAA GAG GAA GCT CAT TCG AAG TTG AAA 1200 Leu Pro Glu Leu Lys Gln Leu Glu Glu Glu Ala His Ser Lys Leu Lys 385 390 395 400 CAA GTT GTG GAG CAT TTT AGA AAA AAA TTT AAA ACG TCA GAG CAA GTG 1248 Gln Val Val Glu His Phe Arg Lys Lys Phe Lys Thr Ser Glu Gln Val 405 410 415 ACA CCA AAA AAA CGT GTC AAA CGA GAT TTA GCT GCT AAT GAA AAT AAT 1296 Thr Pro Lys Lys Arg Val Lys Arg Asp Leu Ala Ala Asn Glu Asn Asn 420 425 430 CAA CAA AAG ATT GAG TTA ACA GTT TCA CCA GAG AAT ATC ACT GTA TAT 1344 Gln Gln Lys Ile Glu Leu Thr Val Ser Pro Glu Asn Ile Thr Val Tyr 435 440 445 GAA GGT GAA GAC GTG AAA TTT ACA GTC ACA GCT AAA AGT GAT TCG AAG 1392 Glu Gly Glu Asp Val Lys Phe Thr Val Thr Ala Lys Ser Asp Ser Lys 450 455 460 ACG ACG TTG GAC TTC AGT GAT CTT TTA ACA AAA TAT AAT CCG TCT GTA 1440 Thr Thr Leu Asp Phe Ser Asp Leu Leu Thr Lys Tyr Asn Pro Ser Val 465 470 475 480 TCA GAT AGA ATT AGT ACA AAT TAT AAG ACT AAC ACG GAT AAT CAT AAG 1488 Ser Asp Arg Ile Ser Thr Asn Tyr Lys Thr Asn Thr Asp Asn His Lys 485 490 495 ATT GCC GAA ATC ACT ATC AAG AAT TTG AAG CTA AAT CAA AGT CAA ACA 1536 Ile Ala Glu Ile Thr Ile Lys Asn Leu Lys Leu Asn Gln Ser Gln Thr 500 505 510 GTG ACT CTA AAA GCT AAA GAT GAT TCT GGC AAT GTA GTT GAA AAA ACA 1584 Val Thr Leu Lys Ala Lys Asp Asp Ser Gly Asn Val Val Glu Lys Thr 515 520 525 TTC ACT ATT ACA GTC CAA AAG AAA GAG GAG AAA CAA GTT CCT AAA ACA 1632 Phe Thr Ile Thr Val Gln Lys Lys Glu Glu Lys Gln Val Pro Lys Thr 530 535 540 CCA GAG CAG AAA CAT TCT AAA ACG GAA CAA AAC GTT CCT CAA GAA CCA 1680 Pro Glu Gln Lys His Ser Lys Thr Glu Gln Asn Val Pro Gln Glu Pro 545 550 555 560 AAA TCA AAT GAC AAG AAT CAA TTA CAA GAG TTG ATT AAA TCA GCT CAA 1728 Lys Ser Asn Asp Lys Asn Gln Leu Gln Glu Leu Ile Lys Ser Ala Gln 565 570 575 CAA GAA CTC GAA AAG TTA GAA AAA GCA ATA AAA GAA TTA ATG GAG CAA 1776 Gln Glu Leu Glu Lys Leu Glu Lys Ala Ile Lys Glu Leu Met Glu Gln 580 585 590 CCA GAG ATT CCA TCC AAT CCA GAG TAT GGT ATT CAA AAA TCT ATT TGG 1824 Pro Glu Ile Pro Ser Asn Pro Glu Tyr Gly Ile Gln Lys Ser He Trp 595 600 605 GAG TCA CAA AAA GAG CCT ATC CAG GAA GCC ATA ACA AGT TTT AAC AAG 1872 Glu Ser Gln Lys Glu Pro Ile Gln Glu Ala Ile Thr Ser Phe Asn Lys 610 615 620 ATT ATT GGT GAT TCA TCT TCA AAA TAC TAC ACA GAG CAC TAT TTT AAC 1920 Ile Ile Gly Asp Ser Ser Ser Lys Tyr Tyr Thr Glu His Tyr Phe Asn 625 630 635 640 AAA TAT AAA TCT CAT TTT ATG AAT TAT CAA CTT CAT GCA CAA ATG GAG 1968 Lys Tyr Lys Ser His Phe Met Asn Tyr Gln Leu His Ala Gln Met Glu 645 650 655 ATC CTG ACT AGA AAA GTG GTT CAG TAT ATG AAC AAA TAT CCT GAT AAT 2016 Ile Leu Thr Arg Lys Val Val Gln Tyr Met Asn Lys Tyr Pro Asp Asn 660 665 670 GCA GAA ATT AAA AAG ATA TTT GAG TCA GAT ATG AAG AGA ACG AAA GAA 2064 Ala Glu Ile Lys Lys Ile Phe Glu Ser Asp Met Lys Arg Thr Lys Glu 675 680 685 GAT AAT TAC GGA AGT TTA GAA AAT GAT GCT TTG AAA GGC TAT TTT GAG 2112 Asp Asn Tyr Gly Ser Leu Glu Asn Asp Ala Leu Lys Gly Tyr Phe Glu 690 695 700 AAA TAT TTC CTT ACA CCA TTT AAT AAA ATT AAG CAG ATT GTA GAT GAT 2160 Lys Tyr Phe Leu Thr Pro Phe Asn Lys Ile Lys Gln Ile Val Asp Asp 705 710 715 720 TTG GAT AAA AAA GTA GAA CAA GAT CAG CCA GCA CCA ATT CCG GAA AAT 2208 Leu Asp Lys Lys Val Glu Gln Asp Gln Pro Ala Pro Ile Pro Glu Asn 725 730 735 TCA GAA ATG GAT CAG GCT AAG GAA AAG GCT AAG ATT GCT GTA TCG AAG 2256 Ser Glu Met Asp Gln Ala Lys Glu Lys Ala Lys Ile Ala Val Ser Lys 740 745 750 TAT ATG AGT AAG GTT TTA GAT GGA GTT CAT CAA CAT CTG CAG AAG AAA 2304 Tyr Met Ser Lys Val Leu Asp Gly Val His Gln His Leu Gln Lys Lys 755 760 765 AAT CAC AGT AAA ATT GTT GAT CTT TTT AAG GAA CTT GAA GCG ATT AAA 2352 Asn His Ser Lys Ile Val Asp Leu Phe Lys Glu Leu Glu Ala Ile Lys 770 775 780 CAA CAA ACT ATT TTT GAT ATT GAC AAT GCA AAG ACT GAA GTA GAG ATT 2400 Gln Gln Thr Ile Phe Asp Ile Asp Asn Ala Lys Thr Glu Val Glu Ile 785 790 795 800 GAT AAC TTA GTA CAC GAT GCA TTC TCA AAA ATG AAT GCT ACT GTT GCT 2448 Asp Asn Leu Val His Asp Ala Phe Ser Lys Met Asn Ala Thr Val Ala 805 810 815 AAA TTT CAA AAA GGT CTA GAG ACA AAT ACG CCA GAA ACT CCA GAT ACA 2496 Lys Phe Gln Lys Gly Leu Glu Thr Asn Thr Pro Glu Thr Pro Asp Thr 820 825 830 CCG AAG ATT CCA GAG CTA CCT CAA GCC CCA GAT ACA CCG CAG GCT CCA 2544 Pro Lys Ile Pro Glu Leu Pro Gln Ala Pro Asp Thr Pro Gln Ala Pro 835 840 845 GAC ACA CCG CAT GTT CCG GAA TCA CCA AAG GCC CCA GAA GCA CCG CGT 2592 Asp Thr Pro His Val Pro Glu Ser Pro Lys Ala Pro Glu Ala Pro Arg 850 855 860 GTT CCG GAA TCA CCA AAC ACT CCA GAA GCA CCG CAT GTT CCG GAA TCA 2640 Val Pro Glu Ser Pro Asn Thr Pro Glu Ala Pro His Val Pro Glu Ser 865 870 875 880 CCA AAG GCC CCA GAA CCA CCG CGT GTT CCG GAA TCA CCA AAC ACT CCA 2688 Pro Lys Ala Pro Glu Pro Pro Arg Val Pro Glu Ser Pro Asn Thr Pro 885 890 895 GAA GCA CCG CAT GTT CCG GAA TCA CCA AAG ACT CCA GAA GCA CCA AAG 2736 Glu Ala Pro His Val Pro Glu Ser Pro Lys Thr Pro Glu Ala Pro Lys 900 905 910 ATT CCG GAA CCC CCT AAG ACT CCA GAC GTC CCT AAG CTT CCA GAC GTC 2784 Ile Pro Glu Pro Pro Lys Thr Pro Asp Val Pro Lys Leu Pro Asp Val 915 920 925 CCT AAG CTT CCA CAC GTC CCT AAG CTT CCA GAT GCA CCG AAG TTA CCA 2832 Pro Lys Leu Pro His Val Pro Lys Leu Pro Asp Ala Pro Lys Leu Pro 930 935 940 GAT GGG TTA AAT AAA GTT GGA CAA GCA GTA TTT ACA TCA ACT GAT GGA 2880 Asp Gly Leu Asn Lys Val Gly Gln Ala Val Phe Thr Ser Thr Asp Gly 945 950 955 960 AAT ACT AAG GTT ACG GTT GTA TTT GAT AAA CCT ACA GAT GCT GAT AAG 2928 Asn Thr Lys Val Thr Val Val Phe Asp Lys Pro Thr Asp Ala Asp Lys 965 970 975 TTA CAT CTC AAG GAA CTA ACG ACG AAA GAG TTG GCT GAT AAA ATT GCT 2976 Leu His Leu Lys Glu Leu Thr Thr Lys Glu Leu Ala Asp Lys Ile Ala 980 985 990 CAT AAA ACA GGA GGA GGA ACA GTT CGT GTG TTT GAC TTA TCT CTT TCT 3024 His Lys Thr Gly Gly Gly Thr Val Arg Val Phe Asp Leu Ser Leu Ser 995 1000 1005 AAA GGA GGC AAG GAA ACA CAT GTC AAT GGA GAA CGA ACT GTT CGG CTC 3072 Lys Gly Gly Lys Glu Thr His Val Asn Gly Glu Arg Thr Val Arg Leu 1010 1015 1020 GCG CTT GGG CAG ACT GGC TCA GAT GTT CAC GTC TAT CAC GTA AAG GAA 3120 Ala Leu Gly Gln Thr Gly Ser Asp Val His Val Tyr His Val Lys Glu 1025 1030 1035 1040 AAT GGC GAC CTT GAG CGT ATT CCT TCT AAA GTT GAA AAT GGG CAA GTT 3168 Asn Gly Asp Leu Glu Arg Ile Pro Ser Lys Val Glu Asn Gly Gln Val 1045 1050 1055 GTT TTT AAA ACG AAC CAC TTC AGT TTG TTT GCG ATT AAG ACA CTT TCT 3216 Val Phe Lys Thr Asn His Phe Ser Leu Phe Ala Ile Lys Thr Leu Ser 1060 1065 1070 AAG GAT CAA AAT GTT ACT CCA CCG AAG CAG ACT AAA CCT TCT ACC CAA 3264 Lys Asp Gln Asn Val Thr Pro Pro Lys Gln Thr Lys Pro Ser Thr Gln 1075 1080 1085 GGC AGT CAA GTA GAG ATT GCA GAG AGT CAA ACT GGA AAA TTC CAG AGT 3312 Gly Ser Gln Val Glu Ile Ala Glu Ser Gln Thr Gly Lys Phe Gln Ser 1090 1095 1100 AAA GCA GCT AAT CAT AAA GCA CTG GCT ACT GGA AAT GAA ACA GTG GCA 3360 Lys Ala Ala Asn His Lys Ala Leu Ala Thr Gly Asn Glu Thr Val Ala 1105 1110 1115 1120 AAA GGA AAT CCT ACA TCA ACA ACG GAA AAG AAA CTC GAG CAC CAC 3405 Lys Gly Asn Pro Thr Ser Thr Thr Glu Lys Lys Leu Glu His His 1125 1130 1135 (2) INFORMATION FOR SEQ ID NO : 4: (i) SEQUENCE CHARACTERISTICS : (A) LENGTH: 1135 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: protein (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 4: Arg Ser Arg Ser Arg Glu Ile Asn Thr Thr His Tyr Arg Gly Ile Val 1 5 10 15 Ser Gly OCH Gln Phe Pro Ser Arg Asn Asn Phe Val OCH Leu OCH Glu 20 25 30 Gly Asp Ile His Met Ser Glu Leu Val Lys Asp Asp Ser Val Lys Thr 35 40 45 Thr Glu Val Ala Ala Lys Pro Tyr Pro Ser Met Ala Gln Thr Asp Gln 50 55 60 Gly Asn Asn Ser Ser Ser Ser Glu Leu Glu Thr Thr Arg Met Glu Ile 65 70 75 80 Pro Thr Thr His Ile Lys Lys Ala Val Glu Pro Val Glu Lys Thr Ala 85 90 95 Gly Glu Thr Ser Ala Thr Asp Thr Gly Lys Arg Glu Lys Gln Leu Gln 100 105 110 Gln Trp Lys Asn Asn Leu Lys Asn Asp Val Asp Asn Thr Ile Leu Ser 115 120 125 His Glu Gln Lys Asn Glu Phe Lys Thr Lys Ile Asp Glu Thr Asn Asp 130 135 140 Ser Asp Ala Leu Leu Glu Leu Glu Asn Gln Phe Asn Glu Thr Asn Arg 145 150 155 160 Leu Leu His Ile Lys Gln His Glu Glu Val Glu Lys His Asn Lys Pro 165 170 175 Asn Gln Gln Lys Thr Leu Lys Gln Ser Asp Thr Lys Val Asp Leu Ser 180 185 190 Asn Ile Asp Lys Glu Leu Asn His Gln Lys Ser Gln Val Glu Ala Met 195 200 205 Ala Glu Gln Ala Gly Ile Thr Asn Glu Asp Lys Asp Ser Ile Leu Lys 210 215 220 Lys Ile Glu Asp Ile Arg Lys Gln Ala Gln Gln Ala Asp Lys Lys Glu 225 230 235 240 Asp Ala Glu Val Lys Val Arg Glu Glu Leu Gly Lys Leu Phe Ser Ser 245 250 255 Thr Lys Ala Gly Leu Asp Gln Gln Ile Gln Glu His Val Lys Lys Glu 260 265 270 Thr Ser Ser Glu Glu Asn Thr Gln Lys Val Asp Glu His Tyr Ala Asn 275 280 285 Ser Leu Gln Asn Leu Ala Gln Lys Ser Leu Glu Glu Leu Asp Lys Ala 290 295 300 Thr Thr Asn Glu Gln Ala Thr Gln Val Lys Asn Gln Phe Leu Glu Asn 305 310 315 320 Ala Gln Lys Leu Lys Glu Ile Gln Pro Leu Ile Lys Glu Thr Asn Val 325 330 335 Lys Leu Tyr Lys Ala Met Ser Glu Ser Leu Glu Gln Val Glu Lys Glu 340 345 350 Leu Lys His Asn Ser Glu Ala Asn Leu Gln Asp Leu Val Ala Lys Ser 355 360 365 Lys Glu Ile Val Arg Glu Tyr Glu Gly Lys Leu Asn Gln Ser Lys Asn 370 375 380 Leu Pro Glu Leu Lys Gln Leu Glu Glu Glu Ala His Ser Lys Leu Lys 385 390 395 400 Gln Val Val Glu His Phe Arg Lys Lys Phe Lys Thr Ser Glu Gln Val 405 410 415 Thr Pro Lys Lys Arg Val Lys Arg Asp Leu Ala Ala Asn Glu Asn Asn 420 425 430 Gln Gln Lys Ile Glu Leu Thr Val Ser Pro Glu Asn Ile Thr Val Tyr 435 440 445 Glu Gly Glu Asp Val Lys Phe Thr Val Thr Ala Lys Ser Asp Ser Lys 450 455 460 Thr Thr Leu Asp Phe Ser Asp Leu Leu Thr Lys Tyr Asn Pro Ser Val 465 470 475 480 Ser Asp Arg Ile Ser Thr Asn Tyr Lys Thr Asn Thr Asp Asn His Lys 485 490 495 Ile Ala Glu Ile Thr Ile Lys Asn Leu Lys Leu Asn Gln Ser Gln Thr 500 505 510 Val Thr Leu Lys Ala Lys Asp Asp Ser Gly Asn Val Val Glu Lys Thr 515 520 525 Phe Thr Ile Thr Val Gln Lys Lys Glu Glu Lys Gln Val Pro Lys Thr 530 535 540 Pro Glu Gln Lys His Ser Lys Thr Glu Gln Asn Val Pro Gln Glu Pro 545 550 555 560 Lys Ser Asn Asp Lys Asn Gln Leu Gln Glu Leu Ile Lys Ser Ala Gln 565 570 575 Gln Glu Leu Glu Lys Leu Glu Lys Ala Ile Lys Glu Leu Met Glu Gln 580 585 590 Pro Glu Ile Pro Ser Asn Pro Glu Tyr Gly Ile Gln Lys Ser Ile Trp 595 600 605 Glu Ser Gln Lys Glu Pro Ile Gln Glu Ala Ile Thr Ser Phe Asn Lys 610 615 620 Ile Ile Gly Asp Ser Ser Ser Lys Tyr Tyr Thr Glu His Tyr Phe Asn 625 630 635 640 Lys Tyr Lys Ser His Phe Met Asn Tyr Gln Leu His Ala Gln Met Glu 645 650 655 Ile Leu Thr Arg Lys Val Val Gln Tyr Met Asn Lys Tyr Pro Asp Asn 660 665 670 Ala Glu Ile Lys Lys Ile Phe Glu Ser Asp Met Lys Arg Thr Lys Glu 675 680 685 Asp Asn Tyr Gly Ser Leu Glu Asn Asp Ala Leu Lys Gly Tyr Phe Glu 690 695 700 Lys Tyr Phe Leu Thr Pro Phe Asn Lys Ile Lys Gln Ile Val Asp Asp 705 710 715 720 Leu Asp Lys Lys Val Glu Gln Asp Gln Pro Ala Pro Ile Pro Glu Asn 725 730 735 Ser Glu Met Asp Gln Ala Lys Glu Lys Ala Lys Ile Ala Val Ser Lys 740 745 750 Tyr Met Ser Lys Val Leu Asp Gly Val His Gln His Leu Gln Lys Lys 755 760 765 Asn His Ser Lys Ile Val Asp Leu Phe Lys Glu Leu Glu Ala Ile Lys 770 775 780 Gln Gln Thr Ile Phe Asp Ile Asp Asn Ala Lys Thr Glu Val Glu Ile 785 790 795 800 Asp Asn Leu Val His Asp Ala Phe Ser Lys Met Asn Ala Thr Val Ala 805 810 815 Lys Phe Gln Lys Gly Leu Glu Thr Asn Thr Pro Glu Thr Pro Asp Thr 820 825 830 Pro Lys Ile Pro Glu Leu Pro Gln Ala Pro Asp Thr Pro Gln Ala Pro 835 840 845 Asp Thr Pro His Val Pro Glu Ser Pro Lys Ala Pro Glu Ala Pro Arg 850 855 860 Val Pro Glu Ser Pro Asn Thr Pro Glu Ala Pro His Val Pro Glu Ser 865 870 875 880 Pro Lys Ala Pro Glu Pro Pro Arg Val Pro Glu Ser Pro Asn Thr Pro 885 890 895 Glu Ala Pro His Val Pro Glu Ser Pro Lys Thr Pro Glu Ala Pro Lys 900 905 910 Ile Pro Glu Pro Pro Lys Thr Pro Asp Val Pro Lys Leu Pro Asp Val 915 920 925 Pro Lys Leu Pro His Val Pro Lys Leu Pro Asp Ala Pro Lys Leu Pro 930 935 940 Asp Gly Leu Asn Lys Val Gly Gln Ala Val Phe Thr Ser Thr Asp Gly 945 950 955 960 Asn Thr Lys Val Thr Val Val Phe Asp Lys Pro Thr Asp Ala Asp Lys 965 970 975 Leu His Leu Lys Glu Leu Thr Thr Lys Glu Leu Ala Asp Lys Ile Ala 980 985 990 His Lys Thr Gly Gly Gly Thr Val Arg Val Phe Asp Leu Ser Leu Ser 995 1000 1005 Lys Gly Gly Lys Glu Thr His Val Asn Gly Glu Arg Thr Val Arg Leu 1010 1015 1020 Ala Leu Gly Gln Thr Gly Ser Asp Val His Val Tyr His Val Lys Glu 1025 1030 1035 1040 Asn Gly Asp Leu Glu Arg Ile Pro Ser Lys Val Glu Asn Gly Gln Val 1045 1050 1055 Val Phe Lys Thr Asn His Phe Ser Leu Phe Ala Ile Lys Thr Leu Ser 1060 1065 1070 Lys Asp Gln Asn Val Thr Pro Pro Lys Gln Thr Lys Pro Ser Thr Gln 1075 1080 1085 Gly Ser Gln Val Glu Ile Ala Glu Ser Gln Thr Gly Lys Phe Gln Ser 1090 1095 1100 Lys Ala Ala Asn His Lys Ala Leu Ala Thr Gly Asn Glu Thr Val Ala 1105 1110 1115 1120 Lys Gly Asn Pro Thr Ser Thr Thr Glu Lys Lys Leu Glu His His 1125 1130 1135 (2) INFORMATION FOR SEQ ID NO : 5: (i) SEQUENCE CHARACTERISTICS : (A) LENGTH: 3384 base pairs (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE: cDNA (ix) FEATURE: (A) NAME/KEY: CDS (B) LOCATION: 1.. 3384 (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 5: ATG AGT GAG CTT GTA AAG GAC GAT AGT GTG AAG ACT ACC GAG GTT GCA 48 Met Ser Glu Leu Val Lys Asp Asp Ser Val Lys Thr Thr Glu Val Ala 1 5 10 15 GCT AAG CCC TAT CCA AGT ATG GCT CAA ACA GAT CAA GGA AAT AAT TCA 96 Ala Lys Pro Tyr Pro Ser Met Ala Gln Thr Asp Gln Gly Asn Asn Ser 20 25 30 TCA TCC TCG GAA CTT GAG ACA ACA AGG ATG GAA ATT CCT ACA ACA GAC 144 Ser Ser Ser Glu Leu Glu Thr Thr Arg Met Glu Ile Pro Thr Thr Asp 35 40 45 ATA AAA AAA GCT GTT GAA CCG GTC GAG AAA ACA GCT GGG GAA ACA TCT 192 Ile Lys Lys Ala Val Glu Pro Val Glu Lys Thr Ala Gly Glu Thr Ser 50 55 60 GCC ACT GAT ACT GGA AAA CGA GAG AAA CAA TTA CAA CAA TGG AAA AAT 240 Ala Thr Asp Thr Gly Lys Arg Glu Lys Gln Leu Gln Gln Trp Lys Asn 65 70 75 80 AAT CTA AAA AAT GAT GTG GAT AAC ACA ATT CTA TCT CAT GAA CAG AAA 288 Asn Leu Lys Asn Asp Val Asp Asn Thr Ile Leu Ser His Glu Gln Lys 85 90 95 AAT GAG TTT AAA ACA AAA ATT GAT GAA ACA AAT GAT TCT GAT GCA TTA 336 Asn Glu Phe Lys Thr Lys Ile Asp Glu Thr Asn Asp Ser Asp Ala Leu 100 105 110 TTA GAA TTA GAA AAT CAA TTT AAC GAA ACT AAT AGA CTG TTA CAC ATC 384 Leu Glu Leu Glu Asn Gln Phe Asn Glu Thr Asn Arg Leu Leu His Ile 115 120 125 AAA CAA CAT GAA GAA GTT GAG AAA GAT AAG AAA GCT AAG CAA CAG AAA 432 Lys Gln His Glu Glu Val Glu Lys Asp Lys Lys Ala Lys Gln Gln Lys 130 135 140 ACT CTG AAA CAG TCA GAT ACG AAA GTA GAT CTA AGC AAT ATT GAC AAA 480 Thr Leu Lys Gln Ser Asp Thr Lys Val Asp Leu Ser Asn Ile Asp Lys 145 150 155 160 GAG CTT AAT CAT CAA AAA AGT CCA GTT GAA AAA ATG GCA GAG CCA AAG 528 Glu Leu Asn His Gln Lys Ser Pro Val Glu Lys Met Ala Glu Pro Lys 165 170 175 GGA ATC ACA AAT GAA GAT AAA GAT TCT ATG CTG AAA AAA ATC GAA GAT 576 Gly Ile Thr Asn Glu Asp Lys Asp Ser Met Leu Lys Lys Ile Glu Asp 180 185 190 ATT CGT AAA CAA GCT CAA CAA GCA GAT AAA AAA GAA GAT GCC GAA GTA 624 Ile Arg Lys Gln Ala Gln Gln Ala Asp Lys Lys Glu Asp Ala Glu Val 195 200 205 AAG GTT CGT GAA GAA CTA GGT AAA CTC TTT AGT TCA ACT AAA GCT GGT 672 Lys Val Arg Glu Glu Leu Gly Lys Leu Phe Ser Ser Thr Lys Ala Gly 210 215 220 CTG GAT CAA GAA ATT CAT GAG CAT GTG AAG AAA GAA ACG AGT AGT GAG 720 Leu Asp Gln Glu Ile His Glu His Val Lys Lys Glu Thr Ser Ser Glu 225 230 235 240 GAA AAT ACT CAG AAA GTT GAT GAA CAC TAT GCT AAT AGC CTT CAG AAC 768 Glu Asn Thr Gln Lys Val Asp Glu His Tyr Ala Asn Ser Leu Gln Asn 245 250 255 CTT GCT CAA AAA TCT CTT GAA GAA CTA GAT AAG GCA ACT ACC AAT GAA 816 Leu Ala Gln Lys Ser Leu Glu Glu Leu Asp Lys Ala Thr Thr Asn Glu 260 265 270 CAA GCT ACA CAA GTT AAA AAT CAA TTC TTA GAA AAC GCT CAA AAG CTC 864 Gln Ala Thr Gln Val Lys Asn Gln Phe Leu Glu Asn Ala Gln Lys Leu 275 280 285 AAA GAA ATG CAA CCT CTT ATC AAA GAA ACG AAT GTG AAA TTG TAT AAG 912 Lys Glu Met Gln Pro Leu Ile Lys Glu Thr Asn Val Lys Leu Tyr Lys 290 295 300 GCT ATG AGT GAG AGC TTG GAG CAG GTT GAG AAG GAA TTA AAA CAT AAT 960 Ala Met Ser Glu Ser Leu Glu Gln Val Glu Lys Glu Leu Lys His Asn 305 310 315 320 TCG GAA GCT AAT TTA GAA GAT TTG GTT GCG AAA TCT AAA GAA ATC GTA 1008 Ser Glu Ala Asn Leu Glu Asp Leu Val Ala Lys Ser Lys Glu Ile Val 325 330 335 AGA GAA TAC GAA GGA AAA CTT AAT CAA TCT AAA AAT CTT CCA GAA TTA 1056 Arg Glu Tyr Glu Gly Lys Leu Asn Gln Ser Lys Asn Leu Pro Glu Leu 340 345 350 AAG CAA CTA GAA GAG GAA GCT CAT TCG AAG TTG AAA CAA GTT GTG GAG 1104 Lys Gln Leu Glu Glu Glu Ala His Ser Lys Leu Lys Gln Val Val Glu 355 360 365 GAT TTT AGA AAA AAA TTT AAA ACG TCA GAG CAA GTG ACA CCA AAA AAA 1152 Asp Phe Arg Lys Lys Phe Lys Thr Ser Glu Gln Val Thr Pro Lys Lys 370 375 380 CGT GTC AAA CGA GAT TTA GCT GCT AAT GAA AAT AAT CAA CAA AAG ATT 1200 Arg Val Lys Arg Asp Leu Ala Ala Asn Glu Asn Asn Gln Gln Lys Ile 385 390 395 400 GAG TTA ACA GTT TCA CCA GAG AAT ATC ACT GTA TAT GAA GGT GAA GAC 1248 Glu Leu Thr Val Ser Pro Glu Asn Ile Thr Val Tyr Glu Gly Glu Asp 405 410 415 GTG AAA TTT ACA GTC ACA GCT AAA AGT GAT TCG AAG ACG ACG TTG GAC 1296 Val Lys Phe Thr Val Thr Ala Lys Ser Asp Ser Lys Thr Thr Leu Asp 420 425 430 TTC AGT GAT CTT TTA ACA AAA TAT AAT CCG TCT GTA TCA GAT AGA ATT 1344 Phe Ser Asp Leu Leu Thr Lys Tyr Asn Pro Ser Val Ser Asp Arg Ile 435 440 445 AGT ACA AAT TAT AAG ACT AAC ACG GAT AAT CAT AAG ATT GCC GAA ATC 1392 Ser Thr Asn Tyr Lys Thr Asn Thr Asp Asn His Lys Ile Ala Glu Ile 450 455 460 ACT ATC AAG AAT TTG AAG CTA AAT GAA AGT CAA ACA GTG ACT CTA AAA 1440 Thr Ile Lys Asn Leu Lys Leu Asn Glu Ser Gln Thr Val Thr Leu Lys 465 470 475 480 GCT AAA GAT GAT TCT GGC AAT GTA GTT GAA AAA ACA TTC ACT ATT ACA 1488 Ala Lys Asp Asp Ser Gly Asn Val Val Glu Lys Thr Phe Thr Ile Thr 485 490 495 GTG CAA AAG AAA GAG GAG AAA CAA GTT CCT AAA ACA CCA GAG CAG AAA 1536 Val Gln Lys Lys Glu Glu Lys Gln Val Pro Lys Thr Pro Glu Gln Lys 500 505 510 GAT TCT AAA ACG GAA GAA AAG GTT CCT CAA GAA CCA AAA TCA AAT GAC 1584 Asp Ser Lys Thr Glu Glu Lys Val Pro Gln Glu Pro Lys Ser Asn Asp 515 520 525 AAG AAT CAA TTA CAA GAG TTG ATT AAA TCA GCT CAA CAA GAA CTG GAA 1632 Lys Asn Gln Leu Gln Glu Leu Ile Lys Ser Ala Gln Gln Glu Leu Glu 530 535 540 AAG TTA GAA AAA GCA ATA AAA GAA TTA ATG GAG CAA CCA GAG ATT CCA 1680 Lys Leu Glu Lys Ala Ile Lys Glu Leu Met Glu Gln Pro Glu Ile Pro 545 550 555 560 TCC AAT CCA GAG TAT GGT ATT CAA AAA TCT ATT TGG GAG TCA CAA AAA 1728 Ser Asn Pro Glu Tyr Gly Ile Gln Lys Ser Ile Trp Glu Ser Gln Lys 565 570 575 GAG CCT ATC CAG GAA GCC ATA ACA AGT TTT AAG AAG ATT ATT GGT GAT 1776 Glu Pro Ile Gln Glu Ala Ile Thr Ser Phe Lys Lys Ile Ile Gly Asp 580 585 590 TCA TCT TCA AAA TAC TAC ACA GAG CAC TAT TTT AAC AAA TAT AAA TCT 1824 Ser Ser Ser Lys Tyr Tyr Thr Glu His Tyr Phe Asn Lys Tyr Lys Ser 595 600 605 GAT TTT ATG AAT TAT CAA CTT CAT GCA CAA ATG GAG ATG CTG ACT AGA 1872 Asp Phe Met Asn Tyr Gln Leu His Ala Gln Met Glu Met Leu Thr Arg 610 615 620 AAA GTG GTT CAG TAT ATG AAC AAA TAT CCT GAT AAT GCA GAA ATT AAA 1920 Lys Val Val Gln Tyr Met Asn Lys Tyr Pro Asp Asn Ala Glu Ile Lys 625 630 635 640 AAG ATA TTT GAG TCA GAT ATG AAG AGA ACG AAA GAA GAT AAT TAC GGA 1968 Lys Ile Phe Glu Ser Asp Met Lys Arg Thr Lys Glu Asp Asn Tyr Gly 645 650 655 AGT TTA GAA AAT GAT GCT TTG AAA GGC TAT TTT GAG AAA TAT TTC CTT 2016 Ser Leu Glu Asn Asp Ala Leu Lys Gly Tyr Phe Glu Lys Tyr Phe Leu 660 665 670 ACA CCA TTT AAT AAA ATT AAG CAG ATT GTA GAT GAT TTG GAT AAA AAA 2064 Thr Pro Phe Asn Lys Ile Lys Gln Ile Val Asp Asp Leu Asp Lys Lys 675 680 685 GTA GAA CAA GAT CAG CCA GCA CCA ATT CCG GAA AAT TCA GAA ATG GAT 2112 Val Glu Gln Asp Gln Pro Ala Pro Ile Pro Glu Asn Ser Glu Met Asp 690 695 700 CAG GCT AAG GAA AAG GCT AAG ATT GCT GTA TCG AAG TAT ATG AGT AAG 2160 Gln Ala Lys Glu Lys Ala Lys Ile Ala Val Ser Lys Tyr Met Ser Lys 705 710 715 720 GTT TTA GAT GGA GTT CAT CAA CAT CTG CAG AAG AAA AAT CAC AGT AAA 2208 Val Leu Asp Gly Val His Gln His Leu Gln Lys Lys Asn His Ser Lys 725 730 735 ATT GTT GAT CTT TTT AAG GAA CTT GAA GCG ATT AAA CAA CAA ACT ATT 2256 Ile Val Asp Leu Phe Lys Glu Leu Glu Ala Ile Lys Gln Gln Thr Ile 740 745 750 TTT GAT ATT GAC AAT GCA AAG ACT GAA GTA GAG ATT GAT AAC TTA GTA 2304 Phe Asp Ile Asp Asn Ala Lys Thr Glu Val Glu Ile Asp Asn Leu Val 755 760 765 CAC GAT GCA TTC TCA AAA ATG AAT GCT ACT GTT GCT AAA TTT CAA AAA 2352 His Asp Ala Phe Ser Lys Met Asn Ala Thr Val Ala Lys Phe Gln Lys 770 775 780 GGT CTA GAG ACA AAT ACG CCA GAA ACT CCA GAT ACA CCG AAG ATT CCA 2400 Gly Leu Glu Thr Asn Thr Pro Glu Thr Pro Asp Thr Pro Lys Ile Pro 785 790 795 800 GAG CTA CCT CAA GCC CCA GAT ACA CCG CAG GCT CCA GAC ACA CCG CAT 2448 Glu Leu Pro Gln Ala Pro Asp Thr Pro Gln Ala Pro Asp Thr Pro His 805 810 815 GTT CCG GAA TCA CCA AAG GCC CCA GAA GCA CCG CGT GTT CCG GAA TCA 2496 Val Pro Glu Ser Pro Lys Ala Pro Glu Ala Pro Arg Val Pro Glu Ser 820 825 830 CCA AAG ACT CCA GAA GCA CCG CAT GTT CCG GAA TCA CCA AAG GCC CCA 2544 Pro Lys Thr Pro Glu Ala Pro His Val Pro Glu Ser Pro Lys Ala Pro 835 840 845 GAA GCA CCG CGT GTT CCG GAA TCA CCA AAG ACT CCA GAA GCA CCG CAT 2592 Glu Ala Pro Arg Val Pro Glu Ser Pro Lys Thr Pro Glu Ala Pro His 850 855 860 GTT CCG GAA TCA CCA AAG ACT CCA GAA GCA CCA AAG ATT CCG GAA CCC 2640 Val Pro Glu Ser Pro Lys Thr Pro Glu Ala Pro Lys Ile Pro Glu Pro 865 870 875 880 CCT AAG ACT CCG GAC GTC CCT AAG CTT CCA GAC GTC CCT AAG CTT CCA 2688 Pro Lys Thr Pro Asp Val Pro Lys Leu Pro Asp Val Pro Lys Leu Pro 885 890 895 GAC GTC CCT AAG CTT CCA GAT GCA CCG AAG TTA CCA GAT GGG TTA AAT 2736 Asp Val Pro Lys Leu Pro Asp Ala Pro Lys Leu Pro Asp Gly Leu Asn 900 905 910 AAA GTT GGA CAA GCA GTA TTT ACA TCA ACT GAT GGA AAT ACT AAG GTT 2784 Lys Val Gly Gln Ala Val Phe Thr Ser Thr Asp Gly Asn Thr Lys Val 915 920 925 ACG GTT GTA TTT GAT AAA CCT ACA GAT GCT GAT AAG TTA CAT CTC AAG 2832 Thr Val Val Phe Asp Lys Pro Thr Asp Ala Asp Lys Leu His Leu Lys 930 935 940 GAA GTA ACG ACG AAA GAG TTG GCT GAT AAA ATT GCT CAT AAA ACA GGA 2880 Glu Val Thr Thr Lys Glu Leu Ala Asp Lys Ile Ala His Lys Thr Gly 945 950 955 960 GGA GGA ACA GTT CGT GTG TTT GAC TTA TCT CTT TCT AAA GGA GGC AAG 2928 Gly Gly Thr Val Arg Val Phe Asp Leu Ser Leu Ser Lys Gly Gly Lys 965 970 975 GAA ACA CAT GTC AAT GGA GAA CGA ACT GTT CGG CTC GCG CTT GGG CAG 2976 Glu Thr His Val Asn Gly Glu Arg Thr Val Arg Leu Ala Leu Gly Gln 980 985 990 ACT GGC TCA GAT GTT CAC GTC TAT CAC GTA AAG GAA AAT GGC GAC CTT 3024 Thr Gly Ser Asp Val His Val Tyr His Val Lys Glu Asn Gly Asp Leu 995 1000 1005 GAG CGT ATT CCT TCT AAA GTT GAA AAT GGG CAA GTT GTT TTT AAA ACG 3072 Glu Arg Ile Pro Ser Lys Val Glu Asn Gly Gln Val Val Phe Lys Thr 1010 1015 1020 AAC CAC TTC AGT TTG TTT GCG ATT AAG ACA CTT TCT AAG GAT CAA AAT 3120 Asn His Phe Ser Leu Phe Ala Ile Lys Thr Leu Ser Lys Asp Gln Asn 1025 1030 1035 1040 GTT ACT CCA CCG AAG CAG ACT AAA CCT TCT ACC CAA GGC AGT CAA GTA 3168 Val Thr Pro Pro Lys Gln Thr Lys Pro Ser Thr Gln Gly Ser Gln Val 1045 1050 1055 GAG ATT GCA GAG AGT CAA ACT GGA AAA TTC CAG AGT AAA GCA GCT AAT 3216 Glu Ile Ala Glu Ser Gln Thr Gly Lys Phe Gln Ser Lys Ala Ala Asn 1060 1065 1070 CAT AAA GCA CTG GCT ACT GGA AAT GAA ACA GTG GCA AAA GGA AAT CCT 3264 His Lys Ala Leu Ala Thr Gly Asn Glu Thr Val Ala Lys Gly Asn Pro 1075 1080 1085 ACA TCA ACA ACG GAA AAG AAA TTG CCA TAT ACA GGA GTG GCA TCT AAT 3312 Thr Ser Thr Thr Glu Lys Lys Leu Pro Tyr Thr Gly Val Ala Ser Asn 1090 1095 1100 CTA GTT CTT GAA ATT ATG GGT CTC CTT GGT TTG ATT GGA ACT TCA TTC 3360 Leu Val Leu Glu Ile Met Gly Leu Leu Gly Leu Ile Gly Thr Ser Phe 1105 1110 1115 1120 ATC GCA ATG AAA AGA AGA AAA TCA 3384 Ile Ala Met Lys Arg Arg Lys Ser 1125 (2) INFORMATION FOR SEQ ID NO : 6: (i) SEQUENCE CHARACTERISTICS: (LENGTH : 1128 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: protein (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 6: Met Ser Glu Leu Val Lys Asp Asp Ser Val Lys Thr Thr Glu Val Ala 1 5 10 15 Ala Lys Pro Tyr Pro Ser Met Ala Gln Thr Asp Gln Gly Asn Asn Ser 20 25 30 Ser Ser Ser Glu Leu Glu Thr Thr Arg Met Glu Ile Pro Thr Thr Asp 35 40 45 Ile Lys Lys Ala Val Glu Pro Val Glu Lys Thr Ala Gly Glu Thr Ser 50 55 60 Ala Thr Asp Thr Gly Lys Arg Glu Lys Gln Leu Gln Gln Trp Lys Asn 65 70 75 80 Asn Leu Lys Asn Asp Val Asp Asn Thr Ile Leu Ser His Glu Gln Lys 85 90 95 Asn Glu Phe Lys Thr Lys Ile Asp Glu Thr Asn Asp Ser Asp Ala Leu 100 105 110 Leu Glu Leu Glu Asn Gln Phe Asn Glu Thr Asn Arg Leu Leu His Ile 115 120 125 Lys Gln His Glu Glu Val Glu Lys Asp Lys Lys Ala Lys Gln Gln Lys 130 135 140 Thr Leu Lys Gln Ser Asp Thr Lys Val Asp Leu Ser Asn Ile Asp Lys 145 150 155 160 Glu Leu Asn His Gln Lys Ser Pro Val Glu Lys Met Ala Glu Pro Lys 165 170 175 Gly Ile Thr Asn Glu Asp Lys Asp Ser Met Leu Lys Lys Ile Glu Asp 180 185 190 Ile Arg Lys Gln Ala Gln Gln Ala Asp Lys Lys Glu Asp Ala Glu Val 195 200 205 Lys Val Arg Glu Glu Leu Gly Lys Leu Phe Ser Ser Thr Lys Ala Gly 210 215 220 Leu Asp Gln Glu Ile His Glu His Val Lys Lys Glu Thr Ser Ser Glu 225 230 235 240 Glu Asn Thr Gln Lys Val Asp Glu His Tyr Ala Asn Ser Leu Gln Asn 245 250 255 Leu Ala Gln Lys Ser Leu Glu Glu Leu Asp Lys Ala Thr Thr Asn Glu 260 265 270 Gln Ala Thr Gln Val Lys Asn Gln Phe Leu Glu Asn Ala Gln Lys Leu 275 280 285 Lys Glu Met Gln Pro Leu Ile Lys Glu Thr Asn Val Lys Leu Tyr Lys 290 295 300 Ala Met Ser Glu Ser Leu Glu Gln Val Glu Lys Glu Leu Lys His Asn 305 310 315 320 Ser Glu Ala Asn Leu Glu Asp Leu Val Ala Lys Ser Lys Glu Ile Val 325 330 335 Arg Glu Tyr Glu Gly Lys Leu Asn Gln Ser Lys Asn Leu Pro Glu Leu 340 345 350 Lys Gln Leu Glu Glu Glu Ala His Ser Lys Leu Lys Gln Val Val Glu 355 360 365 Asp Phe Arg Lys Lys Phe Lys Thr Ser Glu Gln Val Thr Pro Lys Lys 370 375 380 Arg Val Lys Arg Asp Leu Ala Ala Asn Glu Asn Asn Gln Gln Lys Ile 385 390 395 400 Glu Leu Thr Val Ser Pro Glu Asn Ile Thr Val Tyr Glu Gly Glu Asp 405 410 415 Val Lys Phe Thr Val Thr Ala Lys Ser Asp Ser Lys Thr Thr Leu Asp 420 425 430 Phe Ser Asp Leu Leu Thr Lys Tyr Asn Pro Ser Val Ser Asp Arg Ile 435 440 445 Ser Thr Asn Tyr Lys Thr Asn Thr Asp Asn His Lys Ile Ala Glu Ile 450 455 460 Thr Ile Lys Asn Leu Lys Leu Asn Glu Ser Gln Thr Val Thr Leu Lys 465 470 475 480 Ala Lys Asp Asp Ser Gly Asn Val Val Glu Lys Thr Phe Thr Ile Thr 485 490 495 Val Gln Lys Lys Glu Glu Lys Gln Val Pro Lys Thr Pro Glu Gln Lys 500 505 510 Asp Ser Lys Thr Glu Glu Lys Val Pro Gln Glu Pro Lys Ser Asn Asp 515 520 525 Lys Asn Gln Leu Gln Glu Leu Ile Lys Ser Ala Gln Gln Glu Leu Glu 530 535 540 Lys Leu Glu Lys Ala Ile Lys Glu Leu Met Glu Gln Pro Glu Ile Pro 545 550 555 560 Ser Asn Pro Glu Tyr Gly Ile Gln Lys Ser Ile Trp Glu Ser Gln Lys 565 570 575 Glu Pro Ile Gln Glu Ala Ile Thr Ser Phe Lys Lys Ile Ile Gly Asp 580 585 590 Ser Ser Ser Lys Tyr Tyr Thr Glu His Tyr Phe Asn Lys Tyr Lys Ser 595 600 605 Asp Phe Met Asn Tyr Gln Leu His Ala Gln Met Glu Met Leu Thr Arg 610 615 620 Lys Val Val Gln Tyr Met Asn Lys Tyr Pro Asp Asn Ala Glu Ile Lys 625 630 635 640 Lys Ile Phe Glu Ser Asp Met Lys Arg Thr Lys Glu Asp Asn Tyr Gly 645 650 655 Ser Leu Glu Asn Asp Ala Leu Lys Gly Tyr Phe Glu Lys Tyr Phe Leu 660 665 670 Thr Pro Phe Asn Lys Ile Lys Gln Ile Val Asp Asp Leu Asp Lys Lys 675 680 685 Val Glu Gln Asp Gln Pro Ala Pro Ile Pro Glu Asn Ser Glu Met Asp 690 695 700 Gln Ala Lys Glu Lys Ala Lys Ile Ala Val Ser Lys Tyr Met Ser Lys 705 710 715 720 Val Leu Asp Gly Val His Gln His Leu Gln Lys Lys Asn His Ser Lys 725 730 735 Ile Val Asp Leu Phe Lys Glu Leu Glu Ala Ile Lys Gln Gln Thr Ile 740 745 750 Phe Asp Ile Asp Asn Ala Lys Thr Glu Val Glu Ile Asp Asn Leu Val 755 760 765 His Asp Ala Phe Ser Lys Met Asn Ala Thr Val Ala Lys Phe Gln Lys 770 775 780 Gly Leu Glu Thr Asn Thr Pro Glu Thr Pro Asp Thr Pro Lys Ile Pro 785 790 795 800 Glu Leu Pro Gln Ala Pro Asp Thr Pro Gln Ala Pro Asp Thr Pro His 805 810 815 Val Pro Glu Ser Pro Lys Ala Pro Glu Ala Pro Arg Val Pro Glu Ser 820 825 830 Pro Lys Thr Pro Glu Ala Pro His Val Pro Glu Ser Pro Lys Ala Pro 835 840 845 Glu Ala Pro Arg Val Pro Glu Ser Pro Lys Thr Pro Glu Ala Pro His 850 855 860 Val Pro Glu Ser Pro Lys Thr Pro Glu Ala Pro Lys Ile Pro Glu Pro 865 870 875 880 Pro Lys Thr Pro Asp Val Pro Lys Leu Pro Asp Val Pro Lys Leu Pro 885 890 895 Asp Val Pro Lys Leu Pro Asp Ala Pro Lys Leu Pro Asp Gly Leu Asn 900 905 910 Lys Val Gly Gln Ala Val Phe Thr Ser Thr Asp Gly Asn Thr Lys Val 915 920 925 Thr Val Val Phe Asp Lys Pro Thr Asp Ala Asp Lys Leu His Leu Lys 930 935 940 Glu Val Thr Thr Lys Glu Leu Ala Asp Lys Ile Ala His Lys Thr Gly 945 950 955 960 Gly Gly Thr Val Arg Val Phe Asp Leu Ser Leu Ser Lys Gly Gly Lys 965 970 975 Glu Thr His Val Asn Gly Glu Arg Thr Val Arg Leu Ala Leu Gly Gln 980 985 990 Thr Gly Ser Asp Val His Val Tyr His Val Lys Glu Asn Gly Asp Leu 995 1000 1005 Glu Arg Ile Pro Ser Lys Val Glu Asn Gly Gln Val Val Phe Lys Thr 1010 1015 1020 Asn His Phe Ser Leu Phe Ala Ile Lys Thr Leu Ser Lys Asp Gln Asn 1025 1030 1035 1040 Val Thr Pro Pro Lys Gln Thr Lys Pro Ser Thr Gln Gly Ser Gln Val 1045 1050 1055 Glu Ile Ala Glu Ser Gln Thr Gly Lys Phe Gln Ser Lys Ala Ala Asn 1060 1065 1070 His Lys Ala Leu Ala Thr Gly Asn Glu Thr Val Ala Lys Gly Asn Pro 1075 1080 1085 Thr Ser Thr Thr Glu Lys Lys Leu Pro Tyr Thr Gly Val Ala Ser Asn 1090 1095 1100 Leu Val Leu Glu Ile Met Gly Leu Leu Gly Leu Ile Gly Thr Ser Phe 1105 1110 1115 1120 Ile Ala Met Lys Arg Arg Lys Ser 1125 (2) INFORMATION FOR SEQ ID NO : 7: (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 3387 base pairs (B) TYPE: nucleic acid (C) STRANDEDNESS : single (D) TOPOLOGY: linear (ii) MOLECULE TYPE: cDNA (ix) FEATURE: (A) NAME/KEY: CDS (B) LOCATION: 1.. 3387 (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 7: AGA TCT CGA TCC CGC GAA ATT AAT ACG ACT CAC TAT AGG GGA ATT GTG 48 Arg Ser Arg Ser Arg Glu Ile Asn Thr Thr His Tyr Arg Gly Ile Val 1 5 10 15 AGC GGA TAA CAA TTC CCC TCT AGA AAT AAT TTT GTT TAA CTT TAA GAA 96 Ser Gly OCH Gln Phe Pro Ser Arg Asn Asn Phe Val OCH Leu OCH Glu 20 25 30 GGA GAT ATA CAT ATG AGT GAG CTT GTA AAG GAC GAT AGT GTG AAG ACT 144 Gly Asp Ile His Met Ser Glu Leu Val Lys Asp Asp Ser Val Lys Thr 35 40 45 ACC GAG GTT GCA GCT AAG CCC TAT CCA AGT ATG GCT CAA ACA GAT CAA 192 Thr Glu Val Ala Ala Lys Pro Tyr Pro Ser Met Ala Gln Thr Asp Gln 50 55 60 GGA AAT AAT TCA TCA TCC TCG GAA CTT GAG ACA ACA AGG ATG GAA ATT 240 Gly Asn Asn Ser Ser Ser Ser Glu Leu Glu Thr Thr Arg Met Glu Ile 65 70 75 80 CCT ACA ACA GAC ATA AAA AAA GCT GTT GAA CCG GTC GAG AAA ACA GCT 288 Pro Thr Thr Asp Ile Lys Lys Ala Val Glu Pro Val Glu Lys Thr Ala 85 90 95 GGG GAA ACA TCT GCC ACT CAT ACT GGA AAA CGA GAG AAA CAA TTA CAA 336 Gly Glu Thr Ser Ala Thr His Thr Gly Lys Arg Glu Lys Gln Leu Gln 100 105 110 CAA TGG AAA AAT AAT CTA AAA AAT GAT GTG GAT AAC ACA ATT CTA TCT 384 Gln Trp Lys Asn Asn Leu Lys Asn Asp Val Asp Asn Thr Ile Leu Ser 115 120 125 CAT GAA CAG AAA AAT GAG TTT AAA ACA AAA ATT GAT GAA ACA AAT GAT 432 His Glu Gln Lys Asn Glu Phe Lys Thr Lys Ile Asp Glu Thr Asn Asp 130 135 140 TCT GAT GCA TTA TTA GAA TTA GAA AAT CAA TTT AAC GAA ACT AAT AGA 480 Ser Asp Ala Leu Leu Glu Leu Glu Asn Gln Phe Asn Glu Thr Asn Arg 145 150 155 160 CTG TTA CAC ATC AAA CAA CAT GAA GAA GTT GAG AAA GAT AAG AAA GCT 528 Leu Leu His Ile Lys Gln His Glu Glu Val Glu Lys Asp Lys Lys Ala 165 170 175 AAG CAA CAG AAA ACT CTG AAA CAG TCA GAT ACG AAA GTA GAT CTA AGC 576 Lys Gln Gln Lys Thr Leu Lys Gln Ser Asp Thr Lys Val Asp Leu Ser 180 185 190 AAT ATT GAC AAA GAG CTT AAT CAT CAA AAA AGT CAA GAA GCG GGA ATC 624 Asn Ile Asp Lys Glu Leu Asn His Gln Lys Ser Gln Glu Ala Gly Ile 195 200 205 ACA AAT GAA GAT AAA GAT TCT ATG CTG AAA AAA ATC GAA GAT ATT CGT 672 Thr Asn Glu Asp Lys Asp Ser Met Leu Lys Lys Ile Glu Asp Ile Arg 210 215 220 AAA CAA GCT CAA CAA CCA GAT AAA AAA GAA GAT GCC GAA GTA AAG GTT 720 Lys Gln Ala Gln Gln Pro Asp Lys Lys Glu Asp Ala Glu Val Lys Val 225 230 235 240 CGT GAA GAA CTA GGT AAA CTC TTT AGT TCA ACT AAA GCT GGT CTG GAT 768 Arg Glu Glu Leu Gly Lys Leu Phe Ser Ser Thr Lys Ala Gly Leu Asp 245 250 255 CAA GAA ATT CAA GAG CAT GTG AAG AAA GAA ACG AGT AGT GAG GAA AAT 816 Gln Glu Ile Gln Glu His Val Lys Lys Glu Thr Ser Ser Glu Glu Asn 260 265 270 ACT CAG AAA GTT GAT GAA CAC TAT GCT AAT AGC CTT CAG AAC CTT GCT 864 Thr Gln Lys Val Asp Glu His Tyr Ala Asn Ser Leu Gln Asn Leu Ala 275 280 285 CAA AAA TCT CTT GAA GAA CTA GAT AAG GCA ACT ACC AAT GAA CAA GCT 912 Gln Lys Ser Leu Glu Glu Leu Asp Lys Ala Thr Thr Asn Glu Gln Ala 290 295 300 ACA CAA GTT AAA AAT CAA TTC TTA GAA AAC GCT CAA AAG CTC AAA GAA 960 Thr Gln Val Lys Asn Gln Phe Leu Glu Asn Ala Gln Lys Leu Lys Glu 305 310 315 320 ATA CAA CCT CTT ATC AAA GAA ACG AAT GTG AAA TTG TAT AAG GCT ATG 1008 Ile Gln Pro Leu Ile Lys Glu Thr Asn Val Lys Leu Tyr Lys Ala Met 325 330 335 AGT GAG AGC TTG GAG CAG GTT GAG AAG GAA TTA AAA CAT AAT TCG GAA 1056 Ser Glu Ser Leu Glu Gln Val Glu Lys Glu Leu Lys His Asn Ser Glu 340 345 350 GCT AAT TTA GAA GAT TTG GTT GCG AAA TCT AAA GAA ATC GTA AGA GAA 1104 Ala Asn Leu Glu Asp Leu Val Ala Lys Ser Lys Glu Ile Val Arg Glu 355 360 365 TAC GAA GGA AAA CTT AAT CAA TCT AAA AAT CTT CCA GAA TTA AAG CAA 1152 Tyr Glu Gly Lys Leu Asn Gln Ser Lys Asn Leu Pro Glu Leu Lys Gln 370 375 380 CTA GAA GAG GAA GCT CAT TCG AAG TTG AAA CAA GTT GTG GAG GAT TTT 1200 Leu Glu Glu Glu Ala His Ser Lys Leu Lys Gln Val Val Glu Asp Phe 385 390 395 400 AGA AAA AAA TTT AAA ACG TCA GAG CAA GTG ACA CCA AAA AAA CGT CTC 1248 Arg Lys Lys Phe Lys Thr Ser Glu Gln Val Thr Pro Lys Lys Arg Leu 405 410 415 AAA CGA GAT TTA GCT GCT AAT GAA AAT AAT CAA CAA AAG ATT GAG TTA 1296 Lys Arg Asp Leu Ala Ala Asn Glu Asn Asn Gln Gln Lys Ile Glu Leu 420 425 430 ACA GTT TCA CCA GAG AAT ATC ACT GTA TAT GAA GGT GAA GAC GTG AAA 1344 Thr Val Ser Pro Glu Asn Ile Thr Val Tyr Glu Gly Glu Asp Val Lys 435 440 445 TTT ACA GTC ACA GCT AAA AGT GAT TCG AAG ACG ACG TTG GAC TTC AGT 1392 Phe Thr Val Thr Ala Lys Ser Asp Ser Lys Thr Thr Leu Asp Phe Ser 450 455 460 GAT CTT TTA ACA AAA TAT AAT CCG TCT GTA TCA GAT AGA ATT AGT ACA 1440 Asp Leu Leu Thr Lys Tyr Asn Pro Ser Val Ser Asp Arg Ile Ser Thr 465 470 475 480 AAT TAT AAG ACT AAC ACG GAT AAT CAT AAG ATT GCC GAA ATC ACT ATC 1488 Asn Tyr Lys Thr Asn Thr Asp Asn His Lys Ile Ala Glu Ile Thr Ile 485 490 495 AAG AAT TTG AAG CTA AAT GAA AGT CAA ACA GTG ACT CTA AAA GCT AAA 1536 Lys Asn Leu Lys Leu Asn Glu Ser Gln Thr Val Thr Leu Lys Ala Lys 500 505 510 GAT GAT TCT GGC AAT GTA GTT GAA AAA ACA TTC ACT ATT ACA GTG CAA 1584 Asp Asp Ser Gly Asn Val Val Glu Lys Thr Phe Thr Ile Thr Val Gln 515 520 525 AAG AAA GAG GAG AAA CAA GTT CCT AAA ACA CCA GAG CAG AAA GAT TCT 1632 Lys Lys Glu Glu Lys Gln Val Pro Lys Thr Pro Glu Gln Lys Asp Ser 530 535 540 AAA ACG GAA GAA AAG GTT CCT CAA GAA CCA AAA TCA AAT GAC AAG AAT 1680 Lys Thr Glu Glu Lys Val Pro Gln Glu Pro Lys Ser Asn Asp Lys Asn 545 550 555 560 CAA TTA CAA GAG TTG ATT AAA TCA GCT CAA CAA GAA CTG GAA AAG TTA 1728 Gln Leu Gln Glu Leu Ile Lys Ser Ala Gln Gln Glu Leu Glu Lys Leu 565 570 575 GAA AAA GCA ATA AAA GAA TTA ATG GAG CAA CCA GAG ATT CCA TCC AAT 1776 Glu Lys Ala Ile Lys Glu Leu Met Glu Gln Pro Glu Ile Pro Ser Asn 580 585 590 CCA GAG TAT GGT ATT CAA AAA TCT ATT TGG GAG TCA CAA AAA GAG CCT 1824 Pro Glu Tyr Gly Ile Gln Lys Ser Ile Trp Glu Ser Gln Lys Glu Pro 595 600 605 ATC CAG GAA GCC ATA ACA AGT TTT AAG AAG ATT ATT GGT GAT TCA TCT 1872 Ile Gln Glu Ala Ile Thr Ser Phe Lys Lys Ile Ile Gly Asp Ser Ser 610 615 620 TCA AAA TAC TAC ACA GAG CAC TAT TTT AAC AAA TAT AAA TCT CAT TTT 1920 Ser Lys Tyr Tyr Thr Glu His Tyr Phe Asn Lys Tyr Lys Ser His Phe 625 630 635 640 ATG AAT TAT CAA CTT CAT GCA CAA ATG GAG ATG CTG ACT AGA AAA GTG 1968 Met Asn Tyr Gln Leu His Ala Gln Met Glu Met Leu Thr Arg Lys Val 645 650 655 GTT CAG TAT ATG AAC AAA TAT CCT GAT AAT GCA GAA ATT AAA AAG ATA 2016 Val Gln Tyr Met Asn Lys Tyr Pro Asp Asn Ala Glu Ile Lys Lys Ile 660 665 670 TTT GAG TCA GAT ATG AAG AGA ACG AAA GAA GAT AAT TAC GGA AGT TTA 2064 Phe Glu Ser Asp Met Lys Arg Thr Lys Glu Asp Asn Tyr Gly Ser Leu 675 680 685 GAA AAT GAT GCT TTG AAA GGC TAT TTT GAG AAA TAT TTC CTT ACA CCA 2112 Glu Asn Asp Ala Leu Lys Gly Tyr Phe Glu Lys Tyr Phe Leu Thr Pro 690 695 700 TTT AAT AAA ATT AAG CAG ATT GTA GAT GAT TTC GAT AAA AAA GTA GAA 2160 Phe Asn Lys Ile Lys Gln Ile Val Asp Asp Phe Asp Lys Lys Val Glu 705 710 715 720 CAA GAT CAG CCA GCA CCA ATT CCG GAA AAT TCA GAA ATG GAT CAG GCT 2208 Gln Asp Gln Pro Ala Pro Ile Pro Glu Asn Ser Glu Met Asp Gln Ala 725 730 735 AAG GAA AAG GCT AAG ATT GCT GTA TCG AAG TAT ATG AGT AAG GTT TTA 2256 Lys Glu Lys Ala Lys Ile Ala Val Ser Lys Tyr Met Ser Lys Val Leu 740 745 750 GAT GGA GTT CAT CAA CAT CTG CAG AAG AAA AAT CAC AGT AAA ATT GTT 2304 Asp Gly Val His Gln His Leu Gln Lys Lys Asn His Ser Lys Ile Val 755 760 765 GAT CTT TTT AAG GAA CTT GAA GCG ATT AAA CAA CAA ACT ATT TTT GAT 2352 Asp Leu Phe Lys Glu Leu Glu Ala Ile Lys Gln Gln Thr Ile Phe Asp 770 775 780 ATT GAC AAT GCA AAG ACT GAA GTA GAG ATT GAT AAC TTA GTA CAC GAT 2400 Ile Asp Asn Ala Lys Thr Glu Val Glu Ile Asp Asn Leu Val His Asp 785 790 795 800 GCA TTC TCA AAA ATG AAT GCT ACT GTT GCT AAA TTT CAA AAA GGT CTA 2448 Ala Phe Ser Lys Met Asn Ala Thr Val Ala Lys Phe Gln Lys Gly Leu 805 810 815 GAG ACA AAT ACG CCA GAA ACT CCA GAT ACA CCG AAG ATT CCA GAG CTA 2496 Glu Thr Asn Thr Pro Glu Thr Pro Asp Thr Pro Lys Ile Pro Glu Leu 820 825 830 CCT CAA GCC CCA GAT ACA CCG CAG GCT CCA GAC ACA CCG CAT GTT CCG 2544 Pro Gln Ala Pro Asp Thr Pro Gln Ala Pro Asp Thr Pro His Val Pro 835 840 845 CAA TCA CCA AAG GCC CCA GAA GCA CCG CGT GTT CCG GAA TCA CCA AAG 2592 Gln Ser Pro Lys Ala Pro Glu Ala Pro Arg Val Pro Glu Ser Pro Lys 850 855 860 ACT CCA GAA GCA CCC CAT GTT CCG GAA TCA CCA AAG GCC CCA GAA GCA 2640 Thr Pro Glu Ala Pro His Val Pro Glu Ser Pro Lys Ala Pro Glu Ala 865 870 875 880 CCG CGT GTT CCG GAA TCA CCA AAG ACT CCA GAA GCA CCG CAT GTT CCG 2688 Pro Arg Val Pro Glu Ser Pro Lys Thr Pro Glu Ala Pro His Val Pro 885 890 895 GAA TCA CCA AAG ACT CCA GAA GCA CCA AAG ATT CCG GAA CCC CCT AAG 2736 Glu Ser Pro Lys Thr Pro Glu Ala Pro Lys Ile Pro Glu Pro Pro Lys 900 905 910 ACT CCA GAC GTC CCT AAC CTT CCA GAC GTC CCT AAG CTT CCA GAC GTC 2784 Thr Pro Asp Val Pro Asn Leu Pro Asp Val Pro Lys Leu Pro Asp Val 915 920 925 CCT AAG CTT CCA GAT GCA CCG AAG TTA CCA CAT GGG TTA AAT AAA GTT 2832 Pro Lys Leu Pro Asp Ala Pro Lys Leu Pro His Gly Leu Asn Lys Val 930 935 940 GGA CAA GCA GTA TTT ACA TCA ACT GAT GGA AAT ACT AAG GTT ACG GTT 2880 Gly Gln Ala Val Phe Thr Ser Thr Asp Gly Asn Thr Lys Val Thr Val 945 950 955 960 GTA TTT GAT AAA CCT ACA GAT GCT GAT AAG TTA CAT CTC AAG GAA GTA 2928 Val Phe Asp Lys Pro Thr Asp Ala Asp Lys Leu His Leu Lys Glu Val 965 970 975 ACG ACG AAA GAG TTG GCT GAT AAA ATT GCT CAT AAA ACA GGA GGA GGA 2976 Thr Thr Lys Glu Leu Ala Asp Lys Ile Ala His Lys Thr Gly Gly Gly 980 985 990 ACA GTT CGT GTG TTT GAC TTA TCT CTT TCT AAA GGA GGC AAG GAA ACA 3024 Thr Val Arg Val Phe Asp Leu Ser Leu Ser Lys Gly Gly Lys Glu Thr 995 1000 1005 CAT GTC AAT GGA GAA CGA ACT GTT CGG CTC GCG CTT GGG CAG ACT GGC 3072 His Val Asn Gly Glu Arg Thr Val Arg Leu Ala Leu Gly Gln Thr Gly 1010 1015 1020 TCA GAT GTT CAC GTC TAT CAC GTA AAG GAA AAT GGC GAC CTT GAG CGT 3120 Ser Asp Val His Val Tyr His Val Lys Glu Asn Gly Asp Leu Glu Arg 1025 1030 1035 1040 ATT CCT TCT AAA GTT GAA AAT GGG CAA GTT GTT TTT AAA ACG AAC CAC 3168 Ile Pro Ser Lys Val Glu Asn Gly Gln Val Val Phe Lys Thr Asn His 1045 1050 1055 TTC AGT TTG TTT GCG ATT AAG ACA CTT TCT AAG GAT CAA AAT GTT ACT 3216 Phe Ser Leu Phe Ala Ile Lys Thr Leu Ser Lys Asp Gln Asn Val Thr 1060 1065 1070 CCA CCG AAG CAG ACT AAA CCT TCT ACC CAA GGC AGT CAA GTA GAG ATT 3264 Pro Pro Lys Gln Thr Lys Pro Ser Thr Gln Gly Ser Gln Val Glu Ile 1075 1080 1085 GCA GAG AGT CAA ACT GGA AAA TTC CAG ACT AAA GCA GCT AAT CAT AAA 3312 Ala Glu Ser Gln Thr Gly Lys Phe Gln Thr Lys Ala Ala Asn His Lys 1090 1095 1100 CCA CTG GCT ACT GGA AAT GAA ACA GTG GCA AAA GGA AAT CCT ACA TCA 3360 Pro Leu Ala Thr Gly Asn Glu Thr Val Ala Lys Gly Asn Pro Thr Ser 1105 1110 1115 1120 ACA ACG GAA AAG AAA CTC GAG CAC CAC 3387 Thr Thr Glu Lys Lys Leu Glu His His 1125 (2) INFORMATION FOR SEQ ID NO : 8: (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 1129 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: protein (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 8 : Arg Ser Arg Ser Arg Glu Ile Asn Thr Thr His Tyr Arg Gly Ile Val 1 5 10 15 Ser Gly OCH Gln Phe Pro Ser Arg Asn Asn Phe Val OCH Leu OCH Glu 20 25 30 Gly Asp Ile His Met Ser Glu Leu Val Lys Asp Asp Ser Val Lys Thr 35 40 45 Thr Glu Val Ala Ala Lys Pro Tyr Pro Ser Met Ala Gln Thr Asp Gln 50 55 60 Gly Asn Asn Ser Ser Ser Ser Glu Leu Glu Thr Thr Arg Met Glu Ile 65 70 75 80 Pro Thr Thr Asp Ile Lys Lys Ala Val Glu Pro Val Glu Lys Thr Ala 85 90 95 Gly Glu Thr Ser Ala Thr His Thr Gly Lys Arg Glu Lys Gln Leu Gln 100 105 110 Gln Trp Lys Asn Asn Leu Lys Asn Asp Val Asp Asn Thr Ile Leu Ser 115 120 125 His Glu Gln Lys Asn Glu Phe Lys Thr Lys Ile Asp Glu Thr Asn Asp 130 135 140 Ser Asp Ala Leu Leu Glu Leu Glu Asn Gln Phe Asn Glu Thr Asn Arg 145 150 155 160 Leu Leu His Ile Lys Gln His Glu Glu Val Glu Lys Asp Lys Lys Ala 165 170 175 Lys Gln Gln Lys Thr Leu Lys Gln Ser Asp Thr Lys Val Asp Leu Ser 180 185 190 Asn Ile Asp Lys Glu Leu Asn His Gln Lys Ser Gln Glu Ala Gly Ile 195 200 205 Thr Asn Glu Asp Lys Asp Ser Met Leu Lys Lys Ile Glu Asp Ile Arg 210 215 220 Lys Gln Ala Gln Gln Pro Asp Lys Lys Glu Asp Ala Glu Val Lys Val 225 230 235 240 Arg Glu Glu Leu Gly Lys Leu Phe Ser Ser Thr Lys Ala Gly Leu Asp 245 250 255 Gln Glu Ile Gln Glu His Val Lys Lys Glu Thr Ser Ser Glu Glu Asn 260 265 270 Thr Gln Lys Val Asp Glu His Tyr Ala Asn Ser Leu Gln Asn Leu Ala 275 280 285 Gln Lys Ser Leu Glu Glu Leu Asp Lys Ala Thr Thr Asn Glu Gln Ala 290 295 300 Thr Gln Val Lys Asn Gln Phe Leu Glu Asn Ala Gln Lys Leu Lys Glu 305 310 315 320 Ile Gln Pro Leu Ile Lys Glu Thr Asn Val Lys Leu Tyr Lys Ala Met 325 330 335 Ser Glu Ser Leu Glu Gln Val Glu Lys Glu Leu Lys His Asn Ser Glu 340 345 350 Ala Asn Leu Glu Asp Leu Val Ala Lys Ser Lys Glu Ile Val Arg Glu 355 360 365 Tyr Glu Gly Lys Leu Asn Gln Ser Lys Asn Leu Pro Glu Leu Lys Gln 370 375 380 Leu Glu Glu Glu Ala His Ser Lys Leu Lys Gln Val Val Glu Asp Phe 385 390 395 400 Arg Lys Lys Phe Lys Thr Ser Glu Gln Val Thr Pro Lys Lys Arg Leu 405 410 415 Lys Arg Asp Leu Ala Ala Asn Glu Asn Asn Gln Gln Lys Ile Glu Leu 420 425 430 Thr Val Ser Pro Glu Asn Ile Thr Val Tyr Glu Gly Glu Asp Val Lys 435 440 445 Phe Thr Val Thr Ala Lys Ser Asp Ser Lys Thr Thr Leu Asp Phe Ser 450 455 460 Asp Leu Leu Thr Lys Tyr Asn Pro Ser Val Ser Asp Arg Ile Ser Thr 465 470 475 480 Asn Tyr Lys Thr Asn Thr Asp Asn His Lys Ile Ala Glu Ile Thr Ile 485 490 495 Lys Asn Leu Lys Leu Asn Glu Ser Gln Thr Val Thr Leu Lys Ala Lys 500 505 510 Asp Asp Ser Gly Asn Val Val Glu Lys Thr Phe Thr Ile Thr Val Gln 515 520 525 Lys Lys Glu Glu Lys Gln Val Pro Lys Thr Pro Glu Gln Lys Asp Ser 530 535 540 Lys Thr Glu Glu Lys Val Pro Gln Glu Pro Lys Ser Asn Asp Lys Asn 545 550 555 560 Gln Leu Gln Glu Leu Ile Lys Ser Ala Gln Gln Glu Leu Glu Lys Leu 565 570 575 Glu Lys Ala Ile Lys Glu Leu Met Glu Gln Pro Glu Ile Pro Ser Asn 580 585 590 Pro Glu Tyr Gly Ile Gln Lys Ser Ile Trp Glu Ser Gln Lys Glu Pro 595 600 605 Ile Gln Glu Ala Ile Thr Ser Phe Lys Lys Ile Ile Gly Asp Ser Ser 610 615 620 Ser Lys Tyr Tyr Thr Glu His Tyr Phe Asn Lys Tyr Lys Ser His Phe 625 630 635 640 Met Asn Tyr Gln Leu His Ala Gln Met Glu Met Leu Thr Arg Lys Val 645 650 655 Val Gln Tyr Met Asn Lys Tyr Pro Asp Asn Ala Glu Ile Lys Lys Ile 660 665 670 Phe Glu Ser Asp Met Lys Arg Thr Lys Glu Asp Asn Tyr Gly Ser Leu 675 680 685 Glu Asn Asp Ala Leu Lys Gly Tyr Phe Glu Lys Tyr Phe Leu Thr Pro 690 695 700 Phe Asn Lys Ile Lys Gln Ile Val Asp Asp Phe Asp Lys Lys Val Glu 705 710 715 720 Gln Asp Gln Pro Ala Pro Ile Pro Glu Asn Ser Glu Met Asp Gln Ala 725 730 735 Lys Glu Lys Ala Lys Ile Ala Val Ser Lys Tyr Met Ser Lys Val Leu 740 745 750 Asp Gly Val His Gln His Leu Gln Lys Lys Asn His Ser Lys Ile Val 755 760 765 Asp Leu Phe Lys Glu Leu Glu Ala Ile Lys Gln Gln Thr Ile Phe Asp 770 775 780 Ile Asp Asn Ala Lys Thr Glu Val Glu Ile Asp Asn Leu Val His Asp 785 790 795 800 Ala Phe Ser Lys Met Asn Ala Thr Val Ala Lys Phe Gln Lys Gly Leu 805 810 815 Glu Thr Asn Thr Pro Glu Thr Pro Asp Thr Pro Lys Ile Pro Glu Leu 820 825 830 Pro Gln Ala Pro Asp Thr Pro Gln Ala Pro Asp Thr Pro His Val Pro 835 840 845 Gln Ser Pro Lys Ala Pro Glu Ala Pro Arg Val Pro Glu Ser Pro Lys 850 855 860 Thr Pro Glu Ala Pro His Val Pro Glu Ser Pro Lys Ala Pro Glu Ala 865 870 875 880 Pro Arg Val Pro Glu Ser Pro Lys Thr Pro Glu Ala Pro His Val Pro 885 890 895 Glu Ser Pro Lys Thr Pro Glu Ala Pro Lys Ile Pro Glu Pro Pro Lys 900 905 910 Thr Pro Asp Val Pro Asn Leu Pro Asp Val Pro Lys Leu Pro Asp Val 915 920 925 Pro Lys Leu Pro Asp Ala Pro Lys Leu Pro His Gly Leu Asn Lys Val 930 935 940 Gly Gln Ala Val Phe Thr Ser Thr Asp Gly Asn Thr Lys Val Thr Val 945 950 955 960 Val Phe Asp Lys Pro Thr Asp Ala Asp Lys Leu His Leu Lys Glu Val 965 970 975 Thr Thr Lys Glu Leu Ala Asp Lys Ile Ala His Lys Thr Gly Gly Gly 980 985 990 Thr Val Arg Val Phe Asp Leu Ser Leu Ser Lys Gly Gly Lys Glu Thr 995 1000 1005 His Val Asn Gly Glu Arg Thr Val Arg Leu Ala Leu Gly Gln Thr Gly 1010 1015 1020 Ser Asp Val His Val Tyr His Val Lys Glu Asn Gly Asp Leu Glu Arg 1025 1030 1035 1040 Ile Pro Ser Lys Val Glu Asn Gly Gln Val Val Phe Lys Thr Asn His 1045 1050 1055 Phe Ser Leu Phe Ala Ile Lys Thr Leu Ser Lys Asp Gln Asn Val Thr 1060 1065 1070 Pro Pro Lys Gln Thr Lys Pro Ser Thr Gln Gly Ser Gln Val Glu Ile 1075 1080 1085 Ala Glu Ser Gln Thr Gly Lys Phe Gln Thr Lys Ala Ala Asn His Lys 1090 1095 1100 Pro Leu Ala Thr Gly Asn Glu Thr Val Ala Lys Gly Asn Pro Thr Ser 1105 1110 1115 1120 Thr Thr Glu Lys Lys Leu Glu His His 1125 (2) INFORMATION FOR SEQ ID NO : 9: (i) SEQUENCE CHARACTERISTICS : (A) LENGTH: 3492 base pairs (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE: cDNA (ix) FEATURE : (A) NAME/KEY: CDS (B) LOCATION: 1.. 3492 (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 9: ATG TTT AAA TCT AAT TAT GAA AGA AAA ATG CGT TAT TCC ATT CGT AAA 48 Met Phe Lys Ser Asn Tyr Glu Arg Lys Met Arg Tyr Ser Ile Arg Lys 1 5 10 15 TTT AGT GTA GGA GTA GCT AGT GTA GCG GTA GCT AGT TTG TTC ATG GGA 96 Phe Ser Val Gly Val Ala Ser Val Ala Val Ala Ser Leu Phe Met Gly 20 25 30 AGC GTT GCT CAT GCA AGT GAG CTT GTA AAG CAC GAT AGT GTG AAG ACT 144 Ser Val Ala His Ala Ser Glu Leu Val Lys His Asp Ser Val Lys Thr 35 40 45 ACC GAG GTT GCA GCT AAG CCC TAT CCA AGT ATG GCT CAA ACA GAT CAA 192 Thr Glu Val Ala Ala Lys Pro Tyr Pro Ser Met Ala Gln Thr Asp Gln 50 55 60 GGA AAT AAT TCA TCA TCC TCG GAA CTT GAG ACA ACA AAG ATC GAA ATT 240 Gly Asn Asn Ser Ser Ser Ser Glu Leu Glu Thr Thr Lys Ile Glu Ile 65 70 75 80 CCT ACA ACA GAC ATA AAA AAA GCT GTT GAA CCG CTC GAG AAA ACA GCT 288 Pro Thr Thr Asp Ile Lys Lys Ala Val Glu Pro Leu Glu Lys Thr Ala 85 90 95 GGG GAA ACA TCT GCC ACT GAT ACT GGA AAA CGA GAG AAA CAA TTA CAA 336 Gly Glu Thr Ser Ala Thr Asp Thr Gly Lys Arg Glu Lys Gln Leu Gln 100 105 110 CAA TGG AAA AAT AAT CTA AAA AAT GAT GTG CAT AAC ACA ATT CTA TCT 384 Gln Trp Lys Asn Asn Leu Lys Asn Asp Val His Asn Thr Ile Leu Ser 115 120 125 CAT GAA CAG AAA AAT GAG TTT AAA ACA AAA ATT GAT GAA ACA AAT GAT 432 His Glu Gln Lys Asn Glu Phe Lys Thr Lys Ile Asp Glu Thr Asn Asp 130 135 140 TCT GAT GCA TTA TTA GAA TTA GAA AAT CAA TTT AAC GAA ACT AAT AGA 480 Ser Asp Ala Leu Leu Glu Leu Glu Asn Gln Phe Asn Glu Thr Asn Arg 145 150 155 160 CTG TTA CAC ATC AAA CAA CAT GAA GAA GTT GAG AAA GAT AAG AAA GCT 528 Leu Leu His Ile Lys Gln His Glu Glu Val Glu Lys Asp Lys Lys Ala 165 170 175 AAG CAA CAG AAA ACT CTG AAA CAG TCA GAT ACC AAA GTA GAT CTA AGC 576 Lys Gln Gln Lys Thr Leu Lys Gln Ser Asp Thr Lys Val Asp Leu Ser 180 185 190 AAT ATT GAC AAA GAG CTT AAT CAT CAA AAA AGT CAA GTT GAA ACC ATG 624 Asn Ile Asp Lys Glu Leu Asn His Gln Lys Ser Gln Val Glu Thr Met 195 200 205 GCA GAG CAA CTC GGG ATC ACA AAT GAA GAT AAA GAT TCT ATG CTG AAA 672 Ala Glu Gln Leu Gly Ile Thr Asn Glu Asp Lys Asp Ser Met Leu Lys 210 215 220 AAA ATC GAA GAT ATT CGT AAA CAA GCT CAA CAA GCA GAT AAA AAA GAA 720 Lys Ile Glu Asp Ile Arg Lys Gln Ala Gln Gln Ala Asp Lys Lys Glu 225 230 235 240 GAT GCC GAA GTA AAG GTT CGT GAA GAA CTA GGT AAA CTC TTT ACT TCA 768 Asp Ala Glu Val Lys Val Arg Glu Glu Leu Gly Lys Leu Phe Thr Ser 245 250 255 ACT AAA GCT GGT CTG GAT CAA GAA ATT CAA GAG CAT GTG AAG AAA GAA 816 Thr Lys Ala Gly Leu Asp Gln Glu Ile Gln Glu His Val Lys Lys Glu 260 265 270 ACG ACT AGT GAG GAA AAT ACT CAG AAA GTT GAT GAA CAC TAT CCT AAT 864 Thr Thr Ser Glu Glu Asn Thr Gln Lys Val Asp Glu His Tyr Pro Asn 275 280 285 AGC CTT CAG AAC CTT GCT CAA AAA TCT CTT GAA GAA CTA GAT AAG GCA 912 Ser Leu Gln Asn Leu Ala Gln Lys Ser Leu Glu Glu Leu Asp Lys Ala 290 295 300 ACT ACC AAT GAA CAA GCT ACA CAA GTT AAA AAT CAA TTC TTA GAA AAC 960 Thr Thr Asn Glu Gln Ala Thr Gln Val Lys Asn Gln Phe Leu Glu Asn 305 310 315 320 GCT CAA AAG CTC AAA GAA ATA CAA CCT CTT ATC AAA GAA ACG AAT GTG 1008 Ala Gln Lys Leu Lys Glu Ile Gln Pro Leu Ile Lys Glu Thr Asn Val 325 330 335 AAA TTG TAT AAG GCT ATG AGT GAG AGC TTG GAG CAG GTT GAG AAG CAA 1056 Lys Leu Tyr Lys Ala Met Ser Glu Ser Leu Glu Gln Val Glu Lys Gln 340 345 350 TTA AAA CAT AAT TCG CAA GCT AAT TTA GAA GAT TTG GTT GCG AAA TCT 1104 Leu Lys His Asn Ser Gln Ala Asn Leu Glu Asp Leu Val Ala Lys Ser 355 360 365 AAA GAA ATC GTA AGA GAA TAC GAA GGA AAA CTT AAT CAA TCT AAA AAT 1152 Lys Glu Ile Val Arg Glu Tyr Glu Gly Lys Leu Asn Gln Ser Lys Asn 370 375 380 CTT CCA GAA TTA AAG CAA CTA GAA GAG GAA GCT CAT TCG AAG TTG AAA 1200 Leu Pro Glu Leu Lys Gln Leu Glu Glu Glu Ala His Ser Lys Leu Lys 385 390 395 400 CAA GTT GTG GAG GAT TTT AGA AAA AAA TTT AAA ACC TCA GAG CAA GTG 1248 Gln Val Val Glu Asp Phe Arg Lys Lys Phe Lys Thr Ser Glu Gln Val 405 410 415 ACA CCA AAA AAA CGT GTC AAA CGA GAT TTA GCT GCT AAT GAA AAT AAT 1296 Thr Pro Lys Lys Arg Val Lys Arg Asp Leu Ala Ala Asn Glu Asn Asn 420 425 430 CAA CAA AAG ATT GAG TTA ACA GTT TCA CCA GAG AAT ATC ACT GTA TAT 1344 Gln Gln Lys Ile Glu Leu Thr Val Ser Pro Glu Asn Ile Thr Val Tyr 435 440 445 GAA GGT GAA GAC CTG AAA TTT ACA CTC ACA GCT AAA AGT GAT TCG AAG 1392 Glu Gly Glu Asp Leu Lys Phe Thr Leu Thr Ala Lys Ser Asp Ser Lys 450 455 460 ACG ACG TTG GAC TTC AGT GAT CTT TTA ACA AAA TAT AAT CCG TCT GTA 1440 Thr Thr Leu Asp Phe Ser Asp Leu Leu Thr Lys Tyr Asn Pro Ser Val 465 470 475 480 TCA GAT AGA ATT AGT ACA AAT TAT AAG ACT AAC ACG GAT AAT CAT AAG 1488 Ser Asp Arg Ile Ser Thr Asn Tyr Lys Thr Asn Thr Asp Asn His Lys 485 490 495 ATT GCC GAA ATC ACT ATC AAG AAT TTG AAG CTA AAT GAA AGT CAA ACA 1536 Ile Ala Glu Ile Thr Ile Lys Asn Leu Lys Leu Asn Glu Ser Gln Thr 500 505 510 GTG ACT CTA AAA GCT AAA GAT GAT TCT GGC AAT GTA GTT CAA AAA ACA 1584 Val Thr Leu Lys Ala Lys Asp Asp Ser Gly Asn Val Val Gln Lys Thr 515 520 525 TTC ACT ATT ACA GTG CAA AAG AAA GAG GAG AAA CAA GTT CCT AAA ACA 1632 Phe Thr Ile Thr Val Gln Lys Lys Glu Glu Lys Gln Val Pro Lys Thr 530 535 540 CCA GAG CAG AAA GAT TCT AAA ACG GAA GAA AAG GTT CCT CAA GAA CCA 1680 Pro Glu Gln Lys Asp Ser Lys Thr Glu Glu Lys Val Pro Gln Glu Pro 545 550 555 560 AAA TCA AAT GAC AAG AAT CAA TTA CAA GAG TTG ATT AAA TCA GCT CAA 1728 Lys Ser Asn Asp Lys Asn Gln Leu Gln Glu Leu Ile Lys Ser Ala Gln 565 570 575 CAA CAA CTG GAA AAG TTA GAA AAA GCA ATA AAA GAA TTA ATG GAG CAA 1776 Gln Gln Leu Glu Lys Leu Glu Lys Ala Ile Lys Glu Leu Met Glu Gln 580 585 590 CCA GAG ATT CCA TCC AAT CCA GAG TAT GGT ATT CAA AAA TCT ATT TGG 1824 Pro Glu Ile Pro Ser Asn Pro Glu Tyr Gly Ile Gln Lys Ser Ile Trp 595 600 605 GAG TCA CAA AAA GAG CCT ATC CAG GAA GCC ATA ACA AGT TTT AAG AAG 1872 Glu Ser Gln Lys Glu Pro Ile Gln Glu Ala Ile Thr Ser Phe Lys Lys 610 615 620 ATT ATT GGT GAT TCA TCT TCA AAA TAC TAC ACA GAG CAC TAT TTT AAC 1920 Ile Ile Gly Asp Ser Ser Ser Lys Tyr Tyr Thr Glu His Tyr Phe Asn 625 630 635 640 AAA TAT AAA TCT GAT TTT ATG AAT TAT CAA CTT CAT GCA CAA ATG GAG 1968 Lys Tyr Lys Ser Asp Phe Met Asn Tyr Gln Leu His Ala Gln Met Glu 645 650 655 ATG CTG ACT AGA AAA GTG GTT CAG TAT ATC AAC AAA TAT CCT GAT AAT 2016 Met Leu Thr Arg Lys Val Val Gln Tyr Ile Asn Lys Tyr Pro Asp Asn 660 665 670 GCA GAA ATT AAA AAG ATA TTT GAG TCA GAT ATG AAG AGA ACG AAA GAA 2064 Ala Glu Ile Lys Lys Ile Phe Glu Ser Asp Met Lys Arg Thr Lys Glu 675 680 685 GAT AAT TAC GGA AGT TTA GAA AAT GAT GCT TTG AAA GGC TAT TTT GAG 2112 Asp Asn Tyr Gly Ser Leu Glu Asn Asp Ala Leu Lys Gly Tyr Phe Glu 690 695 700 AAA TAT TTC CTT ACA CCA TTT AAT AAA ATT AAG CAG ATT GTA GAT GAT 2160 Lys Tyr Phe Leu Thr Pro Phe Asn Lys Ile Lys Gln Ile Val Asp Asp 705 710 715 720 TTG GAT AAA AAA GTA GAA CAA GAT CAG CCA GCA CCA ATT CCG GAA AAT 2208 Leu Asp Lys Lys Val Glu Gln Asp Gln Pro Ala Pro Ile Pro Glu Asn 725 730 735 TCA GAA ATG GAT CAG GCT AAG GAA AAG GCT AAG ATT GCT GTA TCG AAG 2256 Ser Glu Met Asp Gln Ala Lys Glu Lys Ala Lys Ile Ala Val Ser Lys 740 745 750 TAT ATG AGT AAG GTT TTA GAT GGA GTT CAT CAA CAT CTG CAG AAG AAA 2304 Tyr Met Ser Lys Val Leu Asp Gly Val His Gln His Leu Gln Lys Lys 755 760 765 AAT AAC ACT AAA ATT GTT GAT CTT TTT AAG GAA CTT GAA GCG ATT AAA 2352 Asn Asn Thr Lys Ile Val Asp Leu Phe Lys Glu Leu Glu Ala Ile Lys 770 775 780 CAA CAA ACT ATT TTT GAT ATT GAC AAT GCA AAG ACT GAA GTA GAG ATT 2400 Gln Gln Thr Ile Phe Asp Ile Asp Asn Ala Lys Thr Glu Val Glu Ile 785 790 795 800 GAT AAC TTA GTA CAC GAT GCA TTC TCA AAA ATG AAT GCT ACT GTT GCT 2448 Asp Asn Leu Val His Asp Ala Phe Ser Lys Met Asn Ala Thr Val Ala 805 810 815 AAA TTT CAA AAA GGT CTA GAG ACA AAT ACG CCA GAA ACT CCA CAT ACA 2496 Lys Phe Gln Lys Gly Leu Glu Thr Asn Thr Pro Glu Thr Pro His Thr 820 825 830 CCC AAG ATT CCA GAG CTA CCT CAA GCC CCA GAT ACA CCG CAG GCT CCA 2544 Pro Lys Ile Pro Glu Leu Pro Gln Ala Pro Asp Thr Pro Gln Ala Pro 835 840 845 GAC ACA CCG CAT GTT CCG GAA TCA CCA AAG GCC CCA GAA GCA CCC CGT 2592 Asp Thr Pro His Val Pro Glu Ser Pro Lys Ala Pro Glu Ala Pro Arg 850 855 860 GTT CCG GAA TCA CCA AAC ACT CCA GAA GCA CCG CAT GTT CCC CAA TCA 2640 Val Pro Glu Ser Pro Asn Thr Pro Glu Ala Pro His Val Pro Gln Ser 865 870 875 880 CCA AAG GCC CCA GAA GCA CCG CGT GTT CCG GAA TCA CCA AAC ACT CCA 2688 Pro Lys Ala Pro Glu Ala Pro Arg Val Pro Glu Ser Pro Asn Thr Pro 885 890 895 GAA GCA CCG CAT GTT CCG GAA TCA CCA AAG ACT CCA GAA GCA CCA AAG 2736 Glu Ala Pro His Val Pro Glu Ser Pro Lys Thr Pro Glu Ala Pro Lys 900 905 910 ATT CCG GAA CCC CCT AAG ACT CCA GAC GTC CCT AAG CTT CCA GAC GTC 2784 Ile Pro Glu Pro Pro Lys Thr Pro Asp Val Pro Lys Leu Pro Asp Val 915 920 925 CCT AAG CTT CCA GAC GTC CCT AAG CTT CCA GAT GCA CCC AAG TTA CCA 2832 Pro Lys Leu Pro Asp Val Pro Lys Leu Pro Asp Ala Pro Lys Leu Pro 930 935 940 GAT GGG TTA AAT AAA GTT GGA CAA GCA GTA TTT ACA TCA ACT GAT GGA 2880 Asp Gly Leu Asn Lys Val Gly Gln Ala Val Phe Thr Ser Thr Asp Gly 945 950 955 960 AAT ACT AAG GTT ACG GTT GTA TTT GAT AAA CCT ACA GAT GCT GAT AAG 2928 Asn Thr Lys Val Thr Val Val Phe Asp Lys Pro Thr Asp Ala Asp Lys 965 970 975 TTA CAT CTC AAG GAA CTA ACG ACG AAA GAG TTG GCT GAT AAA ATT GCT 2976 Leu His Leu Lys Glu Leu Thr Thr Lys Glu Leu Ala Asp Lys Ile Ala 980 985 990 CAT AAA ACA GGA GGA GGA ACA GTT CGT GTG TTT GAC TTA TCT CTT TCT 3024 His Lys Thr Gly Gly Gly Thr Val Arg Val Phe Asp Leu Ser Leu Ser 995 1000 1005 AAA GGA GGC AAG GAA ACA CAT GTC AAT GGA CAA CGA ACT GTT CGG CTC 3072 Lys Gly Gly Lys Glu Thr His Val Asn Gly Gln Arg Thr Val Arg Leu 1010 1015 1020 GCG CTT GGG CAG ACT GGC TCA GAT GTT CAC GTC TAT CAC GTA AAG GAA 3120 Ala Leu Gly Gln Thr Gly Ser Asp Val His Val Tyr His Val Lys Glu 1025 1030 1035 1040 AAT GGC GAC CTT GAG CGT ATT CCT TCT AAA GTT GAA AAT GGG CAA GTT 3168 Asn Gly Asp Leu Glu Arg Ile Pro Ser Lys Val Glu Asn Gly Gln Val 1045 1050 1055 GTT TTT AAA ACG AAC CAC TTC AGT TTG TTT GCG ATT AAG ACA CTT TCT 3216 Val Phe Lys Thr Asn His Phe Ser Leu Phe Ala Ile Lys Thr Leu Ser 1060 1065 1070 AAG GAT CAA AAT GTT ACT CCA CCG AAG CAG ACT AAA CCT TCT ACC CAA 3264 Lys Asp Gln Asn Val Thr Pro Pro Lys Gln Thr Lys Pro Ser Thr Gln 1075 1080 1085 GGC AGT CAA GTA GAG ATT GCA GAG AGT CAA ACT GGA AAA TTC CAG AGT 3312 Gly Ser Gln Val Glu Ile Ala Glu Ser Gln Thr Gly Lys Phe Gln Ser 1090 1095 1100 AAA GCA GCT AAT CAT AAA GCA CTC GCT ACT GGA AAT GAA ACA GTG GCA 3360 Lys Ala Ala Asn His Lys Ala Leu Ala Thr Gly Asn Glu Thr Val Ala 1105 1110 1115 1120 AAA GGA AAT CCT ACA TCA ACA ACG CAA AAG AAA TTG CCA TAT ACA GGA 3408 Lys Gly Asn Pro Thr Ser Thr Thr Gln Lys Lys Leu Pro Tyr Thr Gly 1125 1130 1135 GTG GCA TCT AAT CTA GTT CTT GAA ATT ATG GGT CTC CTT GGT TTG ATT 3456 Val Ala Ser Asn Leu Val Leu Glu Ile Met Gly Leu Leu Gly Leu Ile 1140 1145 1150 GGA ACT TCA TTC ATC GCA ATG AAA AGA AGA AAA TCA 3492 Gly Thr Ser Phe Ile Ala Met Lys Arg Arg Lys Ser 1155 1160 (2) INFORMATION FOR SEQ ID NO : 10: (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 1164 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) MOLECULE TYPE: protein (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 10: Met Phe Lys Ser Asn Tyr Glu Arg Lys Met Arg Tyr Ser Ile Arg Lys 1 5 10 15 Phe Ser Val Gly Val Ala Ser Val Ala Val Ala Ser Leu Phe Met Gly 20 25 30 Ser Val Ala His Ala Ser Glu Leu Val Lys His Asp Ser Val Lys Thr 35 40 45 Thr Glu Val Ala Ala Lys Pro Tyr Pro Ser Met Ala Gln Thr Asp Gln 50 55 60 Gly Asn Asn Ser Ser Ser Ser Glu Leu Glu Thr Thr Lys Ile Glu Ile 65 70 75 80 Pro Thr Thr Asp Ile Lys Lys Ala Val Glu Pro Leu Glu Lys Thr Ala 85 90 95 Gly Glu Thr Ser Ala Thr Asp Thr Gly Lys Arg Glu Lys Gln Leu Gln 100 105 110 Gln Trp Lys Asn Asn Leu Lys Asn Asp Val His Asn Thr Ile Leu Ser 115 120 125 His Glu Gln Lys Asn Glu Phe Lys Thr Lys Ile Asp Glu Thr Asn Asp 130 135 140 Ser Asp Ala Leu Leu Glu Leu Glu Asn Gln Phe Asn Glu Thr Asn Arg 145 150 155 160 Leu Leu His Ile Lys Gln His Glu Glu Val Glu Lys Asp Lys Lys Ala 165 170 175 Lys Gln Gln Lys Thr Leu Lys Gln Ser Asp Thr Lys Val Asp Leu Ser 180 185 190 Asn Ile Asp Lys Glu Leu Asn His Gin Lys Ser Gin Val Glu Thr Met 195 200 205 Ala Glu Gin Leu Gly Ile Thr Asn Glu Asp Lys Asp Ser Met Leu Lys 210 215 220 Lys Ile Glu Asp Ile Arg Lys Gin Ala Gin Gin Ala Asp Lys Lys Glu 225 230 235 240 Asp Ala Glu Val Lys Val Arg Glu Glu Leu Gly Lys Leu Phe Thr Ser 245 250 255 Thr Lys Ala Gly Leu Asp Gin Glu Ile Gin Glu His Val Lys Lys Glu 260 265 270 Thr Thr Ser Glu Glu Asn Thr Gin Lys Val Asp Glu His Tyr Pro Asn 275 280 285 Ser Leu Gin Asn Leu Ala Gin Lys Ser Leu Glu Glu Leu Asp Lys Ala 290 295 300 Thr Thr Asn Glu Gin Ala Thr Gin Val Lys Asn Gin Phe Leu Glu Asn 305 310 315 320 Ala Gin Lys Leu Lys Glu Ile Gin Pro Leu Ile Lys Glu Thr Asn Val 325 330 335 Lys Leu Tyr Lys Ala Met Ser Glu Ser Leu Glu Gin Val Glu Lys Gin 340 345 350 Leu Lys His Asn Ser Gin Ala Asn Leu Glu Asp Leu Val Ala Lys Ser 355 360 365 Lys Glu Ile Val Arg Glu Tyr Glu Gly Lys Leu Asn Gin Ser Lys Asn 370 375 380 Leu Pro Glu Leu Lys Gin Leu Glu Glu Glu Ala His Ser Lys Leu Lys 385 390 395 400 Gin Val Val Glu Asp Phe Arg Lys Lys Phe Lys Thr Ser Glu Gin Val 405 410 415 Thr Pro Lys Lys Arg Val Lys Arg Asp Leu Ala Ala Asn Glu Asn Asn 420 425 430 Gin Gin Lys Ile Glu Leu Thr Val Ser Pro Glu Asn Ile Thr Val Tyr 435 440 445 Glu Gly Glu Asp Leu Lys Phe Thr Leu Thr Ala Lys Ser Asp Ser Lys 450 455 460 Thr Thr Leu Asp Phe Ser Asp Leu Leu Thr Lys Tyr Asn Pro Ser Val 465 470 475 480 Ser Asp Arg Ile Ser Thr Asn Tyr Lys Thr Asn Thr Asp Asn His Lys 485 490 495 Ile Ala Glu Ile Thr Ile Lys Asn Leu Lys Leu Asn Glu Ser Gln Thr 500 505 510 Val Thr Leu Lys Ala Lys Asp Asp Ser Gly Asn Val Val Gln Lys Thr 515 520 525 Phe Thr Ile Thr Val Gln Lys Lys Glu Glu Lys Gln Val Pro Lys Thr 530 535 540 Pro Glu Gln Lys Asp Ser Lys Thr Glu Glu Lys Val Pro Gln Glu Pro 545 550 555 560 Lys Ser Asn Asp Lys Asn Gln Leu Gln Glu Leu Ile Lys Ser Ala Gln 565 570 575 Gln Gln Leu Glu Lys Leu Glu Lys Ala Ile Lys Glu Leu Met Glu Gln 580 585 590 Pro Glu Ile Pro Ser Asn Pro Glu Tyr Gly Ile Gln Lys Ser Ile Trp 595 600 605 Glu Ser Gln Lys Glu Pro He Gln Glu Ala Ile Thr Ser Phe Lys Lys 610 615 620 Ile Ile Gly Asp Ser Ser Ser Lys Tyr Tyr Thr Glu His Tyr Phe Asn 625 630 635 640 Lys Tyr Lys Ser Asp Phe Met Asn Tyr Gln Leu His Ala Gln Met Glu 645 650 655 Met Leu Thr Arg Lys Val Val Gln Tyr Ile Asn Lys Tyr Pro Asp Asn 660 665 670 Ala Glu Ile Lys Lys Ile Phe Glu Ser Asp Met Lys Arg Thr Lys Glu 675 680 685 Asp Asn Tyr Gly Ser Leu Glu Asn Asp Ala Leu Lys Gly Tyr Phe Glu 690 695 700 Lys Tyr Phe Leu Thr Pro Phe Asn Lys Ile Lys Gln Ile Val Asp Asp 705 710 715 720 Leu Asp Lys Lys Val Glu Gln Asp Gln Pro Ala Pro Ile Pro Glu Asn 725 730 735 Ser Glu Met Asp Gln Ala Lys Glu Lys Ala Lys Ile Ala Val Ser Lys 740 745 750 Tyr Met Ser Lys Val Leu Asp Gly Val His Gln His Leu Gln Lys Lys 755 760 765 Asn Asn Thr Lys Ile Val Asp Leu Phe Lys Glu Leu Glu Ala Ile Lys 770 775 780 Gln Gln Thr Ile Phe Asp Ile Asp Asn Ala Lys Thr Glu Val Glu Ile 785 790 795 800 Asp Asn Leu Val His Asp Ala Phe Ser Lys Met Asn Ala Thr Val Ala 805 810 815 Lys Phe Gln Lys Gly Leu Glu Thr Asn Thr Pro Glu Thr Pro His Thr 820 825 830 Pro Lys Ile Pro Glu Leu Pro Gln Ala Pro Asp Thr Pro Gln Ala Pro 835 840 845 Asp Thr Pro His Val Pro Glu Ser Pro Lys Ala Pro Glu Ala Pro Arg 850 855 860 Val Pro Glu Ser Pro Asn Thr Pro Glu Ala Pro His Val Pro Gln Ser 865 870 875 880 Pro Lys Ala Pro Glu Ala Pro Arg Val Pro Glu Ser Pro Asn Thr Pro 885 890 895 Glu Ala Pro His Val Pro Glu Ser Pro Lys Thr Pro Glu Ala Pro Lys 900 905 910 Ile Pro Glu Pro Pro Lys Thr Pro Asp Val Pro Lys Leu Pro Asp Val 915 920 925 Pro Lys Leu Pro Asp Val Pro Lys Leu Pro Asp Ala Pro Lys Leu Pro 930 935 940 Asp Gly Leu Asn Lys Val Gly Gln Ala Val Phe Thr Ser Thr Asp Gly 945 950 955 960 Asn Thr Lys Val Thr Val Val Phe Asp Lys Pro Thr Asp Ala Asp Lys 965 970 975 Leu His Leu Lys Glu Leu Thr Thr Lys Glu Leu Ala Asp Lys Ile Ala 980 985 990 His Lys Thr Gly Gly Gly Thr Val Arg Val Phe Asp Leu Ser Leu Ser 995 1000 1005 Lys Gly Gly Lys Glu Thr His Val Asn Gly Gln Arg Thr Val Arg Leu 1010 1015 1020 Ala Leu Gly Gln Thr Gly Ser Asp Val His Val Tyr His Val Lys Glu 1025 1030 1035 1040 Asn Gly Asp Leu Glu Arg Ile Pro Ser Lys Val Glu Asn Gly Gln Val 1045 1050 1055 Val Phe Lys Thr Asn His Phe Ser Leu Phe Ala Ile Lys Thr Leu Ser 1060 1065 1070 Lys Asp Gln Asn Val Thr Pro Pro Lys Gln Thr Lys Pro Ser Thr Gln 1075 1080 1085 Gly Ser Gln Val Glu Ile Ala Glu Ser Gln Thr Gly Lys Phe Gln Ser 1090 1095 1100 Lys Ala Ala Asn His Lys Ala Leu Ala Thr Gly Asn Glu Thr Val Ala 1105 1110 1115 1120 Lys Gly Asn Pro Thr Ser Thr Thr Gln Lys Lys Leu Pro Tyr Thr Gly 1125 1130 1135 Val Ala Ser Asn Leu Val Leu Glu Ile Met Gly Leu Leu Gly Leu Ile 1140 1145 1150 Gly Thr Ser Phe Ile Ala Met Lys Arg Arg Lys Ser 1155 1160 (2) INFORMATION FOR SEQ ID NO : 11 : (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 106 amino acids (B) TYPE: amino acid (C) STRANDEDNESS : single (D) TOPOLOGY: not relevant (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 11 : Leu Leu His Ile Lys Gln His Glu Glu Val Glu Lys Asp Lys Lys Ala 1 5 10 15 Lys Gln Gln Lys Thr Leu Lys Gln Ser Asp Thr Lys Val Asp Leu Ser 20 25 30 Asn Ile Asp Lys Glu Leu Asn His Gln Lys Ser Gln Val Glu Lys Met 35 40 45 Ala Glu Gln Lys Gly Ile Thr Asn Glu Asp Lys Asp Ser Met Leu Lys 50 55 60 Lys Ile Glu Asp Ile Arg Lys Gln Ala Gln Gln Ala Asp Lys Lys Glu 65 70 75 80 Asp Ala Glu Val Lys Val Arg Glu Glu Leu Gly Lys Leu Phe Ser Ser 85 90 95 Thr Lys Ala Gly Leu Asp Gln Glu Ile Gln 100 105 (2) INFORMATION FOR SEQ ID NO : 12: (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 147 amino acids (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: not relevant (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 12: Asp Ser Asp Ala Leu Leu Glu Leu Glu Asn Gln Phe Asn Glu Thr Asn 1 5 10 15 Arg Leu Leu His Ile Lys Gln His Glu Glu Val Glu Lys Asp Lys Lys 20 25 30 Ala Lys Gln Gln Lys Thr Leu Lys Gln Ser Asp Thr Lys Val Asp Leu 35 40 45 Ser Asn Ile Asp Lys Glu Leu Asn His Gln Lys Ser Gln Val Glu Lys 50 55 60 Met Ala Glu Gln Lys Gly Ile Thr Asn Glu Asp Lys Asp Ser Met Leu 65 70 75 80 Lys Lys Ile Glu Asp Ile Arg Lys Gln Ala Gln Gln Ala Asp Lys Lys 85 90 95 Glu Asp Ala Glu Val Lys Val Arg Glu Glu Leu Gly Lys Leu Phe Ser 100 105 110 Ser Thr Lys Ala Gly Leu Asp Gln Glu Ile Gln Glu His Val Lys Lys 115 120 125 Glu Thr Ser Ser Glu Glu Asn Thr Gln Lys Val Asp Glu His Tyr Ala 130 135 140 Asn Ser Leu 145 (2) INFORMATION FOR SEQ ID NO : 13: (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 147 amino acids (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: not relevant (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 13: Asp Ser Asp Ala Leu Leu Glu Leu Glu Asn Gln Phe Asn Glu Thr Asn 1 5 10 15 Arg Leu Leu His Ile Lys Gln His Glu Glu Val Glu Lys Asp Lys Lys 20 25 30 Ala Lys Gln Gln Lys Thr Leu Lys Gln Ser Asp Thr Lys Val Asp Leu 35 40 45 Ser Asn Ile Asp Lys Glu Leu Asn His Gln Lys Ser Gln Val Glu Lys 50 55 60 Met Ala Glu Gln Lys Gly Ile Thr Asn Glu Asp Lys Asp Ser Met Leu 65 70 75 80 Lys Lys Ile Glu Asp Ile Arg Lys Gln Ala Gln Gln Ala Asp Lys Lys 85 90 95 Glu Asp Ala Glu Val Lys Val Arg Glu Glu Leu Gly Lys Leu Phe Ser 100 105 110 Ser Thr Lys Ala Gly Leu Asp Gln Glu Ile Gln Glu His Val Lys Lys 115 120 125 Glu Thr Ser Ser Glu Glu Asn Thr Gln Lys Val Asp Glu His Tyr Ala 130 135 140 Asn Ser Leu 145 (2) INFORMATION FOR SEQ ID NO : 14: (i) SEQUENCE CHARACTERISTICS : (A) LENGTH: 111 amino acids (B) TYPE: amino acid (C) STRANDEDNESS : single (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 14: Val Asp Leu Ser Asn Ile Asp Lys Glu Leu Asn His Gln Lys Ser Gln 1 5 10 15 Val Glu Lys Met Ala Glu Gln Lys Gly Ile Thr Asn Glu Asp Lys Asp 20 25 30 Ser Met Leu Lys Lys Ile Glu Asp Ile Arg Lys Gln Ala Gln Gln Ala 35 40 45 Asp Lys Lys Glu Asp Ala Glu Val Lys Val Arg Glu Glu Leu Gly Lys 50 55 60 Leu Phe Ser Ser Thr Lys Ala Gly Leu Asp Gln Glu Ile Gln Glu His 65 70 75 80 Val Lys Lys Glu Thr Ser Ser Glu Glu Asn Thr Gln Lys Val Asp Glu 85 90 95 His Tyr Ala Asn Ser Leu Gln Asn Leu Ala Gln Lys Ser Leu Glu 100 105 110 (2) INFORMATION FOR SEQ ID NO : 15: (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 111 amino acids (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: not relevant (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 15: Val Asp Leu Ser Asn Ile Asp Lys Glu Leu Asn His Gln Lys Ser Gln 1 5 10 15 Val Glu Lys Met Ala Glu Gln Lys Gly Ile Thr Asn Glu Asp Lys Asp 20 25 30 Ser Met Leu Lys Lys Ile Glu Asp Ile Arg Lys Gln Ala Gln Gln Ala 35 40 45 Asp Lys Lys Glu Asp Ala Glu Val Lys Val Arg Glu Glu Leu Gly Lys 50 55 60 Leu Phe Ser Ser Thr Lys Ala Gly Leu Asp Gln Glu Ile Gln Glu His 65 70 75 80 Val Lys Lys Glu Thr Ser Ser Glu Glu Asn Thr Gln Lys Val Asp Glu 85 90 95 His Tyr Ala Asn Ser Leu Gln Asn Leu Ala Gln Lys Ser Leu Glu 100 105 110 (2) INFORMATION FOR SEQ ID NO : 16: (i) SEQUENCE CHARACTERISTICS : (A) LENGTH: 120 amino acids (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: not relevant (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 16: Val Asp Leu Ser Asn Ile Asp Lys Glu Leu Asn His Gln Lys Ser Gln 1 5 10 15 Val Glu Lys Met Ala Glu Gln Lys Gly Ile Thr Asn Glu Asp Lys Asp 20 25 30 Ser Met Leu Lys Lys Ile Glu Asp Ile Arg Lys Gln Ala Gln Gln Ala 35 40 45 Asp Lys Lys Glu Asp Ala Glu Val Lys Val Arg Glu Glu Leu Gly Lys 50 55 60' Leu Phe Ser Ser Thr Lys Ala Gly Leu Asp Gln Glu Ile Gln Glu His 65 70 75 80 Val Lys Lys Glu Thr Ser Ser Glu Glu Asn Thr Gln Lys Val Asp Glu 85 90 95 His Tyr Ala Asn Ser Leu Gln Asn Leu Ala Gln Lys Ser Leu Glu Glu 100 105 110 Leu Asp Lys Ala Thr Thr Asn Glu 115 120 (2) INFORMATION FOR SEQ ID NO : 17: (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 120 amino acids (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: not relevant (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 17: Val Asp Leu Ser Asn Ile Asp Lys Glu Leu Asn His Gln Lys Ser Gln 1 5 10 15 Val Glu Lys Met Ala Glu Gln Lys Gly Ile Thr Asn Glu Asp Lys Asp 20 25 30 Ser Met Leu Lys Lys Ile Glu Asp Ile Arg Lys Gln Ala Gln Gln Ala 35 40 45 Asp Lys Lys Glu Asp Ala Glu Val Lys Val Arg Glu Glu Leu Gly Lys 50 55 60 Leu Phe Ser Ser Thr Lys Ala Gly Leu Asp Gln Glu Ile Gln Glu His 65 70 75 80 Val Lys Lys Glu Thr Ser Ser Glu Glu Asn Thr Gln Lys Val Asp Glu 85 90 95 His Tyr Ala Asn Ser Leu Gln Asn Leu Ala Gln Lys Ser Leu Glu Glu 100 105 110 Leu Asp Lys Ala Thr Thr Asn Glu 115 120 (2) INFORMATION FOR SEQ ID NO : 18: (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 58 amino acids (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: not relevant (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 18: Val Asp Leu Ser Asn Ile Asp Lys Glu Leu Asn His Gln Lys Ser Gln 1 5 10 15 Val Glu Lys Met Ala Glu Gln Lys Gly Ile Thr Asn Glu Asp Lys Asp 20 25 30 Ser Met Leu Lys Lys Ile Glu Asp Ile Arg Lys Gln Ala Gln Gln Ala 35 40 45 Asp Lys Lys Glu Asp Ala Glu Val Lys Val 50 55 (2) INFORMATION FOR SEQ ID NO : 19 : (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 58 amino acids (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: not relevant (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 19 : Val Asp Leu Ser Asn Ile Asp Lys Glu Leu Asn His Gln Lys Ser Gln 1 5 10 15 Val Glu Lys Met Ala Glu Gln Lys Gly Ile Thr Asn Glu Asp Lys Asp 20 25 30 Ser Met Leu Lys Lys Ile Glu Asp Ile Arg Lys Gln Ala Gln Gln Ala 35 40 45 Asp Lys Lys Glu Asp Ala Glu Val Lys Val 50 55 (2) INFORMATION FOR SEQ ID NO : 20: (i) SEQUENCE CHARACTERISTICS : (A) LENGTH: 102 amino acids (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: not relevant (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 20: Val Asp Leu Ser Asn Ile Asp Lys Glu Leu Asn His Gln Lys Ser Gln 1 5 10 15 Val Glu Lys Met Ala Glu Gln Lys Gly Ile Thr Asn Glu Asp Lys Asp 20 25 30 Ser Met Leu Lys Lys Ile Glu Asp Ile Arg Lys Gln Ala Gln Gln Ala 35 40 45 Asp Lys Lys Glu Asp Ala Glu Val Lys Val Arg Glu Glu Leu Gly Lys 50 55 60 Leu Phe Ser Ser Thr Lys Ala Gly Leu Asp Gln Glu Ile Gln Glu His 65 70 75 80 Val Lys Lys Glu Thr Ser Ser Glu Glu Asn Thr Gln Lys Val Asp Glu 85 90 95 His Tyr Ala Asn Ser Leu 100 (2) INFORMATION FOR SEQ ID NO : 21: (i) SEQUENCE CHARACTERISTICS : (A) LENGTH: 78 amino acids (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: not relevant (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 21: Val Asp Leu Ser Asn Ile Asp Lys Glu Leu Asn His Gln Lys Ser Pro 1 5 10 15 Val Glu Lys Met Ala Glu Pro Lys Gly Ile Thr Asn Glu Asp Lys Asp 20 25 30 Ser Met Leu Lys Lys Ile Glu Asp Ile Arg Lys Gln Ala Gln Gln Ala 35 40 45 Asp Lys Lys Glu Asp Ala Glu Val Lys Val Arg Glu Glu Leu Gly Lys 50 55 60 Leu Phe Ser Ser Thr Lys Ala Gly Leu Asp Gln Glu Ile Gln 65 70 75 (2) INFORMATION FOR SEQ ID NO : 22: (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 78 amino acids (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: not relevant (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 22: Val Asp Leu Ser Asn Ile Asp Lys Glu Leu Asn His Gln Lys Ser Gln 1 5 10 15 Val Glu Ala Met Ala Glu Gln Ala Gly Ile Thr Asn Glu Asp Lys Asp 20 25 30 Ser Met Leu Lys Lys Ile Glu Asp Ile Arg Lys Gln Ala Gln Gln Ala 35 40 45 Asp Lys Lys Glu Asp Ala Glu Val Lys Val Arg Glu Glu Leu Gly Lys 50 55 60 Leu Phe Ser Ser Thr Lys Ala Gly Leu Asp Gln Glu Ile Gln 65 70 75 (2) INFORMATION FOR SEQ ID NO : 23: (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 72 amino acids (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: not relevant (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 23: Val Asp Leu Ser Asn Ile Asp Lys Glu Leu Asn His Gln Lys Ser Gln 1 5 10 15 Glu Ala Gly Ile Thr Asn Glu Asp Lys Asp Ser Met Leu Lys Lys Ile 20 25 30 Glu Asp Ile Arg Lys Gln Ala Gln Gln Ala Asp Lys Lys Glu Asp Ala 35 40 45 Glu Val Lys Val Arg Glu Glu Leu Gly Lys Leu Phe Ser Ser Thr Lys 50 55 60 Ala Gly Leu Asp Gln Glu Ile Gln 65 70 (2) INFORMATION FOR SEQ ID NO : 24: (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 78 amino acids (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: not relevant (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 24: Val Asp Leu Ser Asn Ile Asp Lys Glu Leu Asn His Gln Lys Ser Gln 1 5 10 15 Val Glu Thr Met Ala Glu Gln Leu Gly Ile Thr Asn Glu Asp Lys Asp 20 25 30 Ser Met Leu Lys Lys Ile Glu Asp Ile Arg Lys Gln Ala Gln Gln Ala 35 40 45 Asp Lys Lys Glu Asp Ala Glu Val Lys Val Arg Glu Glu Leu Gly Lys 50 55 60 Leu Phe Ser Ser Thr Lys Ala Gly Leu Asp Gln Glu Ile Gln 65 70 75 (2) INFORMATION FOR SEQ ID NO : 25: (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 9 amino acids (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: not relevant (ii) MOLECULE TYPE: peptide (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 25: Glu Leu Ile Lys Ser Ala Gln Gln Glu 1 5 (2) INFORMATION FOR SEQ ID NO : 26: (i) SEQUENCE CHARACTERISTICS : (A) LENGTH: 40 base pairs (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE: cDNA (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 26: GTTGAAGCAA TGGCAGAGCA AGCGGGAATC ACAAATGAAG 40 (2) INFORMATION FOR SEQ ID NO : 27: (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 42 base pairs (B) TYPE: nucleic acid (C) STRANDEDNESS : single (D) TOPOLOGY: not relevant (ii) MOLECULE TYPE: cDNA (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 27: GATTCCCGCT TGCTCTGCCA TTGCTTCAAC TTGACTTTTT TG 42 (2) INFORMATION FOR SEQ ID NO : 28: (i) SEQUENCE-CHARACTERISTICS : (A) LENGTH: 30 base pairs (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: not relevant (ii) MOLECULE TYPE: cDNA (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 28: AAGGATCCAA GTGAGCTTGT AAAGGACGAT 30 (2) INFORMATION FOR SEQ ID NO : 29: (i) SEQUENCE CHARACTERISTICS : (A) LENGTH: 32 base pairs (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: not relevant (ii) MOLECULE TYPE: cDNA (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 29: AAAACTCGAG TTTCTTTTCC GTTGTTGATG TA 32 (2) INFORMATION FOR SEQ ID NO : 30: (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 14 amino acids (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE: cDNA (xi) SEQUENCE DESCRIPTION: SEQ ID NO : 30: His Gln Lys Ser Gln Val Glu Lys Met Ala Glu Gln Lys Gly 1 5 10