AND METHODS OF USE

FIELD

The application relates to the field of molecular biology, in particular to anti-CRISPR genes and anti-CRISPR proteins, and methods of use in various biotechnology applications.

BACKGROUND

Bacteriophage-host dynamics are a clear example of an evolutionary arms race (Labrie et al. 2010; Samson et al. 2013) in which each bacterial defense mechanism, such as restriction enzymes, might be countered in turn by a phage mechanism, such as phage T4's heavily modified DNA. A ponounced biotechnological interest arose in finding proteins specifically inhibiting bacterial CRISPR-Cas immune systems, which could then serve to modulate the activity of the CRISPR-derived genome-editing tools (such as SpCas9) in vivo and limit off-target activity. However, given the relative ease of bypassing the CRISPR-Cas system - a single point mutation in a targeted region is sufficient (Barangou et al. 2007) - it wasn't clear whether such a system would even exist.

This doubt was laid to rest with the discovery of four anti-CRISPR (ACR) genes in Pseudomonas temperate phages, with activity against the type l-F system (Bondy-Denomy et al. 2013). Type I systems are distantly related to type II systems (Makarova et al. 2015; Makarova et al. 2017), such as the type ll-A system of Streptococcus pyogenes (source of the genome-editing tool SpCas9) (Jinek et al. 2012). The targets of these four ACRs are distinct (Bondy-Denomy et al. 2015), and subsequent work on two of these proteins (Maxwell et al. 2016; Chowdhury et al. 2017) revealed that the mechanisms of action span from interacting directly with the targeting RNA, to mimicking DNA in order to bind to the cleavage complex's active site. While these ACRs shared little similarity to known sequences, bioinformatic searches in similar gene neighborhoods assisted by an association with helix- turn-helix (HTH) motifs enabled the discovery ACRs with activity against type l-E (Pawluk et al. 2014), both type l-E and type l-F (Pawluk et al. 2016a), and subsequently against type II- C (Pawluk et al. 2016b). Most recently, this bioinformatic approach identified ACRs in prophages of Listeria strains whose native type ll-A systems appeared to target their own genomes (Rauch et al. 2017). In the case of two of these, a moderate activity against SpCas9 could be demonstrated. Although several ACRs have recently been discovered, there is still a need to discover additional ACRs not only having a broad spectrum of action in terms of bacterial species but also being highly effective against CRISPR-Cas systems to be targeted. BRIEF SUMMARY

In one embodiment, the present disclosure provides proteins (anti-CRISPR proteins) interfering with a function of a CRISPR-Cas system from a bacterial strain, as well as genes encoding these proteins (anti-CRISPR genes), contructs and vector comprising these genes.

Also provided are bacterial strains as well as phages comprising these anti-CRISPR genes and expressing said anti-CRISPR proteins.

In another embodiment, methods to downmodulate, in a bacterial strain, the activity of a CRISPR-Cas system against target nucleic acids - based on expressing in said bacterial strain a gene (anti-CRISPR gene) encoding a protein which interferes with a function of a CRISPR-Cas system or based on introducing in said bacterial strain a protein (anti-CRISPR protein) which interferes with a function of a CRISPR-Cas system against target nucleic acids - are provided

In still a further embodiment, methods - based on expressing anti-CRISPR genes - to downmodulate, in a bacterial strain, the CRISPR-Cas-mediated immunity against a given target nucleic acid are provided

In another embodiment, the invention also discloses methods - based on expressing anti-CRISPR genes - to decrease the CRISPR-mediated instability of a plasmid in a bacterial strain.

Also provided herein are methods - based on expressing anti-CRISPR genes - to increase the efficiency of gene transfer methods in a bacterial strain.

In another embodiment, the invention also discloses methods - based on expressing anti-CRISPR genes - to favor the screening of a bacterial mechanism providing resistance against a virulent phage other than a given CRISPR-Cas mediated resistance.

Methods - based on expressing anti-CRISPR genes - to enrich a bacterial population in bacteriophage-insensitive mutants (BIMs) other than BIMs due to a given CRISPR-Cas system, are also disclosed.

Also provided herein are methods to identify a gene (anti-CRISPR gene) encoding a protein (anti-CRISPR protein), which interferes with the interference function of a given CRISPR-Cas system.

Another embodiment provided herein are methods - based on modulating the expression of anti-CRISPR genes - to induce the death of a bacterial population BRIEF DESCRIPTION OF THE DRAWINGS

Figure 1 provides one embodiment of a schematic for the discovery of virulent phages impeding CRISPR-based immunity. (Top) When a virulent phage is used to challenge a bacterium, phage-resistant survivors might be isolated. Six virulent phages infecting Streptococcus thermophilus DGCC7854 generated differing frequencies of CRISPR-immune survivors. (Bottom) When comparing these same phages plated on the phage-sensitive wild- type strain DGCC7854 and a CRISPR-immunized mutant targeting a sequence conserved in all six phages, a large reduction in phage titer was expected. Phages D4276 and D181 1 suffered a much smaller reduction in titer than the other four related phages. Phage names and associated data are divided according to CRISPR-interacting phenotypes; permissive (white), impeded adaptation (fractal pattern), and restrictive (black).

Figure 2 provides a representative anti-CRISPR activity of the Acr protein (SEQ ID NO: 10) in Streptococcus thermophilus. (A) Genes cloned from the CRISPR restrictive (black capsid) phage D4276 were expressed in the DGCC7854-derived immunized strain, and the resulting transformants were assayed for increased sensitivity to the permissive (white capsid) phage D5842. (B) Titer of the restrictive (black) cos-type phage D4276 and permissive (white) cos-type phage D5842 on the naive DGCC7854 or its CR1 -immune derivative, carrying either the empty vector pNZ123 or the vector expressing the acr gene (SEQ ID NO:9) (pNZAcr). Each column depicts the average of three biological replicates, each of three technical replicates. (C) Titer of the permissive (white) pac-type phage 2972 on the naive DGCC7710, a CRISPRI -immune mutant or a CRISPR3-immune mutant carrying either the empty vector pNZ123 or the vector expressing the acr gene (pNZAcr). Each column depicts the average of three biological replicates, each of three technical replicates. In (B) and (C), error bars represent the standard deviation, and an asterisk denotes a difference (p<0.001 ) from all other data, while no other strain differed from any other (p>0.5) as determined by one-way ANOVA and Tukey HSD test. (D) Number and characterization of survivors following a phage 2972 challenge of DGCC7710, carrying either the empty vector pNZ123 or the vector expressing the acr gene (pNZAcr). The single CRISPR1 acquisition detected in the presence of the anti-CRISPR targeted the plasmid and not the phage. CRISPR3 acquisitions targeted the phage, as expected. All cells maintained an intact acr gene.

Figure 3 provides schematic representation of one example of anti-CRISPR activity against SpCas9 (A) Generating an immunized Lactococcus lactis MG1363 strain. pL2Cas9 (24) contains the SpCas9 module from pCas9 (23) on a pTRKL2 (30) vector backbone. A spacer targeting orf44 of L. lactis virulent phage p2 was cloned-in to create a phage-targeting SpCas9. (B) The titer of virulent phage p2 on its host L. lactis MG1363 carrying either pL2Cas9 or pL2Cas9 targeting the phage (pL2Cas9-44), and either the empty vector pNZ123 or the vector expressing the acr gene (pNZAcr). The titer was assayed by spot test, and each bar represents an average of three biological replicates, each of three technical replicates. Only plaques with typical morphology were counted, although a secondary morphology of tiny plaques occasionally appeared when plated on pL2Cas9-44 with pNZ123. While these plaques were not reliably countable, the maximum threshold at which they appeared is depicted by a patterned box. Error bars represent the standard deviation, and an asterisk denotes a difference (p<0.001 ) from all other data, while no other strain differed from any other (p>0.5) as determined by one-way ANOVA and Tukey HSD test.

Figure 4 provides a representative anti-CRISPR activity of the Acr2 protein (SEQ ID NO:28) in Streptococcus thermophilus. (A) Titer of the restrictive (black) cos-type phage D181 1 and permissive (white) cos-type phage D5842 on the naive DGCC7854 or its CR1 - immune derivative, carrying either the empty vector pNZ123 or the vector expressing the acr2 gene (SEQ ID NO:27) (pNZAcr). Each column depicts the average of three biological replicates, each of three technical replicates. (B) Titer of the permissive (white) pac-type phage 2972 on the naive DGCC7710, a CRISPR1 -immune mutant or a CRISPR3-immune mutant carrying either the empty vector pNZ123 or the vector expressing the acr2 gene (pNZAcr). Each column depicts the average of three biological replicates, each of three technical replicates. In (A) and (B), error bars represent the standard deviation, and an asterisk denotes a difference (p<0.001 ) from all other data, while no other strain differed from any other (p>0.5) as determined by one-way ANOVA and Tukey HSD test. SEQUENCES

A sequence listing encompassing 552 sequences is electronically submitted together with this application. Some of these anti-CRISPR gene sequences and anti-CRISPR protein sequences are also disclosed below:

SEQID NO:l / anti-CRISPR gene isolated from bacteriophage O1205

ATGGCATACGGAAAAAGCAGATACAACTCATATAGGAAACGCAGTTTCAATAGAAGCGAT AAGCAACGTAGAGAATAC GCACAAGAAATGGATAGATTAGAACAAACATTTGAAAAACTTGATGGTTGGTATCTATCT AGCATGAAAGATAGTGCGT ATAAAGATTTCGGAAAATACGAAATTCGCTTATCAAATCATTCAGCAGACAACAAATATC ATGACCTAGAAAATGGTCGT TTAATTGTTAATGTCAAAGCAAGTAAATTGAAATTCGTTGATATCAAATGTTACTATAAG GGATTTAAGACAAAGAAGGA TGTAATCTAA

SEQID NO:2 / anti-CRISPR protein encoded by SEQ ID NO:l MAYGKSRYNSYRKRSFNRSDKQRREYAQEMDRLEQTFEKLDGWYLSSMKDSAYKDFGKYE IRLSNHSADNKYHDLENGRLIV NVKASKLKFVDIKCYYKGFKTKKDVI

SEQID N0:3 / anti-CRISPR gene isolated from Bacteriophage Sfi21

ATGGCATACGGAAAAAGTAGATATAACTCATATAGAAAGCGCAGTTTTAACAGAAGT AATAAGCAACGTAGAGAATACG CACAAGAAATGGATAGATTAGAGAAAGCTTTCGAAAATCTTGACGGATGGTATCTATCTA GCATGAAAGATAGTGCGTA CAAAGATTTCGGAAAATACGAAATTCGCTTATCAAATCATTCAGCAGACAACAAATATCA TGACCTAGAAAATGGTCGTT TAATTGTTAATGTCAAAGCAAGTAAATTGAACTTCGTTGATATCATCGAGAACAAACTTG ATAAAATCATTGAGAAGATT GATACTCTTGATTTAGATAAGTACAGATTCATTAATGCTACTAAATTGGAACGTGATATC AAATGCTACTATAAAGGCTAT AAGACAAAGAAGGATGTAATCTAA

SEQID NO:4 / anti-CRISPR protein encoded by SEQ ID NO:3

MAYGKSRYNSYRKRSFNRSNKQRREYAQEMDRLEKAFENLDGWYLSSMKDSAYKDFGKYE IRLSNHSADNKYHDLENGRLIV NVKASKLNFVDIIENKLDKIIEKIDTLDLDKYRFINATKLERDIKCYYKGYKTKKDVI

SEQID NO:5 / anti-CRISPR gene isolated from Bacteriophage TP-778L

ATGGCATACGGAAAAAGCAGATACAACTCATATAGAAAACGTAGTTTCAACATAAGTGAC ACAAAGCGTAGGGAATATG CAAAAGAAATGGAGAAATTAGAACAAGCATTTGAAAAGCTAGATGGTTGGTATCTATCTA GCATGAAGGATAGTGCATA CAAGGATTTTGGAAAATACGAAATCCGCTTATCAAATCATTCAGCAGACAATAAATATCA TGACCTAGAAAATGGTCGTT TAATTGTTAATGTTAAAGCAAGTAAATTGAACTTCGTTGATATCATCGAAAACAAACTTG ATAAAATCATCGAGAAGATT GATAAGCTTGATTTAGATAAGTACAGATTTATTAACGCTACTAGAATGGAGCATGACATT AAATGCTACTATAAAGGATT TAAGACAAAGAAAGATGTAATCTAA

SEQID NO:6 / anti-CRISPR protein encoded by SEQ ID NO:5

MAYGKSRYNSYRKRSFNISDTKRREYAKEMEKLEQAFEKLDGWYLSSMKDSAYKDFG KYEIRLSNHSADNKYHDLENGRLIVN VKASKLNFVDIIENKLDKIIEKIDKLDLDKYRFINATRMEHDIKCYYKGFKTKKDVI

SEQID NO:7 / anti-CRISPR gene isolated from the genome of Streptococcus sp. HMSC072D07

ATGGCATTTGGCAAGAACAGATACAATCCATACAGGAAACGTAGTTTTAATCGTAGT GATAAACAATGTCGAGAGTATG CTCAGGCAATGGACGAACTAGAACAAGCCTTTGAGGAACTTGATGGATGGCACTTATCTA GTATGATGGATAGTGCTTAT AAGAATTTTGAAAAGTACCAGGTTCGCCTATCAAATCATTCAGCAGACAACCAATATCAT GACTTAGAAAATGGTTACTT GATTGTCAATGTTAAAGCAAGTAAATTGAACTTTGTCGATATTATCGAAAATAAATTGGA TAAGATTTTAGAGAAAGTAG ACAAGCTTGATCTTGATAAGTATAGGTTTATCAATGCGACCAATCTGGAACATGATATTA AATGTTATCTCAAAGGCTATA AGACGAAAAAAGACGTGATTTAA

SEQID NO:8 / anti-CRISPR protein encoded by SEQ ID NO: 7

MAFGKNRYNPYRKRSFNRSDKQCREYAQAMDELEQAFEELDGWHLSSMMDSAYKNFEKYQ VRLSNHSADNQYHDLENGY LIVNVKASKLNFVDIIENKLDKILEKVDKLDLDKYRFINATNLEHDIKCYLKGYKTKKDV I SEQID NO:9 / anti-CRISPR gene isolated from Bacteriophage D4276

ATGGCATACGGAAAAAGTAGATATAACTCATATAGAAAGCGCAGTTTTAACAGAAGTAAT AAGCAACGTAGAGAATACG CACAAG AAATGG ATAG ATTAG AG AAAG CTTTCG AAAATCTTG ACG G ATG GTATCTATCTAG CATG AAAG AC AGTG CTTA CAAGGATTTTGGGAAATACGAAATTCGCTTATCAAATCATTCGGCAGACAACAAATATCA CGACTTAGAAAACGGTCGTT TAATTGTTAATATTAAAGCTAGTAAATTGAATTTCGTTGATATCATCGAGAATAAGCTTG ATAAAATAATCGAGAAGATTG ATAAGCTTGATTTAGATAAGTACCGATTCATCAATGCGACCAACCTAGAGCATGATATCA AATGCTATTACAAGGGGTTT AAAACGAAAAAGGAGGTAATCTAA

SEQID NO:10 / anti-CRISPR protein encoded by SEQ ID NO:9

MAYGKSRYNSYRKRSFNRSNKQRREYAQEMDRLEKAFENLDGWYLSSMKDSAYKDFGKYE IRLSNHSADNKYHDLENGRLIV NIKASKLNFVDIIENKLDKIIEKIDKLDLDKYRFINATNLEHDIKCYYKGFKTKKEVI

SEQID NO:ll / anti-CRISPR gene isolated from Bacteriophage D1126

ATGGCATACGGAAAAAGCAGATACAATTCATATAGGAAGCGAAACTTCTCTATAAGCGAC AATCAGCGTAGGGAATATG CTAAAAAAATGAAGGAGTTAGAACAAGCGTTTGAAAACCTTGACGGATGGTATCTATCTA GCATGAAAGATAGTGCGTA CAAAGATTTCGGAAAATACGAAATTCGCTTATCAAATCATTCAGCAGACAATAGATATCA TGACCTAGAAAATGGTCGCT TAATCGTTAATGTTAAAGCTAGTAAATTGAACTTCGTTGATATCATCGAGAATAAACTTG GTAAAATCATTGAGAAGATT GATACTCTTGATTTAGATAAGTACAGATTCATTAATGCTACTAAATTGGAACGTGATATC AAATGCTACTATAAAGGCTAT AAG AC AAAG AAG G ATGTAATCTAA SEQID N0:12 / anti-CRISPR protein encoded by SEQ ID NO:ll

MAYGKSRYNSYRKRNFSISDNQRREYAKKMKELEQAFENLDGWYLSSMKDSAYKDFGKYE IRLSNHSADNRYHDLENGRLIV NVKASKLNFVDIIENKLGKIIEKIDTLDLDKYRFINATKLERDIKCYYKGYKTKKDVI

SEQID NO:13 / anti-CRISPR gene isolated from Bacteriophage D4250

ATGGCATACGGAAAAAGTAGATATAACTCATATAGAAAACGCAGTTTCAACAGAAGC GATAAACAGCGTAGAGAATACG CACAAGCAATGGAAGAATTAGAGCAAGCATTTGAAAACTTTGATGATTGGTATCTATCAA GCATGAAAGACAGTGCTTA CAAGGATTTTGGGAAATACGAAATTCGCTTATCAAATCATTCGGCAGACAACAAATATCA CGACTTAGAAAACGGTCGTT TAATTGTTAATATTAAAGCTAGTAAATTGAATTTCGTTGATATCATCGAGAATAAGCTTG ATAAAATAATCGAGAAGATTG ATAAGCTTGATTTAGATAAGTACCGATTCATCAATGCGACCAACCTAGAGCATGATATCA AATGCTATTACAAGGGGTTT AAAACGAAAAAGGAGGTAATCTAA

SEQID NO:14 / anti-CRISPR protein encoded by SEQ ID NO:13

MAYGKSRYNSYRKRSFNRSDKQRREYAQAMEELEQAFENFDDWYLSSMKDSAYKDFGKYE IRLSNHSADNKYHDLENGRLIV NIKASKLNFVDIIENKLDKIIEKIDKLDLDKYRFINATNLEHDIKCYYKGFKTKKEVI

SEQID NO:15 / anti-CRISPR gene isolated from Bacteriophage D4252

ATGGCATACGGAAAAAGCAGATACAACTCATATAGAAAGCGCAGTTTTAACAGAAGTGAT AAGCAACGTAGAGAATAC GCTAAAAAAATGAAGGAGTTAGAACAAGCGTTTGAAAACCTTGATGGTTGGTATCTATCG AGCATGAATGACAGTGCTT ATAAAAATTTTGGCAAATATGAAGTTCGATTGTCAAATCATTCGGCAGATAATAAATATC ACGACATAGAAAACGGTCGT TTAATTGTTAATGTTAAAGCTAGTAAATTGAATTTCGTTGATATCATCGAGAACAAGCTT GATAAAATAATCGAGAAGATT GATAAGCTTGATTTAGATAAGTACCGATTCATCAACGCTACCAATCTAGAGCATAATATT AAATGCTATTACAAGGGATTT AAGACAAAGAAGGATGTAATATAA

SEQID NO:16 / anti-CRISPR protein encoded by SEQ ID NO:15

MAYGKSRYNSYRKRSFNRSDKQRREYAKKMKELEQAFENLDGWYLSSMNDSAYKNFG KYEVRLSNHSADNKYHDIENGRLI VNVKASKLNFVDIIENKLDKIIEKIDKLDLDKYRFINATNLEHNIKCYYKGFKTKKDVI

SEQID NO:17 / anti-CRISPR gene isolated from Bacteriophage D4598

ATGGCATACGGAAAAAGTAGATATAACTCATATAGAAAACGCAGTTTCAACAGAAGCGAT AAACAGCGTGGAGAATAC GCACAAGCAATGGAAGAATTAGAGCAAGCATTTGAAAACTTTGATGATTGGTATCTATCA AGCATGAAAGACAGTGCTT ACAAGGATTTTGGGAAATACGAAATTCGCTTATCAAATCATTCGGCAGACAATAAATATC ATGACCTAGAAAATGGTCGC TTAATCGTTAATGTTAAAGCTAGTAAATTGAACTTCGTCGATATCATCGAGAATAAAATC GATAAAATCATTGAGAAGATT GATAAGCTTGATTTAGATAAGTACCGATTCATCAACGCTACCAACCTAGAGCATGATATC AAATGTTATTACAAGGGATTT AAGACAAAAAAGGATGTAATCTAA

SEQID NO:18 / anti-CRISPR protein encoded by SEQ ID NO:17

MAYGKSRYNSYRKRSFNRSDKQRGEYAQAMEELEQAFENFDDWYLSSMKDSAYKDFGKYE IRLSNHSADNKYHDLENGRLIV NVKASKLNFVDIIENKIDKIIEKIDKLDLDKYRFINATNLEHDIKCYYKGFKTKKDVI SEQID NO:19 / anti-CRISPR gene isolated from the genome of a Streptococcus mutans strain

ATGGCATTTGGAAAAAGAAGATATAACTCGTATCGTAAACGCAGTTTTAATAGAAGTGAT AAGCAACGTCGAGAATATG CACAAGCAATGGAAGAACTTGAACAAACATTTGAAAATCTTGAAGGTTGGAATTTATCAA GCATGAAAGATAGTGCTTAT AAAGATTATGATAAATATGAAGTTCGACTTTCAAATCATTCAGCTGATAATCAATATCAT AACTTACAAGATGGTAAATTA ATCATCAATATCAAAGCTAGTAAAATGAATTTTGTTTGGATTATAGAAAATAAACTTGAT GCAATTCTTGAAAAAGTAAAT AAGTTAGACCTTAGCAAATACAGATTTATTAATGCTACAAGTTTAGATCATGATATCAAA TGTTATTACAAAAATTATAAA ACAAAGAAAGATGTAATTTAA

SEQID NO:20 / anti-CRISPR protein encoded by SEQ ID NO:19

MAFGKRRYNSYRKRSFNRSDKQRREYAQAMEELEQTFENLEGWNLSSMKDSAYKDYDKYE VRLSNHSADNQYHNLQDGKLI INIKASKMNFVWIIENKLDAILEKVNKLDLSKYRFINATSLDHDIKCYYKNYKTKKDVI SEQID NO:21 / anti-CRISPR gene isolated from the genome of a Streptococcus mutans strain ATGGCATTTGGAACAAGAAGATATAATTCATATCGTAAACGCAGTTTTAATAGAAGTGAT AAGCAACGTCGAGAATATG CACAAGCAATGGAAGAACTTGAACAAACATTTGAAAATCTTGAAGATTGGAATTTGTCGA GCATGAAAGATAGTGCTTA TAAAGATTATGATAAATATGAAGTTCGACTTTCAAATCATTCAGCTGATAATCAATATCA TAACTTACAAGATGGTAAATT AATCATCAATATCAAAGCTAGTAAAATGAATTTTGTTTGGATTATAGAAAATAAACTTGA TGCAATTCTTGAAAAAGTAAA TAAGTTAGACCTTAGCAGATACAGATTTATTAATGCTACAAATTTAGAACATGATATCAA ATGTTATTACAAAAATTATAA AACAAAGAAAGATGTAATTTAA

SEQID NO:22 / anti-CRISPR protein encoded by SEQ ID NO:21

MAFGTRRYNSYRKRSFNRSDKQRREYAQAMEELEQTFENLEDWNLSSMKDSAYKDYD KYEVRLSNHSADNQYHNLQDGKLI INIKASKMNFVWIIENKLDAILEKVNKLDLSRYRFINATNLEHDIKCYYKNYKTKKDVI

SEQID NO:23 / anti-CRISPR gene isolated from the genome of a Streptococcus mutans strain

ATGGCATTTGGAACAAGAAGATATAATTCATATCGTAAACGCAGTTTTAATAGAAGT GATAAGCAACGTCGAGAATATG CACAAGCAATGGAAGAACTTGAACAAACATTTGAAAATCTTGAAGATTGGAATTTGTCGA GCATGAAAGATAGTGCTTA TAAAGATTATGATAAATATGAAGTTAGACTTTCAAATCATTCAGCTGATAATCAATATCA TAACTTACAAGATGGTAAATT AATCATCAATATCAAAGCTAGTAAAATGAATTTTGTTTGGATTATAGAAAATAAACTTGA TGTAATTCTTGAAAAAGTAAA TAAGTTAGACCTTAGCAAATACAGATTTATTAATGCTACAAGTTTAGATCATGATATCAA ATGTTATTACAAAAATTATAA AACAAAGAAAGATGTAATCTAA

SEQID NO:24 / anti-CRISPR protein encoded by SEQ ID NO:23

MAFGTRRYNSYRKRSFNRSDKQRREYAQAMEELEQTFENLEDWNLSSMKDSAYKDYDKYE VRLSNHSADNQYHNLQDGKLI INIKASKMNFVWIIENKLDVILEKVNKLDLSKYRFINATSLDHDIKCYYKNYKTKKDVI SEQID NO:25 / anti-CRISPR gene isolated from the genome of a Streptococcus mutans strain

ATGGCATTTGGAACAAGAAGATATAATTCATATCGTAAACGCAATTTTAATAGAAGTGAT AAACAACGTCGAGAATATGC ACAAGCAATGGAAGAACTTGAACAAACATTTGAAAATCTTGAAGATTGGAATTTGTCGAG CATGAAAGATAGTGCTTAT AAAGATTATGATAAATTTGAAGTTCGACTTTCAAATCATTCAGCTGATAATCAATATCAT AACTTACAAGATGGTAAATTA ATCATCAATATCAAAGCTAGTAAAATGAATTTTGTTTGGATTATAGAAAATAAACTTGAT GCAATTCTTGAAAAGGTAAAT AAGTTAGACCTTAGCAAATACAGATTTATTAATGCTACAAGTTTAGATCATGATATCAAA TGTTATTACAAAAATTATAAA ACAAAAAAAGATGTAATTTAA

SEQID NO:26 / anti-CRISPR protein encoded by SEQ ID NO:25

MAFGTRRYNSYRKRNFNRSDKQRREYAQAMEELEQTFENLEDWNLSSMKDSAYKDYDKFE VRLSNHSADNQYHNLQDGKL IINIKASKMNFVWIIENKLDAILEKVNKLDLSKYRFINATSLDHDIKCYYKNYKTKKDVI

SEQID NO:27 / anti-CRISPR gene isolated from Bacteriophage D1811

ATGAAAATAAATGACGACATCAAAGAGTTAATTTTAGAATATATGAGCCGTTACTTCAAA TTCGAGAACGACTTTTATAA ACTGCCAGGCATCAAGTTCACTGATGCAAATTGGCAGAAGTTCAAAAATGGAGGCACTGA CATTGAGAAGATGGGGGC GGCACGAGTAAACGCCATGCTCGACTGCCTATTCGACGATTTCGAGCTTGCTATGATTGG CAAGGCTCAAACTAATTATT ACAATGATAATTCACTAAAGATGAACATGCCATTTTACACTTACTATGACATGTTCAAAA AGCAGCAACTTCTAAAATGGC TTAAAAATAACCGTGATGATGTCATCGGCGGAACTGGTAGGATGTACACAGCAAGTGGTA ATTACATTGCTAACGCTTAT TTAGAGGTGGCATTAGAATCGAGCTCGCTTGGTAGTGGCTCTTACATGCTTCAAATGAGG TTTAAAGACTATTCAAAAGG TCAAGAACCTATTCCGTCAGGTCGTCAGAATCGACTTGAATGGATTGAAAACAATCTCGA AAACATTCGATAA

SEQID NO:28 / anti-CRISPR protein encoded by SEQ ID NO:27

MKINDDIKELILEYMSRYFKFENDFYKLPGIKFTDANWQKFKNGGTDIEKMGAARVNAML DCLFDDFELAMIGKAQTNYYND NSLKMNMPFYTYYDMFKKQQLLKWLKNNRDDVIGGTGRMYTASGNYIANAYLEVALESSS LGSGSYMLQMRFKDYSKGQE PIPSGRQNRLEWIENNLENIR

SEQID NO:29 / anti-CRISPR gene isolated from Bacteriophage D1024

ATGAAAATAAATGACGACATCAAAGAGTTAATTTTAGAATATATGAGCCGTTACTTCAAA TTCGAGAACGACTTTTATAA ACTGCCAGGCATCAAGTTCACTGATGCAAATTGGCAGAAGTTCAAAAATGGAGGCACTGA CATTGAGAAGATGGGGGC GGCACGAGTAAATGCCATGCTTTCCTGCCTATTCGAGGATTTTGAGCTTGCAATGATTGG CAAGGCTCAAACTAATTATT ACATTGATAACTCACTTAAATTGAACATGCCATTTTACGCTTACTATGACATGTTCAAAA AGCAACTTCTTATAAATTGGCT TAAAAATAACCGTGATGATGTCATCTGCGGAACTGGTAGGATGTACACAGCAAGTGGTAA TTACATTGCTAACGCTTATT TAGAGGTGGCATTAGAATCTAGCCGTCTGGGTGGTGGTGAGTACATGTTGCAAATGCGTT TTAAAAATTATTCAAGAAG TCAAGAACCTATTCCGTCTGGTCGTCAGAATCGACTTGAATGGATTGAAAACAATCTTGA AAACATTCGATAA

SEQID NO:30 / anti-CRISPR protein encoded by SEQ ID NO:29

MKINDDIKELILEYMSRYFKFENDFYKLPGIKFTDANWQKFKNGGTDIEKMGAARVNAML SCLFEDFELAMIGKAQTNYYIDN SLKLNMPFYAYYDMFKKQLLINWLKNNRDDVICGTGRMYTASGNYIANAYLEVALESSRL GGGEYMLQMRFKNYSRSQEPIP SGRQNRLEWIENNLENIR

SEQID NO:31 / anti-CRISPR gene isolated from Bacteriophage D4530

ATGAAAATCAATAATGACATCAAAGAGCTAATTTTGGAATATGTAAGTCGCTATTTTAAA TTTGAAAACGACTTCTACAAA TTGCCAGGCATCAAATTCACTGATGCAAATTGGCAAAAATTCAAGAATGGAGATACTTCC ATCGAGAAGATGGGGGCAG CACGAGTAAATGCCATGCTTGACTGCCTGTTCGAAGATTTTGAGCTTGCAATGATTGGCA AGGCTCAAACTAATTATTAC AATGATAATTCACTAAAGATGAACATGCCATTTTACACTTACTATGACATGTTCAAAAAG CAGCAACTTCTAAAATGGCTT AAAAATAACCGTGATGATGTCATCTGCGGAACTGGTAGGATGTACACAGCAAGTGGTAAT TACATTGCTAACGCTTATTT AGAAATTGCGTTAGAATCTAGCCGTCTGGGTAGTGGCTCTTACATGCTTCAAATGAGATT CAAAGACTATTCAAGAAGTC AAGAACCTATTCCGTCTGGTCGCCAAAATAGACTAGAATGGATTGAGAGCAACTTGGAAA ACATTCGATAA SEQID NO:32 / anti-CRISPR protein encoded by SEQ ID NO:31

MKINNDIKELILEYVSRYFKFENDFYKLPGIKFTDANWQKFKNGDTSIEKMGAARVNAML DCLFEDFELAMIGKAQTNYYNDN SLKMNMPFYTYYDMFKKQQLLKWLKNNRDDVICGTGRMYTASGNYIANAYLEIALESSRL GSGSYMLQMRFKDYSRSQEPIP SGRQNRLEWIESNLENIR SEQID NO:33 / anti-CRISPR gene isolated from Bacteriophage D2759

ATGAAAATCAATAATGACATCAAAGAGCTAATTTTGGAATATGTAAGTCGCTATTTTAAA TTTGAAAACGACTTCTACAAA TTGCCAGGCATCAAATTCACTGATGCAAATTGGCAAAAATTCAAGAATGGAGATACTTCC ATCGAGAAGATGGGGGCAG CACGAGTAAATGCCATGCTTGACTGCCTATTCGACGATTTTGAGCTTGCTTTGATTGGCA AGGCTCAAACTAATTATTACA TTGATAACTCACTTAAATTGAACATGCCATTTTACGCTTACTATGACATGTTCAAAAAGC AGCAACTTCTAAAATGGCTTA AAAATAACCGTGATGATGTCATCTGCGGAACTGGTAGGATGTACACAGCAAGTGGTAATT ACATTGCTAACTCTTATTTA GAGGTAGCGTTAGAATCTAGCCGTCTGGGTAGTGGCTCTTACATGCTTCAAATGAGATTC AAAGACTATTCAAGAAGTCA AGAACCTATTCCATCTGGTCGCCAAAATAGACTAGAATGGATTGAGAGCAACTTGGAAAA CATTCGATAA

SEQID NO:34 / anti-CRISPR protein encoded by SEQ ID NO:33

MKINNDIKELILEYVSRYFKFENDFYKLPGIKFTDANWQKFKNGDTSIEKMGAARVN AMLDCLFDDFELALIGKAQTNYYIDNS LKLNMPFYAYYDMFKKQQLLKWLKNNRDDVICGTGRMYTASGNYIANSYLEVALESSRLG SGSYMLQMRFKDYSRSQEPIPS GRQNRLEWIESNLENIR

SEQID NO:35 / anti-CRISPR gene isolated from Bacteriophage D1297

ATGAAAATCAATAATGACATCAAAGAGCTAATTTTGGAATATGTAAGTCGCTATTTT AAATTTGAAAACGACTTCTACAAA TTGCAAGGCATCAAATTCACTGATGCAAATTGGCAAAAATTCAAGAATGGAGATACTTCC ATCGAGAAGATGGGGGCAG CACGAGTAAATGCCATGCTTGACTGCCTATTCGACGATTTTGAGCTTGCTTTGATTGGCA AGGCTCAACAAGAATACTATT CGGATAATTCCTTGAAATTGAACATGCCATTTTACGCTTACTATGACATGTTCAAAAAGC AGCAACTTCTAAAATGGCTTA AAAATAACCGTGATGATGTCATCTGCGGAACTGGTAGGATGTACACAGCAAGTGGTAATT ACATTGCTAACTCTTATTTA GAGGTAGCGTTAGAATCTAGCCGTCTGGGTAGTGGCTCTTACATGCTTCAAATGAGATTC AAAGACTATTCAAGAAGTCA AGAACCTATTCCGTCAGGTCGCAAAAACCGACTTGAGTGGATTGAAAACAATCTGGAAAA TATTCGATAA

SEQID NO:36 / anti-CRISPR protein encoded by SEQ ID NO:35

MKINNDIKELILEYVSRYFKFENDFYKLQGIKFTDANWQKFKNGDTSIEKMGAARVNAML DCLFDDFELALIGKAQQEYYSDN SLKLNMPFYAYYDMFKKQQLLKWLKNNRDDVICGTGRMYTASGNYIANSYLEVALESSRL GSGSYMLQMRFKDYSRSQEPIP SGRKNRLEWIENNLENIR

SEQID NO:37 / anti-CRISPR gene isolated from Bacteriophage M5728

ATGAAAATCAATAATGACATCAAAGAGCTAATTTTGGAATATGTAAGTCGCTATTTTAAA TTTGAAAACGACTTCTACAAA TTGCCAGGCATCAAATTCACTGATGCAAATTGGCAAAAATTCAAGAATGGAGATACTTCC ATCGAGAAGATGGGGGCAG CACGAGTAAATGCCATGCTTGACTGCCTATTCGACGATTTTGAGCTTGCTTTTATTGGCA AGGCTCAACAAGAATACTATT CGGATAATTCCTTGAAATTGAACATGCCATTTTACGCTTACTATGACATGTTCAAAAAGC AGCAACTTCTAAAATGGCTTA AAAATAACCGTGATGATGTCATCTGCGGAACTGGTAGGATGTACACAGCAAGTGGTAATT ACATTGCTAACTCTTATTTA GAGGTAGCGTTAGAATCTAGCCGTCTGGGTAGTGGCTCTTACATGCTTCAAATGAGATTC AAAGACTATTCAAGAAGTCA AGAACCTATTCCATCTGGTCGCCAAAATAGACTAGAATGGATTGAAAACAATCTTGAGAA TATTCGATAA

SEQID NO:38 / anti-CRISPR protein encoded by SEQ ID NO:37

MKINNDIKELILEYVSRYFKFENDFYKLPGIKFTDANWQKFKNGDTSIEKMGAARVNAML DCLFDDFELAFIGKAQQEYYSDNS

LKLNMPFYAYYDMFKKQQLLKWLKNNRDDVICGTGRMYTASGNYIANSYLEVALESS RLGSGSYMLQMRFKDYSRSQEPIPS

GRQNRLEWIENNLENIR

SEQID NO:39 / anti-CRISPR gene isolated from Bacteriophage D4419

ATGAAAATCAATAATGACATCAAAGAGCTAATTTTGGAATATGTAAGTCGCTATTTTAAA TTTGAAAACGACTTCTACAAA TTGCCAGGCATCAAATTCACTGATGCAAATTGGCAAAAATTCAAGAATGGAGATACTTCC ATCGAGAAGATGGGGGCAG CACGAGTAAATGCCATGCTTGACTGCCTATTCGACGATTTTGAGCTTGCTTTGATTGGCA AGGCTCAACAAGAATACTATT CGGATAATTCCTTGAAATTGAACATGCCATTTTACGCTTACTATGACATGTTCAAAAAGC AGCAACTTCTAAAATGGCTTA AAAATAACCGTGATGATGTCATCTGCGGAACTGGTAGGATGTACACAGCAAGTGGTAATT ACATTGCTAACTCTTATTTA GAGGTAGCGTTAGAATCTAGCCGTCTGGGTAGTGGCTCTTACATGCTTCAAATGAGATTC AAAGACTATTCAAGAAGTCA AGAACCTATTCCATCTGGTCGCCAAAATAGACTAGAATGGATTGAGAGCAACTTGGAAAA CATTCGATAA SEQID NO:40 / anti-CRISPR protein encoded by SEQ ID NO:39

MKINNDIKELILEYVSRYFKFENDFYKLPGIKFTDANWQKFKNGDTSIEKMGAARVNAML DCLFDDFELALIGKAQQEYYSDNS LKLNMPFYAYYDMFKKQQLLKWLKNNRDDVICGTGRMYTASGNYIANSYLEVALESSRLG SGSYMLQMRFKDYSRSQEPIPS GRQNRLEWIESNLENIR SEQID NO:41 / anti-CRISPR gene isolated from Bacteriophage D5891

ATGAAAATCAATAATGACATCAAAGAGCTAATTTTGGAATATGTAAGTCGCTATTTTAAA TTTGAAAACGACTTCTACAAA TTGCCAGGCATCAAATTCACTGATGCAAATTGGCAAAAATTCAAGAATGGAGATACTTCC ATCGAGAAGATGGGGGCAG CACGAGTAAATGCCATGCTTGACTGCCTATTCGACGATTTTGAGCTTGCTTTTATTGGCA AGGCTCAACAAGAATACTATT CGGATAATTCCTTGAAATTGAACATGCCATTTTACGCTTACTATGACATGTTCAAAAAGC AGCAACTTCTAAAATGGCTTA AAAATAACCGTGATGATGTCATCTGCGGAACTGGTAGGATGTACACAGCAAGTGGTAATT ACATTGCTAACTCTTATTTA GAGGTAGCGTTAGAATCTAGCCGTCTGGGTAGTGGCTCTTACATGCTTCAAATGAGATTC AAAGACTATTCAAGAAGTCA AGAACCTATTCCATCTGGTCGCCAAAATAGACTAGAATGGATTGAGAGCAACTTGGAAAA CATTCGATAA

SEQID NO:42 / anti-CRISPR protein encoded by SEQ ID NO:41

MKINNDIKELILEYVSRYFKFENDFYKLPGIKFTDANWQKFKNGDTSIEKMGAARVN AMLDCLFDDFELAFIGKAQQEYYSDNS LKLNMPFYAYYDMFKKQQLLKWLKNNRDDVICGTGRMYTASGNYIANSYLEVALESSRLG SGSYMLQMRFKDYSRSQEPIPS GRQNRLEWIESNLENIR

SEQID NO:43 / anti-CRISPR gene isolated from Bacteriophage ALQ13.2

ATGAAAATCAATAATGACATCAAAGAGCTAATTTTGGAATATGTAAGTCGCTATTTT AAATTTGAAAACGACTTCTACAAA TTGCCAGGCATCAAATTCACTGATGCAAATTGGCAAAAATTCAAGAACGGAGATACTTCC ATCGAGAAGATGGGGGCAG CACGAGTAAATGCCATGCTTGACTGCCTATTCGACGATTTTGAGCTTGCTTTGATTGGCA AGGCTCAACAAGAATACTATT CGGATAATTCCTTGAAATTGAACATGCCATTTTACGCTTACTATGACATGTTAAAAAAGC AGCAACTTCTAAAATGGCTTA AAAATAACCGTGATGATGTCATCTGCGGAACTGGTAGGATGTACACAGCAAGTGGTAATT ACATTGCTAACTCTTATTTA GAGGTAGCGTTAGAATCTAGCCGTCTGGGTAGTGGCTCTTACATGCTTCAAATGAGATTC AAAGACTATTCAAGAAGTCA AGAACCTATTCCATCTGGTCGCCAAAATAGACTAGAATGGATTGAGAGCAACTTGGAAAA CATTCGATGA

SEQID NO:44 / anti-CRISPR protein encoded by SEQ ID NO:43

MKINNDIKELILEYVSRYFKFENDFYKLPGIKFTDANWQKFKNGDTSIEKMGAARVNAML DCLFDDFELALIGKAQQEYYSDNS LKLNMPFYAYYDMLKKQQLLKWLKNNRDDVICGTGRMYTASGNYIANSYLEVALESSRLG SGSYMLQMRFKDYSRSQEPIPS GRQNRLEWIESNLENIR

SEQID NO:45 / anti-CRISPR gene isolated from Bacteriophage D802

ATGAAAATCAATAATGACATCAAAGAGCTAATTTTGGAATATGTAAGTCGCTATTTTAAA TTCGAGAACGACTTTTACAG ATTGCCTGGCATCAAATTCACTGATGCCAACTGGCAAAAATTCAAGAATGGAGGCACTGC CATTGAGAAGATGGGAGCA GCACGAGTTAATGCCATGCTTTCCTGCCTATTCGAGGATTTTGAGCTTGCAATGATTGGC AAGGCTCAATATGAATACTAT TCGGATAATTCCTTGAAATTGAACATGCCATTTTACGCTTACTATGACATGTTCAAAAAG CAGCAACTTCTAAAATGGCTT AAAAATAACCGTGATGATGTCATCGGCGGAACTGGTAGAATGTACACGTCAAGCGGTAGT TACATTGCTAACGCTTATTT AGAAATTGCGTTAGAATCTAGCCGTCTGGGTAGTGGCTCTTACATGCTTCAAATGAGATT CAAAGACTATTCAAGAAGTC AAGAACCTATTCCGTCTGGTCGCCAAAATAGACTTGAATGGATTGAGAGCAACTTGGAAA ACATTCGATAA

SEQID NO:46 / anti-CRISPR protein encoded by SEQ ID NO:45

MKINNDIKELILEYVSRYFKFENDFYRLPGIKFTDANWQKFKNGGTAIEKMGAARVNAML SCLFEDFELAMIGKAQYEYYSDN SLKLNMPFYAYYDMFKKQQLLKWLKNNRDDVIGGTGRMYTSSGSYIANAYLEIALESSRL GSGSYMLQMRFKDYSRSQEPIPS GRQNRLEWIESNLENIR

SEQID NO:47 / anti-CRISPR gene isolated from Bacteriophage 73

ATGAAAATCAATAATGACATCAAAGAGCTAATTTTGGAATATGTAAGTCGCTATTTTAAA TTTGAAAACGACTTCTACAAA TTACCTGGCATCAAATTCACTGATGCCAACTGGCAAAAATTCAAGAATGGAGATACTTCC ATCGAGAAGATGGGGGCAG CACGAGTAAATGCCATGCTTGACTGCCTATTCGAGGATTTTGAGCTTGCAATGATTGGCA AGGCTCAAACTAATTATTAC ATTGATAACTCACTTAAATTGAACATGCCATTTTACGCTTACTATGACATGTTCAAAAAG CAGCAACTTCTAAAATGGCTT AAAAATAACCGTGATGATGTCATCGGCGGAACTGGTAGGATGTACACAGCAAGTGGTAAT TACATTGCTAACGCTTATTT AGAGGTGGCATTAGAATCGAGCTCGCTTGGTAGTGGCTCTTACATGCTTCAAATGAGGTT TAAAGACTATTCAAAAGGTC AAGAACCTATTCCGTCAGGTCGTCAGAATCGACTTGAATGGATTGAAAACAATCTCGAAA ACATTCGATAA SEQID NO:48 / anti-CRISPR protein encoded by SEQ ID NO:47

MKINNDIKELILEYVSRYFKFENDFYKLPGIKFTDANWQKFKNGDTSIEKMGAARVNAML DCLFEDFELAMIGKAQTNYYIDNS LKLNMPFYAYYDMFKKQQLLKWLKNNRDDVIGGTGRMYTASGNYIANAYLEVALESSSLG SGSYMLQMRFKDYSKGQEPIPS GRQNRLEWIENNLENIR SEQID NO:49 / anti-CRISPR gene isolated from Bacteriophage DTI

ATGAAAATCAATAATGACATCAAAGAGCTAATTTTGGAATATGTAAGTCGCTATTTTAAA TTTGAAAACGACTTCTACAAA TTACCTGGCATCAAATTCACTGATGCCAACTGGCAAAAATTCAAGAATGGAGAAACTTCA ATCGAAAAAATGGGAGCAG CACGAGTTAATGCCATGCTTTCATGCCTATTCGAGGATTTTGAGCTTGCAATGATTGGCA AGGCTCAAACTAATTATTACA TTGATAACTCACTTAAATTGAACATGCCATTTTACGCTTACTATGACATGTTCAAAAAGC AACTTCTTATAAATTGGCTTAA AAATAACCGTGATGATGTCATCGGCGGAACTGGTAGGATGTACACAGCAAGTGGTAATTA CATTGCTAACGCTTATTTAG AGGTGGCATTAGAATCAAGCTCGCTTGGTAGTGGCTCTTACATGATCCAAATGAGGTTTA AAGACTATTCAAAAGGTCAA GAACCTATTCCGTCAGGTCGCAAAAACCGACTTGAGTGGATTGAAAACAATCTGGAAAAT ATTCGATAA

SEQID NO:50 / anti-CRISPR protein encoded by SEQ ID NO:49

MKINNDIKELILEYVSRYFKFENDFYKLPGIKFTDANWQKFKNGETSIEKMGAARVN AMLSCLFEDFELAMIGKAQTNYYIDNS LKLNMPFYAYYDMFKKQLLINWLKNNRDDVIGGTGRMYTASGNYIANAYLEVALESSSLG SGSYMIQMRFKDYSKGQEPIPS GRKNRLEWIENNLENIR

SEQID NO:51 / anti-CRISPR gene isolated from Bacteriophage D1427

ATGAAAATCAATAATGACATCAAAGAGCTAATTTTGGAATATGTAAGTCGCTATTTT AAATTTGAAAACGACTTCTACAAA TTACCTGGCATCAAATTCACTGATGCCAACTGGCAAAAATTCAAGAATGGAGAAACTTCA ATCGAAAAAATGGGAGCAG CACGAGTTAATGCCATGCTTTCATGCCTATTCGAGGATTTTGAGCTTGCAATGATTGGCA AGGCTCAAACTAATTATTACA TTGATAACTCACTTAAATTGAACATGCCATTTTACGCTTACTATGACATGTTCAAAAAGC AACTTCTTATAAATTGGCTTAA AAATAACCGTGATGATGTCATCGGCGGAACTGGTAGGATGTACACAGCAAGTGGTAATTA CATTGCTAACGCTTATTTAG AGGTGGCATTAGAATCAAGCTCGCTTGGTAGTGGCTCTTACATGATCCAAATGAGGTTTA AAGACTATTCAAAAGGTCAA GAACCTATTCCGTCAGGTCGCCAAAATAGACTAGAATGGATTGAGAGCAACTTGGAAAAC ATTCGATAA

SEQID NO:52 / anti-CRISPR protein encoded by SEQ ID NO:51

MKINNDIKELILEYVSRYFKFENDFYKLPGIKFTDANWQKFKNGETSIEKMGAARVNAML SCLFEDFELAMIGKAQTNYYIDNS LKLNMPFYAYYDMFKKQLLINWLKNNRDDVIGGTGRMYTASGNYIANAYLEVALESSSLG SGSYMIQMRFKDYSKGQEPIPS GRQNRLEWIESNLENIR

SEQID NO:53 / anti-CRISPR gene isolated from Bacteriophage N1162

ATGAAAATCAATAATGACATCAAAGAGCTAATTTTGGAATATGTAAGTCGCTATTTTAAA TTTGAAAACGACTTCTACAAA TTACCTGGCATCAAATTCACTGATGCCAACTGGCAAAAATTCAAGAATGGAGATACTTCC ATCGAGAAGATGGGGGCAG CACGAGTAAATGCCATGCTTGACTGCCTATTCGAGGATTTTGAGCTTGCAATGATTGGCA AGGCTCAAACTAATTATTAC ATTGATAACTCACTTAAATTGAACATGCCATTTTACGCTTACTATGACATGTTCAAAAAG CAGCAACTTCTAAAATGGCTT AAAAATAACCGTGATGATGTCATCGGCGGAACTGGTAGGATGTACACATCAACCGGTAAT TACATTGCTAACGCTTATTT AGAAATTGCGTTAGAATCTAGCCGTCTGGGTAGTGGCTCTTACATGATCCAAATGAGGTT TAAAGACTATTCAAAAGGTC AAGAACCTATTCCGTCTGGTCGTCAGAATCGACTTGAATGGATTGAAAACAATCTGGAAA ATATTCGATAA

SEQID NO:54 / anti-CRISPR protein encoded by SEQ ID NO:53

MKINNDIKELILEYVSRYFKFENDFYKLPGIKFTDANWQKFKNGDTSIEKMGAARVNAML DCLFEDFELAMIGKAQTNYYIDNS

LKLNMPFYAYYDMFKKQQLLKWLKNNRDDVIGGTGRMYTSTGNYIANAYLEIALESS RLGSGSYMIQMRFKDYSKGQEPIPS

GRQNRLEWIENNLENIR

SEQID NO:55 / anti-CRISPR gene isolated from Bacteriophage D1018

ATGAAAATCAATAATGATATCAAAGAGCTAATTTTGGAATATGTAAGTCGCTATTTTAAA TTTGAAAACGACTTCTACAAA TTGCCAGACATCAAGTTCACAGATGCTAATTGGCAAAAATTTAAGAATGGAGAAACTTCA ATCGAAAAAATGGGAGCAG CACGAGTAAATGCCATGCTTGACTGCCTATTCGAGGATTTTGAGCTTGCAATGATTGGCA AGGCTCAAACTAATTATTAC ATTGATAACTCACTTAAATTGAACATGCCATTTTACGCTTACTATGACATGTTCAAAAAG CAGCAACTTCTAAAATGGCTT AAAAATAACCGTGATGATGTCATCGGCGGAACTGGTAGGATGTACACATCAACCGGTAAT TACATTGCTAACGCTTATTT AGAAATTGCGTTAGAATCTAGCCGTCTGGGTAGTGGCTCTTACATGATCCAAATGAGGTT TAAAGACTATTCAAAAGGTC AAGAACCTATTCCGTCTGGTCGTCAGAATCGACTTGAATGGATTGAAAACAATCTGGAAA ATATTCGATAA SEQID NO:56 / anti-CRISPR protein encoded by SEQ ID NO:55

MKINNDIKELILEYVSRYFKFENDFYKLPDIKFTDANWQKFKNGETSIEKMGAARVNAML DCLFEDFELAMIGKAQTNYYIDNS

LKLNMPFYAYYDMFKKQQLLKWLKNNRDDVIGGTGRMYTSTGNYIANAYLEIALESS RLGSGSYMIQMRFKDYSKGQEPIPS

GRQNRLEWIENNLENIR SEQID NO:57 / anti-CRISPR gene isolated from Bacteriophage D3577

ATGAAAATAAACAACGATATCAAAGAGCTAATTTTGGAATACGCTAAACGTTATTTCAAG TTTGAAAACGACTTCTACAA ACTGCCAGACATCAAATTCACTGATGCCAACTGGCAAAAATTTAAGAATGGAGAAACTTC CATCGAAAAAATGGGAGCA GCACGAGTTAATGCCATGCTTTCCTGCCTGTTCGACGATTTTGAGCTTGCTATGATTGGC AAGGCTCAAACTAATTATTAC AATGATAACTCACTTAAATTGAACATGCCATTTTACGCTTACTATGACATGTTCAAAAAG CAGCAACTTCTAAAATGGCTT AAAAATAACCGTGATGATATCATCTGCGGAACTGGTAGAATGTACACTTCAAGAGGTAGT TACATTGCTAACGCTTATTT AGAGGTAGCGTTAGAATCAAGCTTGCTTGGTAGTGGCTCTTACATGCTTCAAATGAGGTT CAAAGACTATTCAAAAAGTC AAGAACCTATTCCATCTGGTCGTCAGAATCGACTTGAATGGATTGAGAGCAACTTGGAAA ATATTCGATAA

SEQID NO:58 / anti-CRISPR protein encoded by SEQ ID NO:57

MKINNDIKELILEYAKRYFKFENDFYKLPDIKFTDANWQKFKNGETSIEKMGAARVN AMLSCLFDDFELAMIGKAQTNYYNDN SLKLNMPFYAYYDMFKKQQLLKWLKNNRDDIICGTGRMYTSRGSYIANAYLEVALESSLL GSGSYMLQMRFKDYSKSQEPIPS GRQNRLEWIESNLENIR

SEQID NO:59 / anti-CRISPR gene isolated from Bacteriophage CHPC577

ATGAAAATAAACAACGATATCAAAGAGCTAATTTTGGAATATGGAAGTCGCTATTTT AAATTTGAAAACGACTTCTACAA ACTGCCTGGCATCAAGTTCACTGATGCTAATTGGCAAAAATTCAAAAATGGTGATACTTT AATCGAAAAAATGGGGGCA GCACGAGTAAATGCCATGCTTGACTGCCTGTTCGACGATTTTGAGCTTGCTATGATTGGC AAGGCTCAAACTAATTATTAC AATGATAATTCCTTGAAATTGAACATGCCATTTTACGCTTACTATGACATGTTCAAAAAG CAACAGCTTATACATTGGCTC AAAAACAACCGTGATGACATCGTAGGCGGAACTGGTAGACTGTACACTTCAAGCGGTAGT TACATTGCTAACGCTTATTT AGAAATTGCATTAGAATCGAGCTCGCTTGGTAGTGGCTCTTACATGCTTCAAATGAGATT CAAAAACTATTCAAAAAGTC AAGAACCTATTCCATCTGGTCGCCAGAATCGACTTGAATGGATTGAAAACAATCTTGAGA ATATTCGATAA

SEQID NO:60 / anti-CRISPR protein encoded by SEQ ID NO:59

MKINNDIKELILEYGSRYFKFENDFYKLPGIKFTDANWQKFKNGDTLIEKMGAARVNAML DCLFDDFELAMIGKAQTNYYND NSLKLNMPFYAYYDMFKKQQLIHWLKNNRDDIVGGTGRLYTSSGSYIANAYLEIALESSS LGSGSYMLQMRFKNYSKSQEPIPS GRQNRLEWIENNLENIR

SEQID NO:61 / anti-CRISPR gene isolated from Bacteriophage D4237

ATGAAAATAAATAACGACATCAAAGAATTAATTTTAGAATATATGAGCCGTTACTTCAAA TTCGAAAACGACTTCTACAAA TTGCCAGACATCAAGTTCACAGATGCTAATTGGCAAAAATTTAAGAATGGAGAAACTTCA ATCGAAAAAATGGGAGCAG CACGAGTTAATGCCATGCTCAACTGCCTATTCGAAGATTTTGAGCTTGCTATGATTGGCA AGGCTCAAATTAATTATTACA ATGATAACTCACTTAAAATGAACATGCCATTTTACGCTTACTATGATATGTTCAAAAAAC AACAGCTTCTAAAATGGCTTA AAGATCACCATGATGACATCATCGGAGGAGCTGGCAGAATGTACACATCAACCGGTAGTT ACATTGCTAATGCTTATTTA GAG GTAG CGTTAG AATCAAG CTCG CTTG GTG ATGGTG AGTACATGTTG CAAATG CGTTTTAAAAATTATTCACG AAGTCA AGAACCTATTCCGTCAGGTCGCAAAAACCGACTTGAGTGGATTGAAAACAATCTGGAAAA TATTCGATAA

SEQID NO:62 / anti-CRISPR protein encoded by SEQ ID NO:61

MKINNDIKELILEYMSRYFKFENDFYKLPDIKFTDANWQKFKNGETSIEKMGAARVNAML NCLFEDFELAMIGKAQINYYNDN SLKMNMPFYAYYDMFKKQQLLKWLKDHHDDIIGGAGRMYTSTGSYIANAYLEVALESSSL GDGEYMLQMRFKNYSRSQEPIP SGRKNRLEWIENNLENIR

SEQID NO:63 / anti-CRISPR gene isolated from Bacteriophage 9874

ATGAAAATAAATGACGACATCAAAGAATTAATTTTAGAATATATGAGCCGTTACTTCAAA TTCGAGAACGACTTCTACAA ATTGCCTGACATCAAATTCACTGATGCCAACTGGCAAAAATTCAAAAATGGAGATACTTC CATCGAGAAGATGGGGGCA GCACGAGTAAATGCCATGCTTGACTGCCTATTCGAAGATTTCGAACTTGCCATGATTGGC AAGGCTCAACAAGAATACTA TTTGGATAATTCACTAAAGATGAACATGCCATTTTACGCTTATTATGATATGTTCAAGAA AAAACAGCTCGTCAAATGGCT TAAAGATCACCATGATGACATCCTAGGCGGAACTGGTAGGATGTACACTTCAGACGGTAG TTACATTGCTAACTCTTATT TAGAGGTAGCGTTAGAATCTAGCCGTCTGGGTAGTGGCTCTTACATGCTTCAAATGAGAT TCAAAGACTATTCAAGAAGT CAAGAACCCATTCCGTCAGGTCGCAAAAACCGACTTGAGTGGATTGAAAACAATCTGGAA AATATTCGATAA SEQID NO:64 / anti-CRISPR protein encoded by SEQ ID NO:63

MKINDDIKELILEYMSRYFKFENDFYKLPDIKFTDANWQKFKNGDTSIEKMGAARVNAML DCLFEDFELAMIGKAQQEYYLDN SLKMNMPFYAYYDMFKKKQLVKWLKDHHDDILGGTGRMYTSDGSYIANSYLEVALESSRL GSGSYMLQMRFKDYSRSQEPIP SGRKNRLEWIENNLENIR SEQID NO:65 / anti-CRISPR gene isolated from Bacteriophage 5093

ATGGAAATCAACAACGATATCAAAGAGTTAATTTTGGAATACGTGAAAAGATACTTCAAG TTCGAGAACGACTTCTACAA ATTGCCTGACATCAAATTCACTGATGCCAACTGGCAGAAGTTCAAAAATGGCGAAACAGC CATTGAGAAGATGGGGGCA GCACGAGTAAACGCAATGCTCGACTGCCTATTCGAAGATTTTGAGCTTGCCATGATTGGC AAGGCTCAAACTAATTATTA TATTGATAACTCGCTTAAATTAAACATGCCATTTTATGCTTACTATGATATGTTTAAGAA ACAACAGCTCGTCAAATGGCTT GAAACTAGTCGTGAAGACATCATCGGAGGGGCTGGCAGAATGTACACTTCAGACGGTAGT TACATTGCTAACGCTTATTT AGAAGTAGCGTTAGAATCAAGCTCGCTTGGTGATAGTGAATACATGTTGCAAATGCGTTT TAAAAATTATTCAAAAAGTC AAGAACCTATTCCGTCTGGTCGTCAAAATAGACTGGAATGGATTGAAAACAATCTTAAAA ACATTCGATAA

SEQID NO:66 / anti-CRISPR protein encoded by SEQ ID NO:65

MEINNDIKELILEYVKRYFKFENDFYKLPDIKFTDANWQKFKNGETAIEKMGAARVN AMLDCLFEDFELAMIGKAQTNYYIDNS LKLNMPFYAYYDMFKKQQLVKWLETSREDIIGGAGRMYTSDGSYIANAYLEVALESSSLG DSEYMLQMRFKNYSKSQEPIPSG RQNRLEWIENNLKNIR

SEQID NO:67 / anti-CRISPR gene isolated from Bacteriophage D4154

ATGCTAATAAATAACGACATCAAAGAGTTGATTTTGGAATACGTCAAACGCTATTTT AAATATGAAAATGACTTCTACAG ATTGCCGGGCATCAAGTTTACCGATGCAAATTGGCAGAAGTTTAAAAATGGCGACACTTC CATCGAGAAGATGGGGGCA GCACGAGTAAACGCCATGCTCGACTGCCTATTCGAAGATTTTGAGCTTGCCATGATTGGT AAGGCTCAAACCAATTATTA TATCAATAATTCATTGAAAATGAATATGCCGTTTTACGCTTACTATGATATGTTCAAGAA GGAACAGCTTATGAAATGGCT TGAAACCAGCCGTGAAGACATCATAGGCGGAACTGGCAGGATGTACACTTCAGACGGTAG TTACATTGCTAACGCTTAT TTGGAAATTGCATTAGAATCGAGCTCGCTTGGTAGTGGCTCTTACATGCTTCAAATGCGT TTTAAAGATTATTCAAAAGGT CAAGAGCCTATCCCGTCTGGTCGTCAAAACCGACTTGAGTGGATTGAAAACAATCTTGAA AACATTCGATAA

SEQID NO:68 / anti-CRISPR protein encoded by SEQ ID NO:67

MLINNDIKELILEYVKRYFKYENDFYRLPGIKFTDANWQKFKNGDTSIEKMGAARVNAML DCLFEDFELAMIGKAQTNYYINN SLKMNMPFYAYYDMFKKEQLMKWLETSREDIIGGTGRMYTSDGSYIANAYLEIALESSSL GSGSYMLQMRFKDYSKGQEPIPS GRQNRLEWIENNLENIR

SEQID NO:69 / anti-CRISPR gene isolated from the genome of Streptococcus thermophilus DGCC11758 ATGCTAATAAATAACGACATCAAAGAGTTGATTTTGGAATACGTCAAACGCTATTTTAAA TTTGAAAATGACTTCTACAGA TTGCCGGGCATCAAGTTTACCGATGCAAATTGGCAGAAGTTTAAAAATGGCGACACTGCC ATTGAGAAGATGGGGGCAT CACGAGTAAACTCTATGCTTGACTGCCTGTTCGAAGATTTTGAGCTTGCTATGATTGGCA AGGCTCAAGATGAATACTATT TGGATAATTCACTAAAGATGAACATGCCATTTTACGCTTATTATGATATGTTCAAGAAAA AACAGCTCGTCAAATGGCTTA AAGATCACCATGATGACATCCTAGGCGGAACTGGTAGGATGTATACTTCAAGCGGCAATT ACATTGCTAACGCTTATTTA GAG GTAGCGTTAG AATCAAG CTCG CTTG GTAGTGG CTCTTACATG ATTCAAATGCGTTTTAAAAATTATTC AAAAG GTCA AGAGCCTATCCCGTCTGGTCGTCAAAACCGACTTGAGTGGATTGAAAAAAACTTGGAGAA CATTCGATAA

SEQID NO:70 / anti-CRISPR protein encoded by SEQ ID NO:69

MLINNDIKELILEYVKRYFKFENDFYRLPGIKFTDANWQKFKNGDTAIEKMGASRVNSML DCLFEDFELAMIGKAQDEYYLDNS LKMNMPFYAYYDMFKKKQLVKWLKDHHDDILGGTGRMYTSSGNYIANAYLEVALESSSLG SGSYMIQMRFKNYSKGQEPIPS GRQNRLEWIEKNLENIR

SEQID NO:71 / anti-CRISPR gene isolated from the genome of Streptococcus thermophilus DSM 20617 ATGGAAATCAACAACGATATTAAACAACTGATCTTGGAATACGCTAAACGTTATTTCAAG TTTGAGAACGACTTTTATAAA CTGCCAGGCATCAAGTTCACTGATGCAAATTGGCAGAAGTTCAAAAATGGAGGCACTGCC ATTGAGAAGATGGGGGCA GCACGAGTAAACGCCATGCTCGACTGCCTATTCGAAGATTTCGAGCTTGCAATGATTGGC AAGGCTCAACAAGAATACTA TTCGGATAATTCCTTGAAAGTAAATATGGCATTCTATGCTTATTACGATCAATTCAAAAA ACAACAGCTTATGAAATGGCT TAAAGATAATCACGATGACATCATAGGAGGGACTGGTAGAATGTACACGTCAAGCGGTAG TTACATTGCTAACGCTTATT TAGAAATTGCGTTAGAATCTAGCCGTCTGGGTGGTGGTTCTTACATGATCCAAATGAGGT TTAAAGACTATTCAAAAGGT CAAGAACCTATTCCGTCTGGTCGTCAGAATCGACTTGAATGGATTGAGAGCAACTTGGAA AACATTCGATAA SEQID NO:72 / anti-CRISPR protein encoded by SEQ ID NO:71

MEINNDIKQLILEYAKRYFKFENDFYKLPGIKFTDANWQKFKNGGTAIEKMGAARVNAML DCLFEDFELAMIGKAQQEYYSD NSLKVNMAFYAYYDQFKKQQLMKWLKDNHDDIIGGTGRMYTSSGSYIANAYLEIALESSR LGGGSYMIQMRFKDYSKGQEPI PSGRQNRLEWIESNLENIR SEQID NO:73 / anti-CRISPR gene isolated from Bacteriophage Sfil9

ATGGAAATCAACAACGACATTAAACAACTGATCTTGGAATACGTGGGACGCTATTTTAAA TTTGAAAATGACTTCTACAA ATTGCCCGGCATCAAATTCACTGATGCCAATTGGCAGAAGTTCAAAAATGGCGATACTTC CATCGAAAAGATGGGAGCA GCACGAGTAAACGCAATGCTTGACTGCCTGTTCGAAGATTTCGAACTTGCCATGATTGGC AAGGCTCAAACTAATTATTA TATTGATAATTCCCTTAAATTAAACATGCCATTTTACGCTTATTATGATATGTTCAAGAA GGAACAGCTTATGAAATGGCTT AAAGATCACCATGATGACATCATAGGCGGAACTGGTAGGATGTACATTTCAAGCGGTAGC TACATTGCTAACGCTTATTT GGAAATTGCACTAGAATCAAGTACGCTTGGTGGTGGTGAGTACATGTTGCAAATGCGCTT TAAAAATTATTCACGAAGCC AAGAACCTATTCCATCAGGTCGCAAAAATAGACTTGAATGGATTGAAAACAATCTTGAAA ACATTCGATAA

SEQID NO:74 / anti-CRISPR protein encoded by SEQ ID NO:73

MEINNDIKQLILEYVGRYFKFENDFYKLPGIKFTDANWQKFKNGDTSIEKMGAARVN AMLDCLFEDFELAMIGKAQTNYYIDN SLKLNMPFYAYYDMFKKEQLMKWLKDHHDDIIGGTGRMYISSGSYIANAYLEIALESSTL GGGEYMLQMRFKNYSRSQEPIPS GRKNRLEWIENNLENIR

SEQID NO:75 / anti-CRISPR gene isolated from Bacteriophage Sfill

ATGGAAATCAACAACGACATTAAACAACTGATCTTGGAATACGTGGGACGCTATTTT AAATTTGAAAATGACTTCTACAA ATTGCCCGGCATCAAATTCACTGATGCCAATTGGCAGAAGTTCAAAAATGGCGATACTTC CATCGAAAAGATGGGAGCA GCACGAGTAAACGCAATGCTTGACTGCCTGTTCGAAGATTTCGAACTTGCCATGATTGGC AAGGCTCAAACTAATTATTA TATTGATAATTCCCTTAAATTAAACATGCCATTTTACGCTTATTATGATATGTTCAAGAA GGAACAGCTTATGAAATGGCTT AAAGATCACCATGATGACATCATAGGCGGAACTGGTAGGATGTACACTTCAAGCGGTAGC TACATTGCTAACGCTTATTT GGAAATTGCACTAGAATCAAGTACGCTTGGTGGTGGTGAGTACATGTTGCAAATGCGCTT TAAAAATTATTCACGAAGCC AAGAACCTATTCCATCAGGTCGCAAAAATAGACTTGAATGGATTGAAAACAATCTTGAAA ACATTCGATAA

SEQID NO:76 / anti-CRISPR protein encoded by SEQ ID NO:75

MEINNDIKQLILEYVGRYFKFENDFYKLPGIKFTDANWQKFKNGDTSIEKMGAARVNAML DCLFEDFELAMIGKAQTNYYIDN SLKLNMPFYAYYDMFKKEQLMKWLKDHHDDIIGGTGRMYTSSGSYIANAYLEIALESSTL GGGEYMLQMRFKNYSRSQEPIPS GRKNRLEWIENNLENIR

SEQID NO:77 / anti-CRISPR gene isolated from the genome of Streptococcus thermophilus M17PTZA496 ATGGAAATCAACAAAGACATCAAAGAGTTGATTTTGGAATACGTCAAACGCTATTTTAAA TTTGAAAATGATTTCTACAG ATTGCCGGGCATCAAGTTTACCGATGCCAACTGGCAAAAATTCAAGAATGGAGATACTTC CATCGAGAAGATGGGGGCA GCACGAGTAAACGCCATGCTTGACTGCCTGTTCGAAGATTTCGAACTTGCTATGATTGGC AAGGCTCAAGATGAATACTA TTTGGATAATTCACTTAAGTTTAATATGGCATTCCATACTTATTACGATCAATTTAAAAA ACAACAGCTTATGAAATGGCTT GAAACTAGCCTCGAAGACATCATAGGCGGAACTGGTAGGATGTACACTTCAAGCGGTAGT TACATTGCTAACGCTTATTT GGAAATTGCACTAGAATCAAGCTCGCTTGGTGGTGGTGAGTACATGTTGCAAATGCGTTT TAAAAATTATTCACGAAGCC AAGAACCTATTCCGTCAGGTCGCAAAAACCGACTTGAGTGGATTGAAAACAATCTGGAAA ATATCCGATAA

SEQID NO:78 / anti-CRISPR protein encoded by SEQ ID NO:77

MEINKDIKELILEYVKRYFKFENDFYRLPGIKFTDANWQKFKNGDTSIEKMGAARVNAML DCLFEDFELAMIGKAQDEYYLDN

SLKFNMAFHTYYDQFKKQQLMKWLETSLEDIIGGTGRMYTSSGSYIANAYLEIALES SSLGGGEYMLQMRFKNYSRSQEPIPSG

RKNRLEWIENNLENIR

SEQID NO:79 / anti-CRISPR gene isolated from Bacteriophage D4769

ATGAAAATCAATAATGACATCAAAGAGCTAATTTTGGAATATGTAAGTCGCTATTTTAAA TTTGAAAACGACTTCTACAAA TTACCTGGCATCAAATTCACTGATGCCAACTGGCAAAAATTCAAGAATGGAGATACTTCC ATCGAGAAGATGGGGGCAG CACGAGTAAACGCCATGCTTGACTGCCTGTTCGAAGATTTCGAACTTGCTATGATTGGCA AGGCTCAAGATGAATACTAT TTGGATAATTCACTTAAGTTTAATATGGCATTCCATACTTATTACGATCAATTTAAAAAA CAACAGCTTATGAAATGGCTT GAAACTAGCCTCGAAGACATCATAGGCGGAACTGGTAGGATGTACACTTCAAGCGGTAGT TACATTGCTAACGCTTATTT GGAAATTGCACTAGAATCAAGCTCGCTTGGTGGTGGTGAGTACATGTTGCAAATGCGTTT TAAAAATTATTCACGAAGCC AAGAACCTATTCCGTCAGGTCGCAAAAACCGACTTGAGTGGATTGAAAACAATCTGGAAA ATATCCGATAA SEQID NO:80 / anti-CRISPR protein encoded by SEQ ID NO:79

MKINNDIKELILEYVSRYFKFENDFYKLPGIKFTDANWQKFKNGDTSIEKMGAARVNAML DCLFEDFELAMIGKAQDEYYLDN

SLKFNMAFHTYYDQFKKQQLMKWLETSLEDIIGGTGRMYTSSGSYIANAYLEIALES SSLGGGEYMLQMRFKNYSRSQEPIPSG

RKNRLEWIENNLENIR SEQID NO:81 / anti-CRISPR gene isolated from Bacteriophage D5691

ATGATTATAAATATTGATATCAAGGAATTGATTTTAGAGTATATGAGTAGATACTTCAAA TTTGAAAATGATTTCTACAAA CTCCCCGGCATCAAATTCACTGATGCCAATTGGCAAAAATTTAAGAATGGTGACACTTCC ATCGAAAAGATGGGAGCGG CTCGAGTAAATGCCATGCTCGACTGTCTATTCGATGACTTTGAACTTGCTATGATTGGCA AGGCTCAAATTAATTATTACA TAGACAATTCCCTTAAATTGAACATGCCATTCTATGCTTATTATGACATGTTCAAAAAAC AACAACTGATCAAATGGATTG AAACCAGCCGTGATGATGTCATCGGAGGAACTGGCAGGATGTATACAGCAAGCGGAAGCT ACATAGCTAACGCTTATCT AGAAATAGCACTAGAATCTAGCTCTCTGGGTGGTGGCTCTTATATGCTTCAAATGAGATT CAAAAACTACTCACGAAGCC AAGAGCCAATACCATCTGGTCGGAAAAACCGACTTGAGTGGATTGAGAGCAACTTGGAAA ACATTAGATAA

SEQID NO:82 / anti-CRISPR protein encoded by SEQ ID NO:81

MIINIDIKELILEYMSRYFKFENDFYKLPGIKFTDANWQKFKNGDTSIEKMGAARVN AMLDCLFDDFELAMIGKAQINYYIDNSL KLNMPFYAYYDMFKKQQLIKWIETSRDDVIGGTGRMYTASGSYIANAYLEIALESSSLGG GSYMLQMRFKNYSRSQEPIPSGR KNRLEWIESNLENIR

SEQID NO:83 / anti-CRISPR gene isolated from the genome of Streptococcus sp. HMSC10E12

ATGGAAATCAACAATGACATCAAAGAGTTAATCTTGGAATACGTGGGACGCTATTTC AAGTTTGAAAATGATTTTTACAA ATTGCCGGGCATCAAATTTACCGATGCAAATTGGCAAAAATTCAAAAACGGTGATACATC CATCGAGAAAATGGGGGCG GCACGAGTAAACGCAATGCTCGACTGCCTATTCGATGATTTCGAGCTTGCTATGATTGGC AAGGCTCAAACTGATTATTA CATTGATAACTCACTTAAATTGAACATGCCATTTTATGCTTATTATGACATGTTCAAAAA ACAACAGCTTCTAAAATGGATT GAGAATAGTCGTGAAGACATCATCGGAGGGGCTGGCAGAATGTACACAGCGGGCGGTAAT TGGATTTCTAGCGCTTATT TAGAGATCGCATTAGAATCTAGTTCCATCGGTGGCGGTGGCTATATGCTTCAAATGCGGT TCAAAAACTACTCAAGAGAC CCTAGACCGATTCCAGCAGGCCACCAAAATCGTCTCGAATGGATTGAAAACAACTTGGAG AATATCCGATAA

SEQID NO:84 / anti-CRISPR protein encoded by SEQ ID NO:83

MEINNDIKELILEYVGRYFKFENDFYKLPGIKFTDANWQKFKNGDTSIEKMGAARVNAML DCLFDDFELAMIGKAQTDYYIDN SLKLNMPFYAYYDMFKKQQLLKWIENSREDIIGGAGRMYTAGGNWISSAYLEIALESSSI GGGGYMLQMRFKNYSRDPRPIPA GHQNRLEWIENNLENIR

SEQID NO:85 / anti-CRISPR gene isolated from the genome of Streptococcus sp. HSISS2

ATGGAAATCAACAATGACATCAAGGACCTAATTTTAGAATACGTAGGACGATATTTTCGA TTTGAAAACGACTTCTACAA ACTTCCCAGAATCAAGTTTACCGATTCCAATTGGCAAAAATTCAAGAACGGTGACACTTC CATCGAAAAAATGGGAGCTG GCAGAGTGAACGCAATGCTCGATTGTCTATTTGATGATTTTGAGCTTGCTATGATTGGTA AGGCTCAAACCGATTACTAC ATGGACAATTCTTTAAAGATGAATATGCCATTTTATGCCTATTATGACCAATTTAAGAAA CAGCAACTATTGAAATGGATC GAGAATAGTAGAGAGGATATCATAGGCGGTGCTGGCAGAATGTACACAGCTAGTGGGAAT TGGATTTCTAGTGCCTATT TAGAAATTGCATTGGAATCCAGCTCGTTAGGTGGTGGTGAGTACATGTTGCAAATGCGTT TCAAAGACTACTCACGAAGC CAAGAGCCGATACCAGCAGGCCGCCAGAATCGACTTGAGTGGATTGAGAATAATTTGGAG AATATTCGATAA

SEQID NO:86 / anti-CRISPR protein encoded by SEQ ID NO:85

MEINNDIKDLILEYVGRYFRFENDFYKLPRIKFTDSNWQKFKNGDTSIEKMGAGRVNAML DCLFDDFELAMIGKAQTDYYMD NSLKMNMPFYAYYDQFKKQQLLKWIENSREDIIGGAGRMYTASGNWISSAYLEIALESSS LGGGEYMLQMRFKDYSRSQEPIP AGRQNRLEWIENNLENIR

DETAILED DESCRIPTION

CRISPR-Cas systems, organization, activity and classification

CRISPR-Cas systems are encoded by CRISPR-cas loci. "CRISPR-cas loci" means a

DNA segment, located in the bacterial genome, which includes a CRISPR locus and one or more cas genes. CRISPR is an acronym for "clustered regularly interspaced short palindromic repeats".

The term "CRISPR locus" as used herein means a DNA segment, which includes a CRISPR array as well as a leader sequence. CRISPR loci typically consist of several noncontiguous, direct, and highly conserved DNA repeats (CRISPR repeats) that are separated by stretches of unique, nonrepetitive, and similarly-sized sequences (CRISPR spacers). CRISPR repeats and CRISPR spacers form together a CRISPR array.

As used herein, the term "CRISPR array" refers to the DNA segment which includes all of the CRISPR repeats and spacers of a CRISPR locus, starting with the first nucleotide of the first CRISPR repeat and ending with the last nucleotide of the last (terminal) CRISPR repeat. Typically, each spacer sequence in a CRISPR array is located between two repeats and consequently, a CRISPR array locus includes one more repeat than spacer sequences. In other words, a CRISPR array comprises one or more [repeat-spacer] units (i.e., a CRISPR spacer sequence associated with a repeat sequence), followed by a terminal repeat.

As used herein, the terms "CRISPR repeat," "repeat sequence," or "repeat" have the conventional meaning as used in the art - i.e., multiple, short, direct repeating sequences, which show little or no sequence variation within a given CRISPR array. Many repeat sequences are partially palindromic, having the potential to form stable, conserved secondary structures.

As used herein, "CRISPR spacer", "spacer sequence," or "spacer" refer to the non- repetitive sequences that are located between two repeats in a CRISPR array. As used herein, "protospacer" refers to the sequence within the target nucleic acid which corresponds to a given CRISPR spacer. Protospacer acquisition in many CRISPR-Cas systems requires recognition of a short protospacer adjacent motif (PAM) in the target nucleic acid. These motifs are located in the direct vicinity of the protospacer (typically less than 10 nucleotides outside of the sequence) and appear to be specific to each CRISPR-Cas system.

As used herein, a "CRISPR leader," "leader sequence," or "leader" refers to a low- complexity, A T-rich, noncoding sequence of up to several hundred base pairs that is located on one side of the repeat-spacer array, immediately upstream of the first repeat.

As used herein, the term "cas gene" (for CRISPR-associated) has its conventional meaning as used in the art where it refers to a gene that is coupled to, associated with, close to, or in the vicinity of a CRISPR array. The expression "cas gene" includes, but is not limited to, cas, csn, csm and cmr genes, depending upon the type of CRISPR-Cas system. Thus, the person skilled in the art can easily identify based on conventional protein comparison bioinformatics tools (such as BLAST), whether a gene associated with a CRISPR locus encodes a Cas protein characteristic of any CRISPR-Cas system. The expression "Cas protein" encompasses Cas, Csn, Csm and Cmr proteins, depending upon the type of CRISPR-Cas system.

CRISPR-Cas system activity, including the activity providing immunity against target nucleic acids, involves two distinct functions: the adaptation function and the interference function. As used herein, "adaptation function" refers to the stage by which a fragment of a target nucleic acid (protospacer) is incorporated into the CRISPR array as a new spacer, in the form of a new repeat-spacer unit. As used herein, "interference function" refers to the stage by which the CRISPR array is transcribed as a precursor transcript (pre-crRNA), the pre-crRNA being possibly processed and matured to produce CRISPR RNAs (crRNAs), and whereby the crRNAs together with Cas protein(s) specifically target and cleave the target nucleic acids.

The adaptation function of a CRISPR-Cas system can be assayed by exposing to a virulent phage a bacterial strain comprising said CRISPR-Cas system (said bacterial being sensitive to said virulent phage), selecting bacteriophage-resistant strains (i.e., strains which are resistant to this phage), and checking whether this resistance is conferred by the addition - in the CRISPR array of said CRISPR-Cas system - of at least one repeat-spacer unit.

The interference function of a CRISPR-Cas system can be assayed by exposing a bacterial strain comprising said CRISPR-Cas system to a virulent phage (the CRISPR array of said CRISPR-Cas system comprising a spacer corresponding to a protospacer found in the genome of said virulent phage), and measuring the phage titer. A phage titer which is significantly reduced (i.e., a reduction of at least 2 Log or at least 99%) as compared to the same exposure with a bacterial strain not comprising in its CRISPR array said spacer is indicative of a functional interference function. In contrast, a phage titer, which is not significantly reduced is indicative of an interference function which is decreased or is inhibited.

The classification used herein - for the disctinction between class 1 type CRISPR-Cas systems and class 2 CRISPR-Cas systems - is the one described in Makarova et al. 2015 (on the basis of the genes encoding the effector molecules). Thus, as defined herein "class 1 type CRISPR-Cas systems" refer to CRISPR-Cas systems possessing multisubunit crRNA- effector complexes. In contrast, "class 2 type CRISPR-Cas systems" as defined herein refer to CRISPR-Cas systems functioning with a single protein as effector complex (such as Cas9).

The classification used here - for the distinction between the different CRISPR-Cas system types within the class 2 CRISPR-Cas systems - is the one described in Schmakov et al. 2017. As defined herein, "class 2 type II CRISPR-Cas system" refers to CRISPR-Cas systems comprising the cas9 gene among its cas genes. As defined herein, "class 2 type II- A CRISPR-Cas system" refers to CRISPR-Cas systems comprising cas9 and csn2 genes. As defined herein, "class 2 type ll-B CRISPR-Cas system" refers to CRISPR-Cas systems comprising the cas9 and cas4 genes. As defined herein, "class 2 type ll-C CRISPR-Cas system" refers to CRISPR-Cas systems comprising the cas9 gene but neither the csn2 nor the cas4 gene. As defined herein, "class 2 type V CRISPR-Cas system" refers to CRISPR- Cas systems comprising the cas12 gene (cas12a, 12b or 12c gene) in its cas genes. As defined herein, "class 2 type VI CRISPR-Cas system" refers to CRISPR-Cas systems comprising the cas13 gene (cas13a, 13b or 13c gene) in its cas genes.

In Streptococcus thermophilus, although CRISPR1 and CRISPR3 belong to class 2 type ll-A systems, they are significantly different in terms of sequence including Cas9 sequence. For the distinction of CRISPR1 and CRISPR3, reference is made herein to the publication of Chylinski et al. 2014, where the CRISPR1 -Cas system is represented by the Cas9 sequence of LMD-9 1 16628213, and the CRISPR3-Cas system is represented by the Cas9 sequence of LMD-9 1 16627542.

Anti-CRISPR proteins

The invention is directed to proteins, which interfere with a function of a bacterial CRISPR-Cas system involved in the immunity of a bacterial strain against target nucleic acids and their uses in various methods. Such proteins are called herein "anti-CRISPR proteins".

By "interfere with a function of a bacterial CRISPR-Cas system", it is meant that the anti-CRISPR protein as defined herein significantly downmodulates the activity of the CRISPR-Cas system, i.e., decreases, from partial to complete inhibition, the activity of the CRISPR-Cas system. Such downmodulation can be assayed by providing a bacterial strain which is resistant to a given virulent phage, said resistance being mediated by a given CRISPR-Cas system (i.e., the CRISPR array of said given CRISPR-Cas system comprises a spacer corresponding to a protospacer found in the genome of the virulent phage); producing in said bacterial strain an anti-CRISPR protein (interfering with a function of a bacterial CRISPR-Cas system); and exposing said bacterial strain to said given virulent phage, wherein an increase of the titer of said virulent phage by more than 1 Log (i.e. more than 90%) is recorded as compared to a control. In the assay above, the control is the same bacterial strain - but not producing said anti-CRISPR protein - and exposed to the same virulent phage in the same conditions. In an embodiment, the increase in the titer of said virulent phage is more than 95% as compared to a control. In an embodiment, the increase in the titer of said virulent phage is more than 98% as compared to a control. In an embodiment, the increase of the titer of said virulent phage is more than 2 Log (more than 99%) as compared to a control. In an embodiment, the increase in the titer of said virulent phage is more than 3 Log as compared to a control. In an embodiment, the increase in the titer of said virulent phage is more than 4 Log as compared to a control.

As used herein, the term "virulent phage" is synonymous to "infectious phage", and includes both lytic and temperate phages.

As used herein, "exposing a bacterial strain to a phage" means that bacterial cells and phage particles are physically mixed together (e.g., in the same medium) in conditions such that the phage particles are in contact with the bacterial cells.

By "a function of a bacterial CRISPR-Cas system", it is meant "at least one function" of a CRISPR-Cas system, such as for example the adaptation function or the interference function. In an embodiment, the anti-CRISPR protein used herein interferes with the interference function of a CRISPR-Cas system. In an embodiment, the anti-CRISPR protein used herein interferes with the adaptation function of a CRISPR-Cas system. In an embodiment, the anti-CRISPR protein used herein interferes with both the adaptation function and the interference function of a CRISPR-Cas system.

In an embodiment, the anti-CRISPR protein as used herein interferes with a function, in particular with the adaptation function and/or the interference function, of a class 2 CRISPR-Cas system. In an embodiment, the anti-CRISPR protein as defined herein interferes with a function, in particular with the adaptation function and/or the interference function, of a class 2 type II CRISPR-Cas system. In an embodiment, the anti-CRISPR protein as used herein interferes with a function, in particular with the adaptation function and/or the interference function, of a class 2 type ll-A CRISPR-Cas system. In an embodiment, and optionally in combination with any interfered function of the CRISPR-Cas system defined above, said anti-CRISPR protein interferes with a function of a class 2 type II, in particular a class 2 type ll-A CRISPR-Cas system, of a Gram-positive bacterial strain. In an embodiment, said anti-CRISPR protein interferes with a function of a class 2 type II, in particular a class 2 type ll-A CRISPR-Cas system, of a lactic acid bacterial strain. In an embodiment, said anti-CRISPR protein interferes with a function of a class 2 type II, in particular a class 2 type ll-A CRISPR-Cas system, of a Streptococcus species strain. In an embodiment, said anti-CRISPR protein interferes with a function of a class 2 type II, in particular a class 2 type ll-A CRISPR-Cas system, of a Streptococcus thermophilus strain. In an embodiment, said anti-CRISPR protein interferes with a function of a CRISPR1 -Cas system of a Streptococcus thermophilus. In an embodiment, said anti-CRISPR protein interferes with a function of a CRISPR3-Cas system of a Streptococcus thermophilus strain. In an embodiment, said anti-CRISPR protein interferes with a function of a class 2 type II, in particular a class 2 type ll-A CRISPR-Cas system, of a Streptococcus pyogenes strain. In an embodiment, said anti-CRISPR protein interferes with a function of a class 2 type II, in particular a class 2 type ll-A CRISPR-Cas system, of a Staphylococcus species strain. In an embodiment, said anti-CRISPR protein interferes with a function of a class 2 type II, in particular a class 2 type ll-A CRISPR-Cas system, of a Staphylococcus aureus strain.

As discussed herein, the Cas9 protein is the effector molecule found in the class 2 type II CRISPR-Cas systems. Cas9 has been shown to act not only in the interference function but also in the adaptation function of the CRISPR-Cas system, for the immunity against target nucleic acids. In an embodiment, said anti-CRISPR protein as used herein downmodulates the activity of a Cas9 protein or Cas9 derivatives. As defined herein "downmodulating the activity of a Cas9 protein", means that said anti-CRISPR protein decreases, from partial to complete inhibition, at least one of the interference activity of the Cas9 protein or the adaptation activity of the Cas9 protein. In an embodiment, the anti- CRISPR protein downmodulates the adaptation activity of the Cas9 protein. In an embodiment, the anti-CRISPR protein downmodulates the interference activity of the Cas9 protein. In an embodiment, the anti-CRISPR protein downmodulates the adaptation activity and the interference activity of the Cas9 protein.

Cas9 has been shown to display several activities on the target nucleic acid: (1 ) the adaptation-based activity of Cas9, (2) the RuvC-based nuclease activity of Cas9, (3) the HNH-based nuclease activity of Cas9, (4) the REC1 -based recognition activity of Cas9, and (5) the REC2-based recognition activity of Cas9. Thus, in an embodiment, the anti-CRISPR protein downmodulates at least one, in particular one, of the following activities of the Cas9 protein: (1 ) the adaptation-based activity of Cas9, (2) the RuvC-based nuclease activity of Cas9, (3) the HNH-based nuclease activity of Cas9, (4) the REC1 -based recognition activity of Cas9, and (5) the REC2-based recognition activity of Cas9. In an embodiment, the anti- CRISPR protein downmodulates the adaptation-based activity of Cas9 protein. In an embodiment, the anti-CRISPR protein downmodulates the RuvC-based nuclease activity of Cas9 protein. In an embodiment, the anti-CRISPR protein downmodulates the HNH-based nuclease activity of Cas9 protein. In an embodiment, the anti-CRISPR protein downmodulates the REC1 -based recognition activity of Cas9 protein. In an embodiment, the anti-CRISPR protein downmodulates the REC2-based recognition activity of Cas9 protein.

In an embodiment, and optionally in combination with any downmodulated subactivities of the Cas9 protein defined above, said anti-CRISPR protein downmodulates the activity of a Cas9 protein of a Gram-positive bacterial strain. In an embodiment, said anti- CRISPR protein downmodulates the activity of a Cas9 protein of a lactic acid bacterial strain. In an embodiment, said anti-CRISPR protein downmodulates the activity of a Cas9 protein of a Streptococcus species strain. In an embodiment, said anti-CRISPR protein downmodulates the activity of a Cas9 protein of a Streptococcus thermophilus strain. In an embodiment, said anti-CRISPR protein downmodulates the activity of the Cas9 protein of a CRISPR1 -Cas system of a Streptococcus thermophilus. In an embodiment, said anti-CRISPR protein downmodulates the activity of the Cas9 protein of a CRISPR3-Cas system of a Streptococcus thermophilus. In an embodiment, said anti-CRISPR protein downmodulates the activity of a Cas9 protein of a Streptococcus pyogenes strain. In an embodiment, said anti-CRISPR protein downmodulates the activity of a Cas9 protein of a Staphylococcus species strain. In an embodiment, said anti-CRISPR protein downmodulates the activity of a Cas9 protein of a Staphylococcus aureus strain.

The downmodulation of the activity of a Cas9 protein (including its several activites described herein) can be assayed by providing a bacterial strain which is resistant to a given virulent phage, said resistance being mediated by a given class 2 type II CRISPR-Cas sytem (i.e., the CRISPR array of said given class 2 type II CRISPR-Cas system comprises a spacer corresponding to a protospacer found in the genome of the virulent phage); producing in said bacterial strain an anti-CRISPR protein (interfering with a function of a bacterial CRISPR-Cas system); and exposing said bacterial strain to said given virulent phage, wherein an increase of the titer of said virulent phage by more than 1 Log (i.e. more than 90%) is recorded as compared to a control. In the assay above, the control is the same bacterial strain - but not producing said anti-CRISPR protein - and exposed to the same virulent phage in the same conditions. In an embodiment, the increase in the titer of said virulent phage is more than 95% as compared to a control. In an embodiment, the increase in the titer of said virulent phage is more than 98% as compared to a control. In an embodiment, the increase of the titer of said virulent phage is more than 2 Log (more than 99%) as compared to a control. In an embodiment, the increase in the titer of said virulent phage is more than 3 Log as compared to a control. In an embodiment, the increase in the titer of said virulent phage is more than 4 Log as compared to a control.

By "Cas9 derivatives", it is meant a Cas9, which is devoid of at least one of its activities, such as for example a Cas9 protein devoid of its nuclease activity (a nuclease-null Cas9, also known as "dCas9").

Some anti-CRISPR proteins, which have been shown to interfere with a function of a

CRISPR-Cas system, in particular a class 2 type II CRISPR-Cas system, more particularly a class 2 type ll-A CRISPR-Cas system, are described herein. These anti-CRISPR proteins as such are part of the invention, and can be used in the methods of the invention. In an embodiment, the invention is directed to a protein, which has the sequence as defined in a SEQ ID NO of a Acr family selected from the group consisting of Acr1 , Acr2, Acr3, Acr4, Acr5, Acr6, Acr7, Acr8, Acr9, Acr10, Acr1 1 , Acr12, Acr13, Acr14, Acr15, Acr16, Acr17, Acr18, Acr19, Acr20, Acr21 , Acr22, Acr23, Acr24, Acr25, Acr26, Acr27, Acr28, Acr29, Acr30, Acr31 , Acr32, Acr33, Acr34, Acr35, Acr36, Acr37, Acr38, Acr39, Acr40, Acr41 , Acr42, Acr43, Acr44, Acr45, Acr46, Acr47, Acr48, Acr49, Acr50, Acr51 , Acr52, Acr53, Acr54, Acr55, Acr56, Acr57, Acr58, Acr59, Acr60, Acr61 , Acr62, Acr63, Acr64, Acr65, Acr66, Acr67, Acr68, Acr69, Acr70, Acr71 , Acr72, Acr73, Acr74, Acr75, Acr76, Acr77, Acr78, Acr79, Acr80, Acr81 , Acr82, Acr83, Acr84, Acr85 and Acr86 families of Table 1 (i.e., selected from the group consisting of Acr1 to Acr86 families of Table 1 ).

Acr9 SEQ ID NO:159, 161, 163 SEQ ID NO:160, 162, 164

AcrlO SEQ ID NO:165 SEQ ID NO:166

Acrll SEQ ID NO:167, 169 SEQ ID NO:168, 170

Acrl2 SEQ ID N0:171, 173, 175, 177, 179, 181, SEQ ID NO:172, 174, 176, 178, 180, 182,

183, 185, 187, 189, 191, 193, 195, 197, 184, 186, 188, 190, 192, 194, 196, 198, 199, 201, 203, 205, 207, 209, 211, 213, 200, 202, 204, 206, 208, 210, 212, 214, 215, 217, 219, 221, 223, 225, 227, 229, 216, 218, 220, 222, 224, 226, 228, 230, 231 232

Acrl3 SEQ ID NO:233 SEQ ID NO:234

Acrl4 SEQ ID NO:235, 237, 239, 241, 243 SEQ ID NO:236, 238, 240, 242, 244

Acrl5 SEQ ID NO:245, 247, 249, 251, 253, 255, SEQ ID NO:246, 248, 250, 252, 254, 256,

257, 259 258, 260

Acrl6 SEQ ID NO:261, 263, 265 SEQ ID NO:262, 264, 266

Acrl7 SEQ ID NO:267 SEQ ID NO:268

Acrl8 SEQ ID NO:269, 271 SEQ ID NO:270, 272

Acrl9 SEQ ID NO:273 SEQ ID NO:274

Acr20 SEQ ID NO:275 SEQ ID NO:276

Acr21 SEQ ID NO:277, 279 SEQ ID NO:278, 280

Acr22 SEQ ID NO:281 SEQ ID NO:282

Acr23 SEQ ID NO:283, 285, 287, 289, 291, 293, SEQ ID NO:284, 286, 288, 290, 292, 294,

295, 297, 299, 301, 303 296, 298, 300, 302, 304

Acr24 SEQ ID NO:305, 307, 309, 311, 313, 315, SEQ ID NO:306, 308, 310, 312, 314, 316,

317, 319, 321, 323 318, 320, 322, 324

Acr25 SEQ ID NO:325, 327, 329, 331, 333, 335 SEQ ID NO:326, 328, 330, 332, 334, 336

Acr26 SEQ ID NO:337, 339, 341, 343 SEQ ID NO:338, 340, 342, 344

Acr27 SEQ ID NO:345, 347, 349, 351, 353, 355 SEQ ID NO:346, 348, 350, 352, 354, 356

Acr28 SEQ ID NO:357, 359, 361, 363, 365 SEQ ID NO:358, 360, 362, 364, 366

Acr29 SEQ ID NO:367 SEQ ID NO:368

Acr30 SEQ ID NO:369, 371 SEQ ID NO:370, 372

Acr31 SEQ ID NO:373 SEQ ID NO:374

Acr32 SEQ ID NO:375 SEQ ID NO:376

Acr33 SEQ ID NO:377 SEQ ID NO:378

Acr34 SEQ ID NO:379 SEQ ID NO:380

Acr35 SEQ ID NO:381 SEQ ID NO:382

Acr36 SEQ ID NO:383 SEQ ID NO:384

Acr37 SEQ ID NO:385 SEQ ID NO:386

Acr38 SEQ ID NO:387 SEQ ID NO:388

Acr39 SEQ ID NO:389 SEQ ID NO:390

Acr40 SEQ ID NO:391 SEQ ID NO:392

Acr41 SEQ ID NO:393 SEQ ID NO:394

Acr42 SEQ ID NO:395 SEQ ID NO:396

Acr43 SEQ ID NO:397 SEQ ID NO:398

Acr44 SEQ ID NO:399 SEQ ID NO:400

Acr45 SEQ ID NO:401 SEQ ID NO:402

Acr46 SEQ ID NO:403 SEQ ID NO:404

Acr47 SEQ ID NO:405 SEQ ID NO:406

Acr48 SEQ ID NO:407 SEQ ID NO:408

Acr49 SEQ ID NO:409 SEQ ID NO:410 Acr50 SEQ ID N0:411, 413 SEQ ID NO:412, 414

Acr51 SEQ ID NO:415 SEQ ID NO:416

Acr52 SEQ ID NO:417 SEQ ID NO:418

Acr53 SEQ ID NO:419 SEQ ID NO:420

Acr54 SEQ ID NO:421 SEQ ID NO:422

Acr55 SEQ ID NO:423 SEQ ID NO:424

Acr56 SEQ ID NO:425 SEQ ID NO:426

Acr57 SEQ ID NO:427, 429 SEQ ID NO:428, 430

Acr58 SEQ ID NO:431 SEQ ID NO:432

Acr59 SEQ ID NO:433 SEQ ID NO:434

Acr60 SEQ ID NO:435, 437 SEQ ID NO:436, 438

Acr61 SEQ ID NO:439, 441 SEQ ID NO:440, 442

Acr62 SEQ ID NO:443 SEQ ID NO:444

Acr63 SEQ ID NO:445 SEQ ID NO:446

Acr64 SEQ ID NO:447 SEQ ID NO:448

Acr65 SEQ ID NO:449, 451, 453, 457, 459 SEQ ID NO:450, 452, 454, 456, 458

Acr66 SEQ ID NO:459 SEQ ID NO:460

Acr67 SEQ ID NO:461, 463, 465 SEQ ID NO:462, 464, 466

Acr68 SEQ ID NO:467 SEQ ID NO:468

Acr 69 SEQ ID NO:469 SEQ ID NO:470

Acr70 SEQ ID NO:471, 473 SEQ ID NO:472, 474

Acr71 SEQ ID NO:475 SEQ ID NO:476

Acr72 SEQ ID NO:477, 479, 481, 483, 485, 487, SEQ ID NO:478, 480, 482, 484, 486, 488,

489 490

Acr73 SEQ ID NO:491, 493, 495, 497, 499, 501 SEQ ID NO:492, 494, 496, 498, 500, 502

Acr74 SEQ ID NO:503, 505, 507, 509, 511, 513 SEQ ID NO:504, 506, 508, 510, 512, 514

Acr75 SEQ ID NO:515 516

Acr76 SEQ ID NO:517 518

Acr77 SEQ ID NO:519 520

Acr78 SEQ ID NO:521 522

Acr79 SEQ ID NO:523, 525, 527, 529, 531, 533, 524, 526, 528, 530, 532, 534, 536

535

Acr80 SEQ ID NO:537 SEQ ID NO:538

Acr81 SEQ ID NO:539 SEQ ID NO:540

Acr82 SEQ ID NO:541 SEQ ID NO:542

Acr83 SEQ ID NO:543, 545 SEQ ID NO:544, 546

Acr84 SEQ ID NO:547 SEQ ID NO:548

Acr85 SEQ ID NO:549 SEQ ID NO:550

Acr86 SEQ ID NO:551 SEQ ID NO:552

Table 1 : Acr families, and corresponding ACR genes and ACR proteins

In an embodiment, the invention is directed to a protein, which has the sequence as defined in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552. In an embodiment, the invention is directed to a protein, which has the sequence as defined in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26. In an embodiment, the invention is directed to a protein, which has the sequence as defined in SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86. In an embodiment, the invention is directed to a protein, which has the sequence as defined in a SEQ ID NO of a Acr family selected from the group consisting of Acr3 to Acr86 families of Table 1. In an embodiment, the invention is directed to a protein, which has the sequence as defined in SEQ ID NO: 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552. In an embodiment, the invention is directed to a protein, which has the sequence as defined in SEQ ID NO: 10 or SEQ ID NO: 28. In an embodiment, the invention is directed to a protein, which has the sequence as defined in SEQ ID NO: 10. In an embodiment, the invention is directed to a protein, which has the sequence as defined in SEQ ID NO: 28. In an embodiment, where an anti-CRISPR protein is specified as having a given amino acid sequence (SEQ ID), it is understood that the anti-CRISPR protein comprises said amino acid sequence. In an embodiment, where an anti-CRISPR protein is specified as having a given amino acid sequence, it is understood that the anti-CRISPR protein consists of said amino acid sequence.

In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552, or has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, or has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86, or has a sequence having at least 90% identity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with SEQ ID NO: 88, 90, 92, 94, 96, 98, 100, 102,

480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552.

In an embodiment, the invention is directed to a protein, which has the sequence having at least 70% similarity with SEQ ID NO: 10 or with SEQ ID NO: 28 or has a sequence having at least 90% identity with SEQ ID NO:10 or with SEQ ID NO:28. In an embodiment, the invention is directed to a protein, which has the sequence having at least 70% similarity with SEQ ID NO: 10 or has a sequence having at least 90% identity with SEQ ID NO:10. the invention is directed to a protein, which has the sequence having at least 70% similarity with SEQ ID NO: 28 or or has a sequence having at least 90% identity with SEQ ID NO:28. When a protein is defined herein by its amino acid sequence having a percentage of identity or percentage of similarity to a specific SEQ ID, these proteins are still functional as anti-CRISPR proteins as defined herein. Thus, a protein defined by an amino acid sequence having a percentage of identity or percentage of similarity to a specific SEQ ID keeps an anti-CRISPR functionality, i.e., keeps the ability to interfere with a function of a bacterial CRISPR-Cas system (as defined herein).

In an embodiment, a protein defined by an amino acid sequence having a percentage of identity or percentage of similarity to a specific SEQ ID keeps the anti-CRISPR functionality of the protein it is identical or similar to. In an embodiment, a protein defined by an amino acid sequence having a percentage of identity or percentage of similarity to a specific SEQ ID keeps at least one, in particular 1 , 2 or 3, in particular all, of the following features of the protein it is identical or similar to:

- it interferes with the same function(s) of a CRISPR-Cas system as the protein it is identical or similar to (in particular with the interference function and/or the adaptation function);

- it interferes with the same CRISPR-Cas system type as the protein they are identical or similar to (in particular with a class 2 CRISPR-Cas system, with a class 2 type II CRISPR-Cas system, with a class 2 type ll-A CRISPR-Cas system);

- if applicable, it downmodulates the activity of a Cas9 protein, if the protein - it is identical or similar to - downmodulates the activity of a Cas9 protein;

- if applicable, it downmodulates the same subactivity(ies) of a Cas9 protein as the protein it is identical or similar (if this protein downmodulates the activity of a Cas9 protein). In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552, or has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552, wherein said protein interferes with the interference function of a class 2 type II CRISPR-Cas system. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with a SEQ ID NO of a Acr family selected from the group consisting of Acr1 to Acr86 families of Table 1 , or has a sequence having at least 90% identity with a SEQ ID NO of a Acr family selected from the group consisting of Acr1 to Acr86 families of Table 1 , wherein said protein interferes with the interference function of a class 2 type II CRISPR-Cas system. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with or has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552, wherein said protein interferes with the interference function of a class 2 type ll-A CRISPR-Cas system. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with or has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552, wherein said protein downmodulates the activity of the Cas9 protein of a class 2 type II CRISPR-Cas system. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with or has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552, wherein said protein downmodulates the activity of the Cas9 protein of a class 2 type ll-A CRISPR-Cas system. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with or has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552, wherein said protein downmodulates the activity of the Cas9 protein of a class 2 type ll-A CRISPR-Cas system of a Streptococcus species strain. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with or has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552, wherein said protein downmodulates the activity of the Cas9 protein of a class 2 type ll-A CRISPR-Cas system of a Streptococcus thermophilus. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with or has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552, wherein said protein downmodulates the activity of the Cas9 protein of a CRISPR1 -Cas system of a Streptococcus thermophilus. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with or has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552, wherein said protein downmodulates the activity of the Cas9 protein of a CRISPR3-Cas system of a Streptococcus thermophilus. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with or has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552, wherein said protein downmodulates the activity of the Cas9 protein of a class 2 type ll-A CRISPR- Cas system of a Streptococcus pyogenes. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with or has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552, wherein said protein downmodulates the activity of the Cas9 protein of a class 2 type II- A CRISPR-Cas system of a Staphylococcus species strain. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with or has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552, wherein said protein downmodulates the activity of the Cas9 protein of a class 2 type ll-A CRISPR-Cas system of a Staphylococcus aureus. In an embodiment, a protein which has a sequence having at least 70% similarity with

SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552 encompasses a protein which has a sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% similarity respectively with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552. In an embodiment, a protein which has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552 encompasses a protein which has a sequence having at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% similarity respectively with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552. In an embodiment, where an anti-CRISPR protein is specified as having an amino acid sequence similar to or identical to a given SEQ ID, it is understood that the anti-CRISPR protein comprises said amino acid sequence. In an embodiment, where an anti-CRISPR protein is specified as having an amino acid sequence similar to or identical to a given SEQ ID, it is understood that the anti-CRISPR protein consists of said amino acid sequence.

A protein which has a sequence having at least 70% similarity with SEQ ID NO: 2, 4,

6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552 as defined herein or which has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552 may differ from SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552 by 1 to 15 amino acid residues, 1 to 10, such as 6 to 10, less than or equals to 5, less than or equals to 4, 3, 2, or even 1 amino acid residue.

Sequences as defined in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86 have been shown to contain a coiled-coil motif which is expected to act in a nucleic acid binding role. Thus, in an embodiment, a protein which has a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86 as defined herein or which has sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86 as defined herein keeps a functional coiled-coil motif as found in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, or has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, wherein said protein interferes with the interference function of a class 2 type II CRISPR-Cas system. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, or has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, wherein said protein interferes with the interference function of a class 2 type ll-A CRISPR-Cas system. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, or has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, wherein said protein downmodulates the activity of the Cas9 protein of a class 2 type II CRISPR-Cas system. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, or has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, wherein said protein downmodulates the activity of the Cas9 protein of a class 2 type ll-A CRISPR-Cas system. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, or has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, wherein said protein downmodulates the activity of the Cas9 protein of a class 2 type ll-A CRISPR-Cas system of a Streptococcus species strain. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, or has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, wherein said protein downmodulates the activity of the Cas9 protein of a class 2 type ll-A CRISPR-Cas system of a Streptococcus thermophilus. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, or has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, wherein said protein downmodulates the activity of the Cas9 protein of a CRISPR1 -Cas system of a Streptococcus thermophilus. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, or has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, wherein said protein downmodulates the activity of the Cas9 protein of a CRISPR3-Cas system of a Streptococcus an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, or has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, wherein said protein downmodulates the activity of the Cas9 protein of a class 2 type ll-A CRISPR-Cas system of a Streptococcus pyogenes. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, or has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, wherein said protein downmodulates the activity of the Cas9 protein of a class 2 type ll-A CRISPR-Cas system of a Staphylococcus species strain. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, or has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, wherein said protein downmodulates the activity of the Cas9 protein of a class 2 type ll-A CRISPR-Cas system of a Staphylococcus aureus.

In an embodiment, a protein which has a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26 encompasses a protein which has a sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% similarity respectively with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26. In an embodiment, a protein which has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26 encompasses a protein which has a sequence having at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% similarity respectively with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26. In an embodiment, where an anti- CRISPR protein is specified as having an amino acid sequence similar to or identical to a given SEQ ID, it is understood that the anti-CRISPR protein comprises said amino acid sequence. In an embodiment, where an anti-CRISPR protein is specified as having an amino acid sequence similar to or identical to a given SEQ ID, it is understood that the anti-CRISPR protein consists of said amino acid sequence.

A protein which has a sequence having at least 70% similarity with SEQ ID NO: 2, 4,

6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26 as defined herein or which has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26 may differ from SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26 by 1 to 15 amino acid residues, 1 to 10, such as 6 to 10, less than or equals to 5, less than or equals to 4, 3, 2, or even 1 amino acid residue. Sequences as defined in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26 have been shown to contain a coiled-coil motif which is expected to act in a nucleic acid binding role. Thus, in an embodiment, a protein which has a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26 as defined herein or which has sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26 as defined herein keeps a functional coiled-coil motif as found in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26.

In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86, or has a sequence having at least 90% identity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86, wherein said protein interferes with the interference function of a class 2 type II CRISPR-Cas system. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86, or has a sequence having at least 90% identity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86, wherein said protein interferes with the interference function of a class 2 type ll-A CRISPR-Cas system. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86, or has a sequence having at least 90% identity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86, wherein said protein downmodulates the activity of the Cas9 protein of a class 2 type II CRISPR-Cas system. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86, or has a sequence having at least 90% identity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86, wherein said protein downmodulates the activity of the Cas9 protein of a class 2 type ll-A CRISPR-Cas system. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86, or has a sequence having at least 90% identity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86, wherein said protein downmodulates the activity of the Cas9 protein of a class 2 type ll-A CRISPR-Cas system of a Streptococcus species strain. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86, or has a sequence having at least 90% identity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86, wherein said protein downmodulates the activity of the Cas9 protein of a class 2 type ll-A CRISPR-Cas system of a Streptococcus thermophilus. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86, or has a sequence having at least 90% identity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86, wherein said protein downmodulates the activity of the Cas9 protein of a CRISPR1 -Cas system of a Streptococcus thermophilus. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86, or has a sequence having at least 90% identity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86, wherein said protein downmodulates the activity of the Cas9 protein of a CRISPR3-Cas system of a Streptococcus thermophilus.\n an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86, or has a sequence having at least 90% identity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86, wherein said protein downmodulates the activity of the Cas9 protein of a class 2 type ll-A CRISPR-Cas system of a Streptococcus pyogenes. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86, or has a sequence having at least 90% identity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86, wherein said protein downmodulates the activity of the Cas9 protein of a class 2 type II- A CRISPR-Cas system of a Staphylococcus species strain. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86, or has a sequence having at least 90% identity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86, wherein said protein downmodulates the activity of the Cas9 protein of a class 2 type ll-A CRISPR-Cas system of a Staphylococcus aureus.

In an embodiment, a protein which has a sequence having at least 70% similarity with

SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86 encompasses a protein which has a sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% similarity respectively with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86. In an embodiment, a protein which has a sequence having at least 90% identity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86 encompasses a protein which has a sequence having at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% similarity respectively with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86. In an embodiment, where an anti-CRISPR protein is specified as having an amino acid sequence similar to or identical to a given SEQ ID, it is understood that the anti-CRISPR protein comprises said amino acid sequence. In an embodiment, where an anti-CRISPR protein is specified as having an amino acid sequence similar to or identical to a given SEQ ID, it is understood that the anti-CRISPR protein consists of said amino acid sequence.

A protein which has a sequence having at least 70% similarity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86 as defined herein or which has a sequence having at least 90% identity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86 may differ from SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86 by 1 to 15 amino acid residues, 1 to 10, such as 6 to 10, less than or equals to 5, less than or equals to 4, 3, 2, or even 1 amino acid residue.

In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with or has a sequence having at least 90% identity with SEQ ID NO: 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552, wherein said protein interferes with the interference function of a class 2 type II CRISPR-Cas system. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with a SEQ ID NO of a Acr family selected from the group consisting of Acr3 to Acr86 families of Table 1 , wherein said protein interferes with the interference function of a class 2 type II CRISPR-Cas system. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with or has a sequence having at least 90% identity with SEQ ID NO: 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552, wherein said protein interferes with the interference function of a class 2 type ll-A CRISPR-Cas system. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with a SEQ ID NO of a Acr family selected from the group consisting of Acr3 to Acr86 families of Table 1 , wherein said protein interferes with the interference function of a class 2 type ll-A CRISPR-Cas system. In an embodiment, the invention is also directed to a protein which has a sequence having at least 70% similarity with or has a sequence having at least 90% identity with SEQ ID NO: 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552, wherein said protein downmodulates the activity of the Cas9 protein of a class 2 type IlA CRISPR-Cas system, in particular of the Cas9 protein of a class 2 type ll-A CRISPR-Cas system of a Streptococcus strain, more particularly of a Streptococcus thermophilus strain or of a Streptococcus pyogenes strain.

In an embodiment, a protein which has a sequence having at least 70% similarity with SEQ ID NO: 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552 encompasses a protein which has a sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% similarity respectively with SEQ ID NO: 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552. In an embodiment, a protein which has a sequence having at least 90% identity with SEQ ID NO: 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552 encompasses a protein which has a sequence having at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% similarity respectively with SEQ ID NO: 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552. In an embodiment, where an anti-CRISPR protein is specified as having an amino acid sequence similar to or identical to a given SEQ ID, it is understood that the anti-CRISPR protein comprises said amino acid sequence. In an embodiment, where an anti-CRISPR protein is specified as having an amino acid sequence similar to or identical to a given SEQ ID, it is understood that the anti-CRISPR protein consists of said amino acid sequence.

A protein which has a sequence having at least 70% similarity with 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552 as defined herein or which has a sequence having at least 90% identity with SEQ ID NO: 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552 may differ from SEQ ID NO: 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552 by 1 to 15 amino acid residues, 1 to 10, such as 6 to 10, less than or equals to 5, less than or equals to 4, 3, 2, or even 1 amino acid residue. Preferably, reference to a sequence which has a percentage identity or similarity to any one of the SEQ ID NOs detailed herein refers to a sequence which has the stated percent identity or similarity with the SEQ ID NO referred to, over the entire length of the two sequences. Percentage (%) sequence identity is defined as the percentage of amino acids or nucleotides in a candidate sequence that are identical to the amino acids or nucleotides in a reference sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. Percentage (%) sequence similarity is defined as the percentage of amino acids in a candidate sequence that are similar to the amino acids in a reference sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence similarity. Similarity between amino acids is based on established amino acid substitution matrices such as the PAM series (Point Accepted Mutation; e.g. PAM30, PAM70, and PAM250) or the BLOSUM series (BLOck Substitution Matrix; e.g. BLOSUM45, BLOSUM50, BLOSUM62, BLOSUM80, and BLOSUM90). Alignment for purposes of determining percent sequence identity or similarity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as CLUSTALW, CLUSTALX, CLUSTAL Omega, BLAST, BLAST-2, ALIGN, ALIGN-2 or Megalign (DNASTAR) software. In an embodiment, similarity between amino acids is determined using the BLASTp software with the BLOSUM62 matrix. Appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared, or gap penalties to be introduced, can be determined by known methods.

Guidance as to appropriate amino acid substitutions that do not affect biological activity of the protein of interest may be found in the model of Dayhoff et al. (1978) Atlas of Protein Sequence and Structure (Natl. Biomed. Res. Found., Washington, D.C.). Conservative substitutions, such as exchanging one amino acid with another having similar properties, may be optimal.

Anti-CRISPR genes, constructs and vectors

Any gene encoding a protein, which interferes with a function of a CRISPR-Cas system (herein defined as an anti-CRISPR protein) can be obtained and used in the methods of the invention. These genes are called anti-CRISPR genes.

Some anti-CRISPR genes are described herein and are as such part of the invention, and can be used in the methods of the invention. In an embodiment, the invention is directed to a gene coding for an anti-CRISPR protein as defined herein (under the anti-CRISPR proteins pargraph). In an embodiment, the invention is directed to a gene coding for a protein having the sequence as defined in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552, or for a protein having a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552, or for a protein having a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552.

In an embodiment, said anti-CRISPR gene has the sequence as defined in a SEQ ID NO of a Acr family selected from the group consisting of Acr1 , Acr2, Acr3, Acr4, Acr5, Acr6, Acr7, Acr8, Acr9, Acr10, Acr1 1 , Acr12, Acr13, Acr14, Acr15, Acr16, Acr17, Acr18, Acr19, Acr20, Acr21 , Acr22, Acr23, Acr24, Acr25, Acr26, Acr27, Acr28, Acr29, Acr30, Acr31 , Acr32, Acr33, Acr34, Acr35, Acr36, Acr37, Acr38, Acr39, Acr40, Acr41 , Acr42, Acr43, Acr44, Acr45, Acr46, Acr47, Acr48, Acr49, Acr50, Acr51 , Acr52, Acr53, Acr54, Acr55, Acr56, Acr57, Acr58, Acr59, Acr60, Acr61 , Acr62, Acr63, Acr64, Acr65, Acr66, Acr67, Acr68, Acr69, Acr70, Acr71 , Acr72, Acr73, Acr74, Acr75, Acr76, Acr77, Acr78, Acr79, Acr80, Acr81 , Acr82, Acr83, Acr84, Acr85 and Acr86 families of Table 1 (i.e., selected from the group consisting of Acr1 to Acr86 families). In an embodiment, said anti-CRISPR gene has the sequence as defined in SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, 167, 169, 171, 173, 175, 177, 179, 181, 183, 185, 187, 189, 191, 193, 195, 197, 199, 201, 203, 205, 207, 209, 211, 213, 215, 217, 219, 221, 223, 225, 227, 229, 231, 233, 235, 237, 239, 241, 243, 245, 247, 249, 251, 253, 255, 257, 259, 261, 263, 265, 267, 269, 271, 273, 275, 277, 279, 281, 283, 285, 287, 289, 291, 293, 295, 297, 299, 301, 303, 305, 307, 309, 311, 313, 315, 317, 319, 321, 323, 325, 327, 329, 331, 333, 335, 337, 339, 341, 343, 345, 347, 349, 351, 353, 355, 357, 359, 361, 363, 365, 367, 369, 371, 373, 375, 377, 379, 381, 383, 385, 387, 389, 391, 393, 395, 397, 399, 401, 403, 405, 407, 409, 411, 413, 415, 417, 419, 421, 423, 425, 427, 429, 431, 433, 435, 437, 439, 441, 443, 445, 447, 449, 451, 453, 455, 457, 459, 461, 463, 465, 467, 469, 471, 473, 475, 477, 479, 481, 483, 485, 487, 489, 491, 493, 495, 497, 499, 501, 503, 505, 507, 509, 511, 513, 515, 517, 519, 521, 523, 525, 527, 529, 531, 533, 535, 537, 539, 541, 543, 545, 547, 549 or 551. The invention is also directed to conservative variants of SEQ ID NO: 1 , 3, 5, 7, 9, 11 , 13, 15, 17, 19, 21 , 23, 25, 27, 29, 31 , 33, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, 167, 169, 171, 173, 175, 177, 179, 181, 183, 185, 187, 189, 191, 193, 195, 197, 199, 201, 203, 205, 207, 209, 211, 213, 215, 217, 219, 221, 223, 225, 227, 229, 231, 233, 235, 237, 239, 241, 243, 245, 247, 249, 251, 253, 255, 257, 259, 261, 263, 265, 267, 269, 271, 273, 275, 277, 279, 281, 283, 285, 287, 289, 291, 293, 295, 297, 299, 301, 303, 305, 307, 309, 311, 313, 315, 317, 319, 321, 323, 325, 327, 329, 331, 333, 335, 337, 339, 341, 343, 345, 347, 349, 351, 353, 355, 357, 359, 361, 363, 365, 367, 369, 371, 373, 375, 377, 379, 381, 383, 385, 387, 389, 391, 393, 395, 397, 399, 401, 403, 405, 407, 409, 411, 413, 415, 417, 419, 421, 423, 425, 427, 429, 431, 433, 435, 437, 439, 441, 443, 445, 447, 449, 451, 453, 455, 457, 459, 461, 463, 465, 467, 469, 471, 473, 475, 477, 479, 481, 483, 485, 487, 489, 491, 493, 495, 497, 499, 501, 503, 505, 507, 509, 511, 513, 515, 517, 519, 521, 523, 525, 527, 529, 531, 533, 535, 537, 539, 541, 543, 545, 547, 549 or 551, because of the degeneracy of the genetic code. Thus, the invention is also directed to any conservative variants of SEQ ID NO: 1 , 3, 5, 7, 9, 11 , 13, 15, 17, 19, 21 , 2325, 27, 29, 31 , 33, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, 167, 169, 171, 173, 175, 177, 179, 181, 183, 185, 187, 189, 191, 193, 195, 197, 199, 201, 203, 205, 207, 209, 211, 213, 215, 217, 219, 221, 223, 225, 227, 229, 231, 233, 235, 237, 239, 241, 243, 245, 247, 249, 251, 253, 255, 257, 259, 261, 263, 265, 267, 269, 271, 273, 275, 277, 279, 281, 283, 285, 287, 289, 291, 293, 295, 297, 299, 301, 303, 305, 307, 309, 311, 313, 315, 317, 319, 321, 323, 325, 327, 329, 331, 333, 335, 337, 339, 341, 343, 345, 347, 349, 351, 353, 355, 357, 359, 361, 363, 365, 367, 369, 371, 373, 375, 377, 379, 381, 383, 385, 387, 389, 391, 393, 395, 397, 399, 401, 403, 405, 407, 409, 411, 413, 415, 417, 419, 421, 423, 425, 427, 429, 431, 433, 435, 437, 439, 441, 443, 445, 447, 449, 451, 453, 455, 457, 459, 461, 463, 465, 467, 469, 471, 473, 475, 477, 479, 481, 483, 485, 487, 489, 491, 493, 495, 497, 499, 501, 503, 505, 507, 509, 511, 513, 515, 517, 519, 521, 523, 525, 527, 529, 531, 533, 535, 537, 539, 541, 543, 545, 547, 549 or 551, as long as said variants encode respectively an anti-CRISPR protein as defined in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 110, 112, 114, 116, 118, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552.

In an embodiment, the invention is directed to a gene coding for an anti-CRISPR protein as defined herein, i.e., a gene encoding a protein having the sequence as defined in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, or for a protein having a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, or for a protein having a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26. In an embodiment, said anti-CRISPR gene has the sequence as defined in SEQ ID NO: 1 , 3, 5, 7, 9, 1 1 , 13, 15, 17, 19, 21 , 23 or 25. The invention is also directed to conservative variants of SEQ ID NO: 1 , 3, 5, 7, 9, 1 1 , 13, 15, 17, 19, 21 , 23 or 25, because of the degeneracy of the genetic code. Thus, the invention is also directed to any conservative variants of SEQ ID NO: 1 , 3, 5, 7, 9, 1 1 , 13, 15, 17, 19, 21 , 23 or 25, as long as said variants encode respectively an anti-CRISPR protein as defined in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26. In an embodiment, the invention is directed to a gene coding for an anti-CRISPR protein as defined herein, i.e., a gene encoding a protein having the sequence as defined in SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86, or for a protein having a sequence having at least 70% similarity with SEQ ID NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86, or for a protein having a sequence having at least 90% identity with SEQ ID NO: 28, 30, 32, 34, 36,

38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84 or 86. In an embodiment, said anti-CRISPR gene has the sequence as defined in SEQ ID NO: 27, 29, 31 , 33, 35, 37, 39, 41 , 43, 45, 47, 49, 51 , 53, 55, 57, 59, 61 , 63, 65, 67, 69, 71 , 73, 75, 77, 79, 81 , 83 or 85. The invention is also directed to conservative variants of SEQ ID NO: 27, 29, 31 , 33, 35, 37, 39, 41 , 43, 45, 47, 49, 51 , 53, 55, 57, 59, 61 , 63, 65, 67, 69, 71 ,

73, 75, 77, 79, 81 , 83 or 85, because of the degeneracy of the genetic code. Thus, the invention is also directed to any conservative variants of SEQ ID NO: 27, 29, 31 , 33, 35, 37,

39, 41 , 43, 45, 47, 49, 51 , 53, 55, 57, 59, 61 , 63, 65, 67, 69, 71 , 73, 75, 77, 79, 81 , 83 or 85, as long as said variants encode respectively an anti-CRISPR protein as defined in SEQ ID

NO: 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72,

74, 76, 78, 80, 82, 84 or 86. In an embodiment, the invention is directed to a gene coding for an anti-CRISPR protein as defined herein, i.e., a gene encoding a protein having the sequence as defined in SEQ ID NO: 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552, or for a protein having a sequence having at least 70% similarity with SEQ ID NO: 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552, or for a protein having a sequence having at least 90% identity with SEQ ID NO: 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552. In an embodiment, said anti-CRISPR gene has the sequence as defined in a SEQ ID NO of a Acr family selected from the group consisting of Acr3 to Acr86 families of Table 1. In an embodiment, said anti-CRISPR gene has the sequence as defined in SEQ ID NO: 87, 89, 91,93, 95, 97,99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, 167, 169, 171, 173, 175, 177, 179, 181, 183, 185, 187, 189, 191, 193, 195, 197, 199, 201, 203, 205, 207, 209, 211, 213, 215, 217, 219, 221, 223, 225, 227, 229, 231, 233, 235, 237, 239, 241, 243, 245, 247, 249, 251, 253, 255, 257, 259, 261, 263, 265, 267, 269, 271, 273, 275, 277, 279, 281, 283, 285, 287, 289, 291, 293, 295, 297, 299, 301, 303, 305, 307, 309, 311, 313, 315, 317, 319, 321, 323, 325, 327, 329, 331, 333, 335, 337, 339, 341, 343, 345, 347, 349, 351, 353, 355, 357, 359, 361, 363, 365, 367, 369, 371, 373, 375, 377, 379, 381, 383, 385, 387, 389, 391, 393, 395, 397, 399, 401, 403, 405, 407, 409, 411, 413, 415, 417, 419, 421, 423, 425, 427, 429, 431, 433, 435, 437, 439, 441, 443, 445, 447, 449, 451, 453, 455, 457, 459, 461, 463, 465, 467, 469, 471, 473, 475, 477, 479, 481, 483, 485, 487, 489, 491, 493, 495, 497, 499, 501, 503, 505, 507, 509, 511, 513, 515, 517, 519, 521, 523, 525, 527, 529, 531, 533, 535, 537, 539, 541, 543, 545, 547, 549 or 551. The invention is also directed to conservative variants of SEQ ID NO: 87, 89, 91, 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, 167, 169, 171, 173, 175, 177, 179, 181, 183, 185, 187, 189, 191, 193, 195, 197, 199, 201, 203, 205, 207, 209, 211, 213, 215, 217, 219, 221, 223, 225, 227, 229, 231, 233, 235, 237, 239, 241, 243, 245, 247, 249, 251, 253, 255, 257, 259, 261, 263, 265, 267, 269, 271, 273, 275, 277, 279, 281, 283, 285, 287, 289, 291, 293, 295, 297, 299, 301, 303, 305, 307, 309, 311, 313, 315, 317, 319, 321, 323, 325, 327, 329, 331, 333, 335, 337, 339, 341, 343, 345, 347, 349, 351, 353, 355, 357, 359, 361, 363, 365, 367, 369, 371, 373, 375, 377, 379, 381, 383, 385, 387, 389, 391, 393, 395, 397, 399, 401, 403, 405, 407, 409, 411, 413, 415, 417, 419, 421, 423, 425, 427, 429, 431, 433, 435, 437, 439, 441, 443, 445, 447, 449, 451, 453, 455, 457, 459, 461, 463, 465, 467, 469, 471, 473, 475, 477, 479, 481, 483, 485, 487, 489, 491, 493, 495, 497, 499, 501, 503, 505, 507, 509, 511, 513, 515, 517, 519, 521, 523, 525, 527, 529, 531, 533, 535, 537, 539, 541 , 543, 545, 547, 549 or 551 as defined herein. Thus, the invention is also directed to any conservative variants of SEQ ID NO: 87, 89, 91, 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, 167, 169, 171, 173, 175, 177, 179, 181, 183, 185, 187, 189, 191, 193, 195, 197, 199, 201, 203, 205, 207, 209, 211, 213, 215, 217, 219, 221, 223, 225, 227, 229, 231, 233, 235, 237, 239, 241, 243, 245, 247, 249, 251, 253, 255, 257, 259, 261 , 263, 265, 267, 269, 271 , 273, 275, 277, 279, 281 , 283, 285, 287, 289, 291 , 293, 295, 297, 299, 301 , 303, 305, 307, 309, 31 1 , 313, 315, 317, 319, 321 , 323, 325, 327, 329, 331 , 333, 335, 337, 339, 341 , 343, 345, 347, 349, 351 , 353, 355, 357, 359, 361 , 363, 365, 367, 369, 371 , 373, 375, 377, 379, 381 , 383, 385, 387, 389, 391 , 393, 395, 397, 399, 401 , 403, 405, 407, 409, 41 1 , 413, 415, 417, 419, 421 , 423, 425, 427, 429, 431 , 433, 435, 437, 439, 441 , 443, 445, 447, 449, 451 , 453, 455, 457, 459, 461 , 463, 465, 467, 469, 471 , 473, 475, 477, 479, 481 , 483, 485, 487, 489, 491 , 493, 495, 497, 499, 501 , 503, 505, 507, 509, 51 1 , 513, 515, 517, 519, 521 , 523, 525, 527, 529, 531 , 533, 535, 537, 539, 541 , 543, 545, 547, 549 or 551 , as long as said variants encode respectively an anti-CRISPR protein as defined in SEQ ID NO: 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552.

In an embodiment, the invention is directed to a gene coding for an anti-CRISPR protein as defined herein, i.e., a gene encoding a protein having the sequence as defined in SEQ ID NO: 10 or 28, or for a protein having a sequence having at least 70% similarity with SEQ ID NO: 10 or 28, or for a protein having a sequence having at least 90% identity with SEQ ID NO: 10 or 28. In an embodiment, said anti-CRISPR gene has the sequence as defined in SEQ ID NO: 9 or 27. The invention is also directed to conservative variants of SEQ ID NO: 9 or 27 as long as said variants encode respectively an anti-CRISPR protein as defined in SEQ ID NO: 10 or 28. In an embodiment, the invention is directed to a gene coding for an anti-CRISPR protein as defined herein, i.e., a gene encoding a protein having the sequence as defined in SEQ ID NO: 10, or for a protein having a sequence having at least 70% similarity with SEQ ID NO: 10, or for a protein having a sequence having at least 90% identity with SEQ ID NO: 10. In an embodiment, said anti-CRISPR gene has the sequence as defined in SEQ ID NO: 9. The invention is also directed to conservative variants of SEQ ID NO:9 as long as said variants encode respectively an anti-CRISPR protein as defined in SEQ ID NO: 10. In an embodiment, the invention is directed to a gene coding for an anti- CRISPR protein as defined herein, i.e., a gene encoding a protein having the sequence as defined in SEQ ID NO: 28, or for a protein having a sequence having at least 70% similarity with SEQ ID NO: 28, or for a protein having a sequence having at least 90% identity with SEQ ID NO: 28. In an embodiment, said anti-CRISPR gene has the sequence as defined in SEQ ID NO: 27. The invention is also directed to conservative variants of SEQ ID NO: 27 as long as said variants encode respectively an anti-CRISPR protein as defined in SEQ ID NO: 28.

When an anti-CRISPR gene is specified as having a given nucleotide sequence, it is understood that the gene comprises said nucleotide sequence. In an embodiment, where an anti-CRISPR gene is specified as having a given nucleotide sequence, it is understood that the gene consists of said nucleotide sequence.

In an embodiment, the anti-CRISPR gene as defined herein is provided under an isolated or substantially purified form. An "isolated" or "purified" anti-CRISPR gene, is substantially or essentially free from components that normally accompany or interact with the gene as found in its naturally occurring environment. Thus, an isolated or purified anti- CRISPR gene is substantially free of other cellular material, or culture medium when produced by recombinant techniques, or substantially free of chemical precursors or other chemicals when chemically synthesized. Optimally, an "isolated" anti-CRISPR gene is free of sequences (optimally protein encoding sequences) that naturally flank the anti-CRISPR gene (i.e., sequences located at the 5' and 3' ends of the anti-CRISPR gene) in the DNA of the organism from which the anti-CRISPR gene is derived. In an embodiment, the anti-CRISPR gene contain less than about 5 kb, 4 kb, 3 kb, 2 kb, 1 kb or 0.5 kb of nucleotide sequence that naturally flank the anti-CRISPR gene in the DNA of the organism from which the polynucleotide is derived.

The invention is also directed to a construct comprising an anti-CRISPR gene as defined herein. In an embodiment, the present invention covers a construct comprising an anti-CRISPR gene operably linked to a regulatory sequence. The term "operably linked" refers to a juxtaposition wherein the components described are in a relationship permitting them to function in their intended manner. A regulatory sequence "operably linked" to a coding sequence is ligated in such a way that expression of the coding sequence is achieved under condition compatible with the control sequences. The term "regulatory sequences" includes promoters and/or enhancers and other expression regulation signals. The term "promoter" is used in the normal sense of the art, e.g. an RNA polymerase binding site. The construct may even contain or express another gene, such as a marker allowing for the selection of the construct. Various markers exist which may be used, for example those markers that provide for antibiotic resistance - e.g. resistance to bacterial antibiotics - such as Erythromycin, Ampicillin, Streptomycin and Tetracycline.

Thus, in a further aspect, there is provided a vector comprising an anti-CRISPR gene or a construct as defined herein. As used herein, the term "vector" refers to any nucleic acid molecule into which another nucleic acid (e.g., an anti-CRISPR gene) can be inserted and which can be introduced into and replicate within bacterial strain. Thus, the term refers to any nucleic acid construct (and, if necessary, any associated delivery system) capable of use for introduding genetic material into a bacterial strain. Selection of appropriate vectors is within the knowledge of those having skill in the art. In an embodiment, the vector is a plasmid. As used herein, the term "plasmid" refers to a circular double-stranded (ds) DNA construct that can be used as a vector for introducing DNA into a bacterial strain. The constructs or the vectors may be introduced into a bacterial strain as described herein.

Bacterial strains and phages comprising anti-CRISPR genes

In the methods of the invention, the anti-CRISPR gene as defined herein, as such, as a contruct or contained in a vector is introduced into a bacterial cell in order to be expressed. Thus, the invention is directed to a bacterial strain comprising - in a vector or integrated into its chromosome - an anti-CRISPR gene or a contruct as defined herein. The term "expression" or "expressed" as used herein has its normal meaning in the art, i.e., the anti-CRISPR gene is transcribed and translated to produce a functional anti-CRISPR protein.

In an embodiment, the anti-CRISPR gene is expressed from a vector (such as a plasmid), i.e., that the anti-CRISPR gene is kept on the vector once introduced into the bacterial strain. In another embodiment, the anti-CRISPR gene is expressed from the chromosome of said bacteria strain, i.e., the anti-CRISPR gene is found integrated into the chromosome of said bacterial strain. As used herein, the term "integrated" used in reference to a nucleic acid (e.g., an anti-CRISPR gene) means incorporated into the chromosomal DNA of a bacterial strain. In an embodiment, an anti-CRISPR gene is inserted in a plasmid, which is used to transform a bacterial strain, and said anti-CRISPR gene is integrated into the transformed bacterial strain's chromosomal DNA.

In an embodiment, the bacterial strain comprises integrated in its chromosome an anti-CRISPR gene as defined herein (encoding a protein inteferring with a function of a given CRISPR-Cas system), and at least one self-targeting spacer(s) inserted in the CRISPR array of said given CRISPR-Cas. "Self-targeting spacer" is as defined elsewhere in this application. In an embodiment, said anti-CRISPR gene encoding a protein inteferring with the interference function of said given CRISPR-Cas system. In an embodiment, said given CRISPR-Cas system is a class 2 CRISPR-Cas system, a class 2 type II CRISPR-Cas system, a class 2 type ll-A CRISPR-Cas system.

Either as a gene, as part of a construct or part of a vector, integrated or not, in an embodiment, the expression of the anti-CRISPR gene as defined herein is constitutive. In another embodiment, either as a gene, as part of a construct or part of a vector, integrated or not, the expression of the anti-CRISPR gene as defined herein is inducible (i.e., the anti- CRISPR gene is found under an inducible promoter). The term "inducible promoter" refers to a promoter that selectively express a coding sequence or functional RNA in response to the presence of an endogenous or exogenous stimulus, for example by chemical compounds (chemical inducers) or in response to environmental and/or chemical signals. Inducible or regulated promoters include, for example, promoters induced or regulated by light, heat, stresses, sugars, peptides and metal ions.

In an embodiment, the bacterial strain of the invention or used in the methods of the invention as defined herein is a Gram-positive bacterial strain. In an embodiment, the bacterial strain is a lactic acid bacterium. In an embodiment, said bacterial strain is selected from a Bifidobacterium species, a Brevibacterium species, a Propionibacterium species, a Lactococcus species, a Streptococcus species, a Lactobacillus species, an Enterococcus species, a Pediococcus species, a Leuconostoc species and an Oenococcus species. In an embodiment, said bacterial strain is a Streptococcus species. Suitable species include, but are not limited to Lactococcus lactis, including Lactococcus lactis subsp. lactis and Lactococcus lactis subsp. cremoris, Leuconostoc sp., Lactococcus lactis subsp. lactis biovar, Streptococcus thermophilus, Lactobacillus delbrueckii subsp. bulgaricus, Lactobacillus helveticus, Bifidobacterium lactis, Lactobacillus acidophilus, and Lactobacillus casei. In an embodiment, said bacterial strain is selected from a Streptococcus thermophilus strain and a Streptococcus pyogenes strain. In an embodiment, said bacterial strain is a Streptococcus thermophilus strain. In an embodiment, said bacterial strain is a Streptococcus pyogenes strain.

In an embodiment, independently of or in combination with the above paragraph, a bacterial strain is characterized by the presence in its genome of a given CRISPR-Cas system as defined herein. Thus, in an embodiment, the bacterial strain of the invention or used in the methods of the invention comprises in its genome a class 2 CRISPR-Cas system as defined herein. In an embodiment, the bacterial strain comprises in its genome a class 2 type II CRISPR-Cas system as defined herein. In an embodiment, the bacterial strain comprises in its genome a class 2 type ll-A CRISPR-Cas system as defined herein.

In an embodiment, when the bacterial strain is a Streptococcus thermophilus strain, said strain of the invention or used in the methods of the invention comprises in its genome a CRISPR1 -Cas system. In an embodiment, when the bacterial strain is a Streptococcus thermophilus strain, said strain of the invention or used in the methods of the invention comprises in its genome a CRISPR3-Cas system. In an embodiment, when the bacterial strain is a Streptococcus thermophilus strain, said strain of the invention or used in the methods of the invention comprises in its genome a CRISPR1 -Cas system and a CRISPR3- Cas system.

The invention is also directed to recombinant phages, the genome of which comprises an anti-CRISPR gene or a construct as defined herein. As used herein, the term "phage" or "bacteriophage" has its conventional meaning as understood in the art - i.e., a virus that selectively infects one or more bacterial strains or species.

Introduction of nucleic acids (including anti-CRISPR genes), anti-CRISPR proteins, constructs and vectors, into bacterial strains

The nucleic acids (including anti-CRISPR genes as defined herein), anti-CRISPR proteins as defined herein, constructs and vectors disclosed herein can be introduced into a host cell, in particular a bacterial strain, using any method available.

"Introducing" (and "introduced") is intended to mean presenting to the host cell, the nucleic acid (including an anti-CRISPR gene) or protein (including an anti-CRISPR protein) or construct or vector as defined herein, in such a manner that the component(s) gains access to the interior of the host cell. The methods and compositions do not depend on a particular method for introducing a sequence into a host cell, only that the nucleic acid or protein gains access to the interior of the host cell. Introducing includes the incorporation of a nucleic acid into the host cell where the nucleic acid may be incorporated into the genome of the host cell, and includes the transient (direct) provision of a nucleic acid or protein to the host cell.

Introducing a nucleic acid (in particular an anti-CRISPR gene), construct or vector into a strain can be carried out by several methods, including transformation, conjugation, transduction or protoplast fusion. Methods for introducing polynucleotides or polypeptides by transformation into a host cell, include, but are not limited to, microinjection, electroporation, stable transformation methods, transient transformation methods [such as induced competence using chemical (e.g. divalent cations such as CaC ) or mechanical (electroporation) means], ballistic particle acceleration (particle bombardment), direct gene transfer, viral-mediated introduction, cell-penetrating peptides or mesoporous silica nanoparticle (MSN)-mediated direct protein delivery. Introducing a nucleic acid, construct or vector into a strain can be carried out by conjugation, which is a specific method of natural DNA exchange requiring physical cell-to-cell contact. Introducing a nucleic acid, construct or vector into a strain can be carried out by transduction, which is the introduction of DNA via a virus (e.g. phage) infection which is also a natural method of DNA exchange. Generally, such methods involve incorporating a polynucleotide within a viral DNA or RNA molecule.

A protein (in particular an anti-CRISPR protein) can be introduced into a host cell by directly introducing the protein itself or an mRNA encoding the anti-CRISPR protein. The protein can be introduced into a host cell transiently. Uptake of the protein into the host cell can be facilitated with a Cell Penetrating Peptide (CPP).

In an embodiment, the introduction can be stable, i.e., that the nucleic acid (construct or vector) introduced into host cell integrates into a genome of the host cell and is capable of being inherited by the progeny thereof. In another embodiment, the introduction can be temporary, i.e., that a nucleic acid (construct or vector) is introduced into the host cell and does not integrate into a genome of the host cell or a polypeptide is introduced into a host cell. Transient transformation indicates that the introduced nucleic acid or protein is only temporarily expressed or present in the host cell.

In an embodiment, whatever the method used for the nucleic acid or protein introduction, the host cell is a bacterial strain, in particular a bacterial strain as defined herein.

Uses of anti-CRISPR genes and anti-CRISPR proteins

The anti-CRISPR genes and the anti-CRISPR proteins as defined herein [in the anti- CRISPR genes and anti-CRISPR proteins paragraphs] find use in a wide variety of applications in bacterial strains, in particular in the methods decribed herein or below.

In the methods described herein, when a bacterial strain comprises in its genome a CRISPR-Cas system to be targeted, it is required that this CRISPR-Cas system is functional, i.e., has been shown to be active against a given target nucleic acid or is known to be active against target nucleic acids (able to acquire spacer(s) against target nucleic acids and able to interfere with said target nucleic acids).

In the method described herein, the expression "target nucleic acid" refers to any nucleic acid - which once introduced into a bacterial strain - is able to generate a response, from this bacterial strain. In an embodiment, said target nucleic acid is a DNA, in particular a double-stranded DNA or a single-stranded DNA. In an embodiment, said target nucleic acid is a RNA. In an embodiment, said target nucleic acid is a chromosomal DNA sequence (i.e., a sequence present in the chromosome of the bacterial cell). In an embodiment, said target nucleic acid is a transcript (i.e., a transcript expressed by the bacterial cell). The response can be generated against the target nucleic acid sequence per se. In another embodiment, the response can be generated against a transcription product of the target nucleic acid sequence - such as a transcript of the target nucleic acid sequence [e.g. an RNA (e.g. mRNA)]. Examples of target nucleic acid include, but are not limited to, a bacteriophage genome, the transcription product of a bacteriophage genome, a plasmid, a chromosomal sequence comprising at least one self-targeting spacer, a mobile genetic element, a transposable element and an insertion sequence. In an embodiment, said target nucleic acid is selected from a bacteriophage genome, the transcription product of a bacteriophage genome, a plasmid, chromosomal sequence comprising at least one self-targeting spacer, a mobile genetic element, a transposable element and an insertion sequence. In an embodiment, said target nucleic acid is a bacteriophage genome or the transcription product of a bacteriophage genome. In an embodiment, said target nucleic acid is a plasmid. In an embodiment, said target nucleic acid is a chromosomal sequence comprising at least one self-targeting spacer.

In an embodiment, said target nucleic acid is a mobile genetic element. In an embodiment, the target nucleic as defined herein is able to generate a CRISPR-Cas system- mediated response. In a particular embodiment, the target nucleic as defined herein is able to generate a class 2 CRISPR-Cas system-mediated response. In a particular embodiment, the target nucleic as defined herein is able to generate a class 2 type II CRISPR-Cas system- mediated response. In a particular embodiment, the target nucleic as defined herein is able to generate a class 2 type ll-A CRISPR-Cas system-mediated response.

In an aspect, the invention is directed to a method to downmodulate, in a bacterial strain, the activity of a class 2 type II CRISPR-Cas system against target nucleic acids, said method comprising either a) expressing in said bacterial strain a gene encoding a protein which interferes with a function of said class 2 type II CRISPR-Cas system or b) introducing in said bacterial strain a protein which interferes with a function of said class 2 type II CRISPR- Cas system. The expression of said gene encoding a protein which interferes with a function of said class 2 type II CRISPR-Cas system or introduction of said protein which interferes with a function of said class 2 type II CRISPR-Cas system downmodulates the activity of a class 2 type II CRISPR-Cas system. In a particular embodiment, the invention is directed to a method to downmodulate, in a bacterial strain, the activity of a class 2 type II CRISPR-Cas system against target nucleic acids, comprising expressing in said bacterial strain a gene encoding a protein which interferes with a function of said class 2 type II CRISPR-Cas system, wherein said bacterial strain is not of the Listeria genus when said gene is not a gene encoding an anti-CRISPR protein having a sequence as defined in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, having a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, or having a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26. In a particular embodiment, the invention is directed to a method to downmodulate, in a bacterial strain, the activity of a class 2 type II CRISPR-Cas system against target nucleic acids, comprising expressing in said bacterial strain a gene encoding a protein which interferes with a function of said class 2 type II CRISPR-Cas system, wherein said said bacterial strain is not of Neisseria genus, when said gene is not a gene encoding an anti-CRISPR protein having a sequence as defined in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, having a sequence having at least 70% similarity with SEQ I D NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, or having a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26. In a particular embodiment, the invention is directed to a method to downmodulate, in a bacterial strain, the activity of a class 2 type II CRISPR-Cas system against target nucleic acids, comprising expressing in said bacterial strain a gene encoding a protein which interferes with a function of said class 2 type II CRISPR-Cas system, wherein said said bacterial strain is neither of Listeria genus nor Neisseria genus, when said gene is not a gene encoding an anti-CRISPR protein having a sequence as defined in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, having a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, or having a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26. In a particular embodiment, the invention is directed to a method to downmodulate, in a bacterial strain, the activity of a class 2 type II CRISPR-Cas system against target nucleic acids, comprising expressing in said bacterial strain a gene encoding a protein which interferes with a function of said class 2 type II CRISPR-Cas system, wherein said said bacterial strain is a gram-positive strain which is not of Listeria genus, when said gene is not a gene encoding an anti-CRISPR protein having a sequence as defined in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, having a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, or having a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26. In the same aspect, the invention is also directed to a method to downmodulate, in a bacterial strain, the activity of a class 2 type II CRISPR-Cas system against target nucleic acids, comprising:

1 ) providing a bacterial strain, the genome of which contains a class 2 type II CRISPR- Cas system, wherein said class 2 type II CRISPR-Cas system is known to be active against target nucleic acids; and

2) either a) expressing in said bacterial strain a gene encoding a protein which interferes with a function of said class 2 type II CRISPR-Cas system or b) introducing in said bacterial strain a protein which interferes with a function of said class 2 type II CRISPR- Cas system.

In the same aspect, the invention is also directed to the use of a gene encoding a protein which interferes with a function of a class 2 type II CRISPR-Cas system or of a protein which interferes with a function of said class 2 type II CRISPR-Cas system, to downmodulate, in a bacterial strain, the activity of a class 2 type II CRISPR CRISPR-Cas system against target nucleic acids.

As used herein "downmodulating the activity", means decreasing, from partially to completely inhibiting, the activity of said class 2 type II CRISPR-Cas system against target nucleic acids.

Such downmodulation can be checked by providing a bacterial strain which is resistant to a given virulent phage, said resistance being mediated by a given CRISPR-Cas sytem (i.e., the CRISPR array of said given CRISPR-Cas system comprises a spacer corresponding to a protospacer found in the genome of the virulent phage); producing in said bacterial strain said anti-CRISPR protein (interfering with a function of said class 2 type II CRISPR-Cas system); and exposing said bacterial strain to said given virulent phage. The use of an anti-CRISPR protein as defined herein leads to an increase of the titer of said virulent phage by more than 1 Log (i.e., more than 90%) as compared to a control [where the control is the same bacterial strain - but not producing said anti-CRISPR protein - and exposed to the same virulent phage in the same conditions]. In an embodiment, the increase in the titer of said virulent phage is more than 95% as compared to a control. In an embodiment, the increase in the titer of said virulent phage is more than 98% as compared to a control. In an embodiment, the increase in the titer of said virulent phage is more than 2 Log (more than 99%) as compared to a control. In an embodiment, the increase in the titer of said virulent phage is more than 3 Log as compared to a control. In an embodiment, the increase in the titer of said virulent phage is more than 4 Log as compared to a control. In an embodiment, the protein interferes with the adaptation function of said class 2 type II CRISPR-Cas system. Thus, the invention is directed to a method to downmodulate, in a bacterial strain, the activity of a class 2 type II CRISPR-Cas system against target nucleic acids, comprising:

1 ) providing a bacterial strain, the genome of which contains a class 2 type II CRISPR-

Cas system, wherein said class 2 type II CRISPR-Cas system is known to be active against target nucleic acids; and

2) either expressing in said bacterial strain a gene encoding a protein which interferes with the adaptation function of said class 2 type II CRISPR-Cas system or introducing in said bacterial strain a protein which interferes with a function of said class 2 type II

CRISPR-Cas system.

In another embodiment, the protein interferes with the interference function of said class 2 type II CRISPR-Cas system. Thus, the invention is directed to a method to downmodulate, in a bacterial strain, the activity of a class 2 type II CRISPR-Cas system against a given target nucleic acid, comprising:

1 ) providing a bacterial strain, the genome of which contains a class 2 type II CRISPR- Cas system, wherein said class 2 type II CRISPR-Cas system has an activity against a given target nucleic acid; and

2) either expressing in said bacterial strain a gene encoding a protein which interferes with the interference function of said class 2 type II CRISPR-Cas system or introducing in said bacterial strain a protein which interferes with a function of said class 2 type II CRISPR-Cas system.

In the method described in the paragraphs immediately above, two techniques have been proposed to provide an anti-CRISPR protein into the bacterial strain: either the expression in said bacterial strain of an anti-CRISPR gene (i.e., a gene encoding a protein which interferes with a function of a CRISPR-Cas system) or by the introduction into said bacterial strain of an anti-CRISPR protein (i.e., a protein which interferes with a function of a CRISPR-Cas system). One technique can be used as an alternative to the other and the person skilled in the art can select which one is the most suitable for a given method described herein. Thus, for any of the methods described herein, and when applicable, the expression in said bacterial strain of an anti-CRISPR gene may be replaced by the introduction into said bacterial strain of an anti- CRISPR protein. Such methods - when the introduction into said bacterial strain of an anti- CRISPR protein replaces the expression in said bacterial strain of an anti-CRISPR gene should be considered described as such and are part of the present invention. In another aspect, the invention is directed to a method to downmodulate, in a bacterial strain, the CRISPR-Cas-mediated immunity against a given target nucleic acid, comprising:

1 ) providing a bacterial strain, the genome of which contains a class 2 type II CRISPR- Cas system, wherein said CRISPR-Cas system provides immunity against a given target nucleic acid (i.e., the CRISPR array of said given CRISPR-Cas system comprises a spacer corresponding to a protospacer found in said target nucleic acid); and

2) expressing in said bacterial strain a gene encoding a protein which interferes with the interference function of said CRISPR-Cas system against said given target nucleic acid. The expression of said gene encoding a protein which interferes with a function of said class 2 type II CRISPR-Cas system downmodulates the CRISPR-Cas-mediated immunity against a given target nucleic acid.

As used herein the term "immunity" or "immunized" refers to the response generated by a bacterial cell into which a target nucleic acid has been introduced, preventing thus said target nucleic acid to be maintained in said bacterial cell. Thus, a bacterial cell is said "immunized" (or has "immunity") against a target nucleic acid, when - after the response generated as a consequence of the introduction of the target nucleic acid - said target nucleic acid is not maintained in said bacterial cell. Thus, immunity against a target nucleic acid can be measured in terms of the maintenance of the target nucleic acid in said bacterial cell (e.g., target nucleic acid replication and/or transcription and/or expression) or in terms of survival of the bacterial cell in response to said target nucleic acid (when the target nucleic acid is detrimental to said bacterial cell), for example survival of the bacterial cell in response to a phage.

In an embodiment, the immunity as defined herein is mediated by a CRISPR-Cas system (CRISPR-Cas system-mediated immunity), i.e., that the maintenance of said target nucleic acid is prevented by a CRISPR-Cas system present in the bacterial strain. In an embodiment, the immunity as defined herein is mediated by a class 2 CRISPR-Cas system. In an embodiment, the immunity as defined herein is mediated by a class 2 type II CRISPR-Cas system. In an embodiment, the immunity as defined herein is mediated by a class 2 type ll-A CRISPR-Cas system.

The method as defined herein further comprises: 3) contacting said bacterial strain of step 2) with the given target nucleic acid and checking that the immunity against this given target nucleic acid is downmodulated.

As used herein, "immunity downmodulation" means from decrease to suppression of the immunity of a bacterial strain against a target nucleic acid. Such downmodulation can be checked by exposing the bacterial strain obtained in step 2) to said target nucleic acid; the use of an anti-CRISPR protein as defined herein leads to an increase of the proportion of bacterial cells into which the target nucleic acid is maintained, by more than 1 Log (i.e., more than 90%) as compared to a control [where the control is the same bacterial strain - but not producing said anti-CRISPR protein - and exposed to the target nucleic acid in the same conditions]. In an embodiment, the increase in the proportion of bacterial cells into which the target nucleic acid is maintained is more than 95% as compared to a control. In an embodiment, the increase in the proportion of bacterial cells into which the target nucleic acid is maintained is more than 98% as compared to a control. In an embodiment, the increase in the proportion of bacterial cells into which the target nucleic acid is maintained is more than 2 Log (more than 99%) as compared to a control. In an embodiment, the increase in the proportion of bacterial cells into which the target nucleic acid is maintained is more than 3 Log as compared to a control. In an embodiment, the increase in the proportion of bacterial cells into which the target nucleic acid is maintained is more than 4 Log as compared to a control.

As used herein, "exposing a bacterial strain to a (target) nucleic acid" or "contacting a bacteria strain to a (target) nucleic acid" means that the bacterial cells and a given or given nucleic acid(s) are physically mixed together (e.g., in the same medium), such that said nucleic acid(s) is introduced into the bacterial cells.

In the same aspect, the invention is also directed to the use of a gene encoding a protein which interferes with the interference function of a CRISPR-Cas system to downmodulate the CRISPR-Cas-mediated immunity against a given target nucleic acid in a bacterial strain, wherein said bacterial strain expresses said gene.

In another aspect, the invention is directed to a method to decrease the CRISPR- mediated instability of a plasmid in a bacterial strain, comprising:

1 ) expressing, in a bacterial strain, the genome of which comprise a CRISPR-Cas system known to be active against target nucleic acids, a gene encoding a protein which interferes with a function of said CRISPR-Cas system, and

2) transforming said bacterial strain with a plasmid;

wherein the expression of said gene encoding a protein which interferes with a function of a CRISPR-Cas system decreases the CRISPR-mediated instability of said plasmid in said bacterial strain.

The decrease of the CRISPR-mediated instability of a plasmid can be checked by determining the proportion of bacterial cells obtained after transformation in step 2) into which the plasmid is maintained; the use of an anti-CRISPR protein as defined herein leads to an increase of the proportion of bacterial cells into which the plasmid is maintained, by more than 1 Log (i.e., more than 90%) as compared to a control population [where the control is the same bacterial strain - but not producing said anti-CRISPR protein - and exposed to the plasmid in the same conditions]. In an embodiment, the increase in the proportion of bacterial cells into which the plasmid is maintained is more than 95% as compared to a control population. In an embodiment, the increase in the proportion of bacterial cells into which the plasmid is maintained is more than 98% as compared to a control population. In an embodiment, the increase in the proportion of bacterial cells into which the plasmid is maintained is more than 2 Log (more than 99%) as compared to a control population. In an embodiment, the increase in the proportion of bacterial cells into which the plasmid is maintained is more than 3 Log as compared to a control population. In an embodiment, the increase in the proportion of bacterial cells into which the plasmid is maintained is more than 4 Log as compared to a control population.

The proportion of bacterial cells into which the plasmid is maintained can be calculated by determining any phenotype linked to the presence of the plasmid, such as a marker (e.g., an antibiotic resistance gene).

In the same aspect, the invention is also directed to the use of a gene encoding a protein which interferes with the interference function of a CRISPR-Cas system to decrease the CRISPR-mediated instability of a plasmid in a bacterial strain, wherein said bacterial strain expresses said gene.

In another aspect, the invention is also directed to a method to increase the efficiency of gene transfer methods in a bacterial strain, said method comprising:

either: A1 ) expressing, in a bacterial strain, the genome of which comprise a CRISPR- Cas system which is known to be active against target nucleic acids, a gene encoding a protein which interferes with a function of said CRISPR-Cas system; and A2) introducing a nucleic acid into said bacterial strain; or

B1 ) introducing a nucleic acid into a bacterial strain, the genome of which comprise a CRISPR-Cas system which is known to be active against target nucleic acids, said nucleic acid comprising a gene encoding a protein which interferes with a function of said CRISPR-Cas system,

wherein the expression of the gene encoding a protein which interferes with a function of a CRISPR-Cas system decreases the CRISPR-mediated targeting of said introduced nucleic acid.

The decrease of the CRISPR-mediated targetting of said introduced nucleic acid can be checked by determining the proportion of bacterial cells (obtained after the introduction os said nucleic acid) into which the introduced nucleic acid is maintained; the use of an anti- CRISPR protein as defined herein leads to an increase of the proportion of bacterial cells into which the introduced nucleic acid is maintained, by more than 1 Log (i.e., more than 90%) as compared to a control population [where the control is the same bacterial strain - but not producing said anti-CRISPR protein - and exposed to the nucleic acid to be introduced in the same conditions]. In an embodiment, the increase in the proportion of bacterial cells into which the introduced nucleic acid is maintained is more than 95% as compared to a control population. In an embodiment, the increase in the proportion of bacterial cells into which the introduced nucleic acid is maintained is more than 98% as compared to a control population. In an embodiment, the increase in the proportion of bacterial cells into which the introduced nucleic acid is maintained is more than 2 Log (more than 99%) as compared to a control population. In an embodiment, the increase in the proportion of bacterial cells into which the introduced nucleic acid is maintained is more than 3 Log as compared to a control population. In an embodiment, the increase in the proportion of bacterial cells into which the introduced nucleic acid is maintained is more than 4 Log as compared to a control population.

In an embodiment, said nucleic acid is introduced through transformation, transduction or conjugation.

In an embodiment, said nucleic acid to be introduced is a DNA. In an embodiment, said nucleic acid to be introduced is a plasmid.

In the same aspect, the invention is also directed to the use of a gene encoding a protein which interferes with the interference function of a CRISPR-Cas system to decrease the CRISPR-mediated instability of a nucleic acid to be introduced in a bacterial strain, wherein said bacterial strain expresses said gene.

In an aspect, the invention is also directed to a method to favor the screening of a bacterial mechanism providing resistance against a virulent phage other than a given CRISPR-Cas- mediated resistance, comprising:

1 ) providing a bacterial strain, the genome of which contains a given CRISPR-Cas system which is known to be active against target nucleic acids;

2) expressing in said bacterial strain a gene encoding a protein which interferes with a function of said given CRISPR-Cas system;

3) exposing said bacterial strain obtained by step 2) with a virulent phage; and

4) selecting bacteriophage-insensitive mutants (BIMs),

wherein the resistance in said selected BIMs is provided by a bacterial mechanism other than the given CRISPR-Cas-mediated resistance. The term "resistance" or "resistant" refers to the status of a bacterial cell with respect to a phage infection. Thus, a bacterial cell is considered "resistant" (or to have "resistance") against a phage, when the phage is not able to replicate in said bacterial cell (because the phage genetic material is not able to enter into said bacterial cell or is not able to be maintained in the bacterial cell). As used herein, a phage resistance is "CRISPR-Cas- mediated", when the maintenance of said phage (i.e., its genetic material) into said bacterial cell is prevented by a CRISPR-Cas system present in the bacterial cell. In an embodiment, the resistance as defined herein is mediated by a class 2 CRISPR-Cas system. In an embodiment, the resistance as defined herein is mediated by a class 2 type II CRISPR-Cas system. In an embodiment, the resistance as defined herein is mediated by a class 2 type II- A CRISPR-Cas system.

Methods to expose a bacterial strain to a phage (challenge) and to select a bacterial strain resistance to a phage (also called bacteriophage-insensitive mutants or BIMs) are known from the person skilled in the art.

In an embodiment, the bacterial mechanism providing phage resistance to the bacterial strain of step 4) is not mediated by a CRISPR-Cas system. In an embodiment, the bacterial mechanism providing phage resistance to the bacterial strain of step 4) is selected from the group consisting of a mechanism of blocking phage adsorption, a mechanism of blocking genome injection, a mechanism of restriction-modification and a mechanism of abortive infection. In another embodiment, the bacterial mechanism providing phage resistance to the bacterial strain of step 4) is mediated by a CRISPR-Cas system other than the given (interfered) CRISPR-Cas system.

In a further aspect, the invention is directed to a method to enrich a bacterial population in bacteriophage-insensitive mutants (BIMs), other than BIMs due to a given CRISPR-Cas system:

1 ) providing a bacterial strain, the genome of which contains a given CRISPR-Cas system which is known to be active against target nucleic acids;

2) expressing in said bacterial strain a gene encoding a protein which interferes with a function of said given CRISPR-Cas system;

3) exposing said bacterial strain obtained by step 2) to a virulent phage; and

4) selecting BIMs,

wherein the selected BIMs have acquired resistance to said virulent phage by a mechanism other than the given CRISPR-Cas system. In an embodiment, the mechanism providing phage resistance to the selected BIMs of step 4) is not mediated by a CRISPR-Cas system. In an embodiment, the mechanism providing phage resistance to the selected BIMs of step 4) is selected from the group consisting of a mechanism of blocking of injection, a mechanism of restriction-modification and a mechanism of abortive infection. In another embodiment, the mechanism providing phage resistance to the selected BIMs of step 4) is mediated by a CRISPR-Cas system other than the given (interfered) CRISPR-Cas system.

In another aspect, the invention concerns a method to identify a gene encoding a protein which interferes with the interference function of a given CRISPR-Cas system, comprising:

1 ) identifying a protospacer in a virulent phage which is virulent against a bacterial strain, the genome of which comprises a given CRISPR-Cas system known to be active against target nucleic acids;

2) inserting a spacer corresponding to said protospacer into the CRISPR array of said CRISPR-Cas system of said bacterial strain;

3) exposing said bacterial strain obtained by step 2) to a set of virulent phages comprising said protospacer, wherein each phage of the set is exposed to said bacterial strain independently;

4) identifying among said set of phages, the ones which are still virulent against said bacterial strain of step 2) and selecting these phages;

5) identifying within the genome of the selected phages in step 4) the gene or the genes interfering with the interference function of said given CRISPR-Cas system.

The protospacer of step 1 ) is as defined herein, and can be identified according to the considered CRISPR-Cas system (class, type), taking into consideration, if needed, the presence of a protospacer adjacent motif (PAM). The spacer of step 2) is to be inserted in the CRISPR array of the CRISPR-Cas system considered when identifying the protospacer; the CRISPR spacer is inserted as a repeat-spacer unit, such that the spacer is flanked by two repeats. For the design of the set of virulent phages, the presence of the protospacer in the genome of said phages is determined as for step 1 ), i.e., taking into consideration, if needed, the presence of said protospacer adjacent motif (PAM). The identification of anti-CRISPR gene(s) in step 5) can be performed for example as detained in the experimental part, i.e., by a systematic cloning of the genes of said selected phage(s) into a vector to obtain constructs, then introducing independently these constructs into the strain of step 2), expressing the genes borne by these constructs, exposing independently the transformed strains to the virulent phage from which each gene comes from, identifying which construct (and thus gene) enables said phage to still be virulent on the transformed strain, wherein said gene is anti- CRISPR gene (see Figure 2A).

In another aspect, the invention is directed to methods to trigger the death of a bacterial population. In a first embodiment, the method comprises:

1 ) providing a bacterial population, wherein the genome of said bacterial strains comprises in the CRISPR array of a given CRISPR-Cas system at least one self-targeting spacer(s) and a gene encoding a protein which interferes with the interference function of said given CRISPR-Cas system (gene encoding an anti-CRISPR protein); and 2) inactivating the expression of said gene encoding a protein which interferes with the interference function of said given CRISPR-Cas system,

wherein said inactivation relieves the interference mediated by said anti-CRISPR protein on the interference function of said given CRISPR-Cas system, what results in the cleavage of said at least one self-targeting spacer(s) and the death of said bacterial population.

In said first embodiment, as defined herein "self-targeting spacer" means a spacer sequence corresponding to a protospacer (as defined herein) the sequence of which is present in the genome of said bacteria (associated with a PAM if required) and can therefore be cleaved by the associated CRISPR-Cas system. The inactivation of said anti-CRISPR gene can be performed by any method known from the person skilled in the art. An example, includes but is not limited to, expressing a repressor which prevents the transcription of said anti-CRISPR gene.

In a second embodiment, the method comprises:

1 ) providing a bacterial population, wherein the genome of said bacterial strains comprises in the CRISPR array of a given CRISPR-Cas system at least one spacer(s) corresponding to the protospacer of a virulent phage and a gene encoding a protein which interferes with the interference function of said given CRISPR-Cas system, wherein said gene is not expressed; and

2) expressing said gene encoding a protein which interferes with the interference function of said given CRISPR-Cas system; and

3) exposing said bacterial population to said virulent phage,

wherein the expression of said gene is performed before or simultaneously to the exposure to said virulent phage, and wherein said expression downmodulates the interference function of said given CRISPR-Cas system on said phage, what results in the cleavage of said at least one spacer(s) and the death of said bacterial population. In said second embodiment, the protospacer of step 1 ) is as defined herein, and can be identified according to the considered CRISPR-Cas system (class, type), taking into consideration, if needed, the presence of a protospacer adjacent motif (PAM). The spacer is to be inserted in the CRISPR array of the CRISPR-Cas system considered when identifying the protospacer. The anti-CRISPR gene is functional when expressed. Expression of said anti-CRISPR gene in step 2) can be performed by any method known from the person skilled in the art. Example includes, but is not limited to, expressing a protein, which activates the transcription of said anti-CRISPR gene (by for example an inducible promoter). Said activator can for example be produced from a plasmid introduced into said bacterial strain in step 2). Said activator can also be for example be produced from a gene previously inserted into the genome of the virulent phage exposed in step 3).

In an embodiment, when a method as decribed above referred to a CRISPR-Cas system, said system is a class 2 CRISPR-Cas system. In an embodiment, said system is a class 2 type II CRISPR-Cas system. In an embodiment, said system is a class 2 type ll-A CRISPR-Cas system.

In an embodiment, taken alone or in combination with the previous paragraph, when a method as decribed above referred to a protein which interferes with a function of a CRISPR-Cas system, said protein interferes with the interference function of said CRISPR- Cas system. In an embodiment, said protein interferes with the interference function of a class 2 CRISPR-Cas system. In an embodiment, said protein interferes with the interference function of a class 2 type II CRISPR-Cas system. In an embodiment, said protein interferes with the interference function of a class 2 type ll-A CRISPR-Cas system.

In an embodiment, when a method as decribed above referred to a protein which interferes with a function of a CRISPR-Cas system, said protein interferes with the interference function of a CRISPR1 -Cas system of a Streptococcus thermophilus. In an embodiment, when a method as decribed above referred to a protein which interferes with a function of a CRISPR-Cas system, said protein interferes with the interference function of a CRISPR3-Cas system of a Streptococcus thermophilus strain.

In an embodiment, said protein which interferes with a function of a class 2 type II

CRISPR-Cas system downmodulates the activity of a Cas9 protein, component of said class 2 type II CRISPR-Cas system, and in particular at least one its activities as defined herein. In an embodiment, said protein downmodulates the activity of a Cas9 protein of a Staphylococcus genus strain, such as a Cas9 protein of a Staphylococcus aureus strain. In another embodiment, said protein downmodulates the activity of a Cas9 protein of a Streptococcus genus strain, such as a Cas9 protein of a Streptococcus thermophilus strain or a Streptococcus pyogenes strain. In an embodiment, said protein downmodulates the activity of the Cas9 protein of a CRISPR1 -Cas system of a Streptococcus thermophilus. In an embodiment, said protein downmodulates the activity of the Cas9 protein of a CRISPR3- Cas system of a Streptococcus thermophilus. In an embodiment, said protein downmodulates the activity of the Cas9 protein of a CRISPR1 -Cas system and CRISPR3-Cas system of a Streptococcus thermophilus.

In an embodiment, when a method as decribed above referred to a protein which interferes with a function of a CRISPR-Cas system, in particular a protein which interferes with a function of a class 2 type II CRISPR-Cas system, in particular a protein which interferes with the interference function of a class 2 type II CRISPR-Cas system, said protein is an anti- CRISPR protein having a sequence as disclosed herein [in the anti-CRISPR proteins paragraph]. In particular, said protein has the sequence as defined in a SEQ ID NO of a Acr family selected from the group consisting of Acr1 to Acr86 families of Table 1 , or has the sequence as defined in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552. In an embodiment, said protein has a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552 as defined herein, or has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552 as defined herein.

In an embodiment, when a method as decribed above referred to a protein which interferes with the interference function of a class 2 type II CRISPR-Cas system, said protein has a sequence as defined in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26. In an embodiment, said protein has a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, or has a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, and is an anti-CRISPR protein as defined herein.

In an embodiment, when a method as decribed above referred to a gene encoding a protein which interferes with a function of a CRISPR-Cas system, in particular a protein which interferes with a function of a class 2 type II CRISPR-Cas system, in particular a protein which interferes with the interference function of a class 2 type II CRISPR-Cas system, said gene has a sequence as defined above [anti-CRISPR genes paragraph] or has a sequence encoding an anti-CRISPR protein as defined herein [anti-CRISPR proteins paragraph]. In particular, said gene has a sequence encoding an anti-CRISPR protein having a sequence as defined in a SEQ ID NO of a Acr family selected from the group consisting of Acr1 to Acr86 families of Table 1 , or an anti-CRISPR protein having the sequence as defined in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552, or having a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 1 10, 1 12, 1 14, 1 16, 1 18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552 as defined herein, or having a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, 100, 102, 104, 106, 108, 110, 112, 114, 116, 118, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 146, 148, 150, 152, 154, 156, 158, 160, 162, 164, 166, 168, 170, 172, 174, 176, 178, 180, 182, 184, 186, 188, 190, 192, 194, 196, 198, 200, 202, 204, 206, 208, 210, 212, 214, 216, 218, 220, 222, 224, 226, 228, 230, 232, 234, 236, 238, 240, 242, 244, 246, 248, 250, 252, 254, 256, 258, 260, 262, 264, 266, 268, 270, 272, 274, 276, 278, 280, 282, 284, 286, 288, 290, 292, 294, 296, 298, 300, 302, 304, 306, 308, 310, 312, 314, 316, 318, 320, 322, 324, 326, 328, 330, 332, 334, 336, 338, 340, 342, 344, 346, 348, 350, 352, 354, 356, 358, 360, 362, 364, 366, 368, 370, 372, 374, 376, 378, 380, 382, 384, 386, 388, 390, 392, 394, 396, 398, 400, 402, 404, 406, 408, 410, 412, 414, 416, 418, 420, 422, 424, 426, 428, 430, 432, 434, 436, 438, 440, 442, 444, 446, 448, 450, 452, 454, 456, 458, 460, 462, 464, 466, 468, 470, 472, 474, 476, 478, 480, 482, 484, 486, 488, 490, 492, 494, 496, 498, 500, 502, 504, 506, 508, 510, 512, 514, 516, 518, 520, 522, 524, 526, 528, 530, 532, 534, 536, 538, 540, 542, 544, 546, 548, 550 or 552 as defined herein. In an embodiment, said anti- CRISPR gene has a sequence as defined herein, and in particular has the sequence as defined in a SEQ ID NO of a Acr family selected from the group consisting of Acr1 to Acr86 families of Table 1 , or has the sequence as defined in SEQ ID NO: 1, 3,5, 7,9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, 167, 169, 171, 173, 175, 177, 179, 181, 183, 185, 187, 189, 191, 193, 195, 197, 199, 201, 203, 205, 207, 209, 211, 213, 215, 217, 219, 221, 223, 225, 227, 229, 231, 233, 235, 237, 239, 241, 243, 245, 247, 249, 251, 253, 255, 257, 259, 261, 263, 265, 267, 269, 271, 273, 275, 277, 279, 281, 283, 285, 287, 289, 291, 293, 295, 297, 299, 301, 303, 305, 307, 309, 311, 313, 315, 317, 319, 321, 323, 325, 327, 329, 331, 333, 335, 337, 339, 341, 343, 345, 347, 349, 351, 353, 355, 357, 359, 361, 363, 365, 367, 369, 371, 373, 375, 377, 379, 381, 383, 385, 387, 389, 391, 393, 395, 397, 399, 401, 403, 405, 407, 409, 411, 413, 415, 417, 419, 421, 423, 425, 427, 429, 431, 433, 435, 437, 439, 441, 443, 445, 447, 449, 451, 453, 455, 457, 459, 461, 463, 465, 467, 469, 471, 473, 475, 477, 479, 481, 483, 485, 487, 489, 491, 493, 495, 497, 499, 501, 503, 505, 507, 509, 511, 513, 515, 517, 519, 521, 523, 525, 527, 529, 531, 533, 535, 537, 539, 541, 543, 545, 547, 549 or 551 , or is a conservative variant of SEQ ID NO: 1 , 3, 5, 7, 9, 11 , 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59, 61, 63, 65, 67, 69, 71, 73, 75, 77, 79, 81, 83, 85, 87, 89, 91, 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, 119, 121, 123, 125, 127, 129, 131, 133, 135, 137, 139, 141, 143, 145, 147, 149, 151, 153, 155, 157, 159, 161, 163, 165, 167, 169, 171, 173, 175, 177, 179, 181, 183, 185, 187, 189, 191, 193, 195, 197, 199, 201, 203, 205, 207, 209, 211, 213, 215, 217, 219, 221, 223, 225, 227, 229, 231, 233, 235, 237, 239, 241, 243, 245, 247, 249, 251, 253, 255, 257, 259, 261, 263, 265, 267, 269, 271, 273, 275, 277, 279, 281, 283, 285, 287, 289, 291, 293, 295, 297, 299, 301, 303, 305, 307, 309, 311, 313, 315, 317, 319, 321, 323, 325, 327, 329, 331, 333, 335, 337, 339, 341, 343, 345, 347, 349, 351, 353, 355, 357, 359, 361, 363, 365, 367, 369, 371, 373, 375, 377, 379, 381, 383, 385, 387, 389, 391, 393, 395, 397, 399, 401, 403, 405, 407, 409, 411, 413, 415, 417, 419, 421, 423, 425, 427, 429, 431, 433, 435, 437, 439, 441, 443, 445, 447, 449, 451, 453, 455, 457, 459, 461, 463, 465, 467, 469, 471, 473, 475, 477, 479, 481, 483, 485, 487, 489, 491, 493, 495, 497, 499, 501, 503, 505, 507, 509, 511, 513, 515, 517, 519, 521, 523, 525, 527, 529, 531, 533, 535, 537, 539, 541, 543, 545, 547, 549 or 551 as defined herein. In an embodiment, when a method as decribed above referred to a gene encoding a protein which interferes with the interference function of a class 2 type II CRISPR-Cas system, said gene has a sequence encoding an anti-CRISPR protein as defined herein, in particular has a sequence encoding an anti- CRISPR protein having a sequence as defined in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, having a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18,20,22, 24 or 26, or having a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26. In an embodiment, said anti- CRISPR gene has a sequence as defined in SEQ ID NO: 1 , 3, 5, 7, 9, 11 , 13, 15, 17, 19, 21, 23 or 25 or is a conservative variant of SEQ ID NO: 1,3,5,7,9, 11, 13, 15, 17, 19, 21, 23 or 25 as defined herein.

In an embodiment, when a method as decribed above referred to the expression of an anti-CRISPR gene in a bacterial strain, said expression is constituve as defined herein. In another embodiment, the expression of said anti-CRISPR gene in a bacterial strain is inducible.

In an embodiment, when a method as decribed above referred to a bacterial strain, said strain is not of Listeria genus. In a particular embodiment, said strain is not of Listeria genus, when said gene is not a gene encoding an anti-CRISPR protein having a sequence as defined in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, having a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, or having a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26.

In an embodiment, when a method as decribed above referred to a bacterial strain, said strain is not of Neisseria genus. In a particular embodiment, said strain is not of Neisseria genus, when said gene is not a gene encoding an anti-CRISPR protein having a sequence as defined in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, having a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, or having a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26.

In an embodiment, when a method as decribed above referred to a bacterial strain, said strain is neither of Listeria genus nor Neisseria genus. In a particular embodiment, said strain is neither of Listeria genus nor Neisseria genus, when said gene is not a gene encoding an anti-CRISPR protein having a sequence as defined in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, having a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, or having a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26.

In an embodiment, when a method as decribed above referred to a bacterial strain, said strain is a Gram-positive bacterial strain which is not of Listeria genus. In a particular embodiment, said strain is a gram-positive strain which is not of Listeria genus, when said gene is not a gene encoding an anti-CRISPR protein having a sequence as defined in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, having a sequence having at least 70% similarity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26, or having a sequence having at least 90% identity with SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or 26.

In an embodiment, when a method as decribed above referred to a bacterial strain, said strain is a Gram-positive bacterial strain. In an embodiment, the bacterial strain is a lactic acid bacterium. In an embodiment, said bacterial strain is selected from a Bifidobacterium species, a Brevi bacterium species, a Propionibacterium species, a Lactococcus species, a Streptococcus species, a Lactobacillus species, an Enterococcus species, a Pediococcus species, a Leuconostoc species and an Oenococcus species. In an embodiment, said bacterial strain is a Streptococcus species. Suitable species include, but are not limited to Lactococcus lactis, including Lactococcus lactis subsp. lactis and Lactococcus lactis subsp. cremoris, Leuconostoc sp., Lactococcus lactis subsp. lactis biovar, Streptococcus thermophilus, Lactobacillus delbrueckii subsp. bulgaricus, Lactobacillus helveticus, Bifidobacterium lactis, Lactobacillus acidophilus, Lactobacillus casei. In an embodiment, said bacterial strain is selected from a Streptococcus thermophilus strain and a Streptococcus pyogenes strain. In an embodiment, said bacterial strain is a Streptococcus thermophilus strain. In an embodiment, said bacterial strain is a Streptococcus pyogenes strain.

All publications and patent applications mentioned in the specification are indicative of the level of those skilled in the art to which this disclosure pertains, and all such publications and patent applications are herein incorporated by reference to the same extent as if each individual publication or patent application was specifically and individually indicated to be incorporated by reference.

EXAMPLES

Example 1

Materials and Methods

As Streptococcus thermophilus is a model for the study of CRISPR adaptation, a detailed step-by-step protocol for many of the methods used here is available elsewhere.

Strain culturing

S. thermophilus cultures were grown in M17 medium (Oxoid, Ontario, Canada) supplemented with 0.5% w/v lactose (LM17). Chloramphenicol, when necessary, was added at 5 μg ml. When used to generate an overnight culture for use the following day, cultures were grown at 37 °C without shaking. In all other cases, they were grown at 42 °C without shaking. If phages were to be added, the media was further supplemented with 10 mM CaC .

Lactococcus lactis cultures were grown in M17 medium (Oxoid, Ontario, Canada) supplemented with 0.5% w/v glucose monohydrate (GM17). Chloramphenicol or erythromycin, when necessary, were added at 5 μg/ml. Cultures were grown at 30 °C without shaking, except when the activity of an SpCas9-containing construct was assayed, in which case incubations took place at 33 °C. If phages were to be added, the media was further supplemented with 10 mM CaC .

Escherichia coli cultures were grown in LB medium. Chloramphenicol, when necessary, was provided at 20 μg/ml. Cultures were grown at 37 °C with shaking.

Phage amplification

A scraping from a phage lysate preserved at -80 °C with 15% glycerol was co- inoculated with its host strain, in media supplemented with 10 mM CaC , and grown until complete lysis was observed. This first amplification lysate was then filtered through a 0.45 μηη PES filter, and 100 μΙ used to inoculate its host strain grown to an Οϋβοο θί 0.1 in media supplemented with 10 mM CaC . This second amplification lysate was also filtered through a 0.45 m PES filter, then stored at 4°C.

Phage titreing

1 ) Spot test (Fig 1 ): Phages were serially diluted in phage buffer (50 mM Tris-HCI, pH

7.5, 100 mM NaCI, 8 mM MgS0 ₄ ). Three ml of molten 0.75 % agar medium at 55 °C, supplemented with 10 mM CaC , was inoculated with 300 μΙ of an overnight culture of the host strain, then rapidly poured over a pre-set plate of the same medium with 1 % agar. The plate was allowed to set and dry. Phage dilutions, 3 ul from each, were spotted onto the dry overlay and allowed to dry for 20 min. The plates were then incubated overnight, and plaques counted at the lowest dilution at which they were visible.

2) Full, (Fig 2): Phages were serially diluted in phage buffer. Three ml of molten 0.75 % agar medium at 55 °C, supplemented with 10 mM CaC , is co-inoculated with 300 μΙ of an OD600 0.6 culture of the host strain and 100 μΙ of diluted phage. The plates were then incubated overnight, and plaques counted from plates with between 30-300 plaques.

Immunizing assays

These are also referred to as "BIM assays" (Bacteriophage Insensitive Mutants). Phages were diluted in phage buffer in order to obtain a final multiplicity of infection (MOI) of 0.1 plaque forming units per colony forming units (pfu/cfu). Three ml of molten 0.75% agar medium at 55 °C, supplemented with 10 mM CaC was co-inoculated with 300 μΙ of a culture at an Οϋβοο of 0.6 (-1.2 x 10 ⁸ cfu/ml) of the host strain and 100 μΙ of the appropriate phage dilution. The plates were then incubated overnight, and surviving colonies counted. Characterization of surviving colonies

Random surviving bacterial colonies were screened by PCR for acquisition of new spacers at the CRISPR1 & CRISPR3 loci (S. thermophilus strain DGCC7710) or CRISPR1 locus (S. thermophilus strain DGCC7854). An increase in the size of the PCR product relative to the wild type was indicative of CRISPR immunization. The resulting PCR products were sequenced to confirm the identity of the newly acquired spacer. For assays in Figure 2, presence of the insert in pNZAcr was confirmed by sequencing in cells that had acquired spacers.

Transformation

Commercial NEB5a E. coli cells were transformed according to the manufacturer's recommendations (New England Biolabs, Ontario, Canada). S. thermophilus strains were transformed by growing them to an Ο βοο of 0.4, subjecting them to a glycine shock for 1 h, repeated washes and then electroporation. L. lactis strains were transformed using a similar glycine-based protocol. Plasmid Programming

A plasmid was designed to contain a protospacer (CRISPR-acquirable sequence) targeting the five phages used in the challenges. Two oligos consisting of a conserved protospacer in the gene encoding the tape measure protein, as well as overhangs suited for cloning, were annealed together by mixing them in equal parts, heating them to 98°C, then cooling them slowly to 50°C. This annealed construct was then ligated directly into an EcoRI/Xhol double-digested pNZ123, transformed into commercial NEB5a, and selected for with chloramphenicol. The constructed plasmid was then isolated using Qiaprep Spin Miniprep kit (Qiagen, Ontario, Canada) according to the manufacturer's recommendations. S. thermophilus DGCC7854 was transformed with this plasmid, pNZ5phage, then grown in the absence of selection for 7 generations and subjected to an immunizing assay (see above) with virulent phage D5842. The surviving colonies had naturally acquired the desired spacer from the plasmid, immunizing them to the phages. The spacer sequence was confirmed as described in "characterization of surviving colonies" above. Phage genome sequencing & annotation

DNA from the phage D4276 was purified using a PureLink Viral RNA DNA kit (Invitrogen, MA, USA). The purified DNA was sequenced on a MiSeq system using a MiSeq reagent kit v2 after preparation using the Nextera XT DNA library preparation kit (lllumina, British Columbia, Canada). The resulting reads assembled using Ray version 2.2.0 (32). The genome was annotated using NCBI ORF finder and GeneMark.hmm prokaryotic, and those annotations then manually curated based on comparisons to related phages.

Phage gene cloning and pNZAcr construction

Primers were designed to systematically clone all of phage D4276 into pNZ123 oriented so as to drive transcription from the promoter upstream of the chloramphenicol resistance gene, cat. Initially, inserts were designed to contain several genes, but if cloning failed the inserts were redesigned as smaller, single-gene constructs. The gene of greatest interest, D4276_028, exemplifies this cloning technique. Primers were designed to amplify the gene and append 30 nt extensions overlapping the pNZ123 MCS (5'- ATTACAG CTCCAGATCCAGTACTG AATTCTCG CTG ATG GTG ATAGC ATTG G-3 ' and 5 - GAAAATATGCACTCGAGAAGCTTGAGCTCTTGCTTTCGCAGTCTCGAATT-3'). The amplified gene was then cloned by Gibson reaction into Xhol digested pNZ123. The resulting plasmid, pNZAcr, was transformed into commercial NEB5a, isolated using a Qiaprep Spin Miniprep kit, and then transformed into the relevant S. thermophilus and L. lactis strains. The sequence of the insert was confirmed by sequencing using primers (5'- AATGTCACTAACCTGCCCCG and CATTGAACATG CTGAAG AG C-3 ' ).

Plasmid loss assays

Cultures carrying pNZAcr were serially grown in the absence of selection, inoculating fresh 10 ml of LM17 broth media with 100 μΙ of a culture grown to saturation. This was repeated 5 times. Dilutions of the resulting culture were spread upon plates in order to obtain isolated colonies, and 120 such colonies were then patch-plated on LM17 with and without chloramphenicol. Colonies, which grew on LM17 (all 120) but failed to grow on LM17 Cm (two), were screened by PCR to confirm plasmid loss using pNZinsF and pNZinsR, and their CRISPR1 locus was amplified to confirm the presence of the immunizing spacer. Colonies were then used to titer the phages D4276 and D5842, and confirm that they had regained resistance to the phages from losing the plasmid. pL2Cas9-44 construction

pL2Cas9 (Lemay et al. 2017) is a derivative of the lactococcal vector pTRKL2 (O'

Sullivan et al. 1993) with the SpCas9 module of pCas9 (Jiang et al. 2013). A pair of oligos consisting of a spacer sequence targeting orf44 of phage p2 and overhangs for ligation into pL2cas9 were designed (5'-AAACTCCGTTACAATTAGAACAAAATTCTTGTTTG-3' and 5 - AAAACAAACAAGAATTTTGTTCTAATTGTAACGGA-3'). They were annealed together by mixing them in equal parts, heating them to 98 °C, then cooling them slowly to 50 °C. This annealed construct was then ligated directly into digested pL2Cas9 and transformed directly into L. lactis. The resulting transformants were screened by PCR amplification and sequencing to confirm the presence of the desired spacer, using primers (5'- GTTCTTAGTG CATATAACAAACATAGAGAC-3 ' and 5'-CCAAGTAGCGAAGCGAGC-3').

Efficiency of centres of infection (ECOI)

Cultures of all four strains depicted in Figure 3B were grown at 33 °C to an Ο βοο of 0.8 (—1.9 ^* 10 ⁸ cfu/ml), 2 ml spun down and resuspended 1 ml in fresh GM17 media with 10 mM CaC . Then, phage p2 was added to an MOI of 0.2, mixed by inversion, and given 5 min to allow adsorption to the cells at 33 °C. The phage-cell mix was then spun down and resuspended in fresh media thrice in order to wash away unbound phages, then serially diluted. 100 μΙ of the resulting dilutions were then added to 300 μΙ of indicator strain (MG1363 pNZ123 pL2Cas9), embedded in a soft agar overlay (see phage titreing), and incubated at 33 °C overnight.

Results

Streptococcus thermophilus has become a model for acquisition of new CRISPR immunities, shares its genus with the source of SpCas9, and its active CRISPR-Cas systems are also of type ll-A. A set of five virulent phages infecting S. thermophilus strain DGCC7854 proved ideal for identifying phages that were less likely to lead to the acquisition of new spacers (phage-derived sequences in the CRISPR array, conferring immunity); while two of the phages readily gave rise to CRISPR-immune colonies, three did not (Figure 1 , Top). The dearth of spacer acquisition from these three phages did not necessarily confirm the presence of anti-CRISPRs. Those phages could simply be more sensitive to non-CRISPR forms of resistance, be quicker to take over the host cell, or produce fewer immunogenic defective particles. It was necessary to establish whether the CRISPR-Cas system was impeded during the adaptation ('memorization' of new targets) or interference (cleavage of that target) process. Using plasmid-programing, a strain targeting a protospacer conserved in all five phage genomes was generated. Then, in plaquing each phage upon this strain, it was observed that four of the five phages suffered a drastic reduction (~ 6 Log) in titer, consistent with CRISPR interference, but one phage, D4276, did not (Figure 1 , bottom). These phages were categorized according to these CRISPR-interacting phenotypes; permissive (white) phages D5842 and D5843, impeded adaptation (fractal pattern) phages D1024 and D5891 , and restrictive (black) phage D4276 - a candidate to harbor an anti-CRISPR.

We set about systematically cloning genes from the restrictive phage D4276 into a vector where they could be expressed in the immunized strain (Figure 2A). A phage gene encoding an anti-CRISPR protein should inactivate the pre-existing immunity and thereby restore the titer of a sensitive (permissive) phage plated upon the strain. In this manner, we found a new anti-CRISPR gene (acr gene, defined herein as SEQ ID NO:9 encoding an anti- CRISPR protein as defined in SEQ ID NO:10), which completely restored the immunized strain's sensitivity to the permissive phage D5842 (~6 Log increase), as well as increased sensitivity to the restrictive phage D4276 back to wild-type levels (Figure 2B). We attribute this increase in titer for even the anti-CRISPR-containing phage D4276 to high anti-CRISPR production before phage exposure, which would otherwise be a time-sensitive process whereby production must outrace CRISPR activity. In order to ensure the gain-of-sensitivity phenotypes were due only to this anti-CRISPR, we allowed loss of the anti-CRISPR -bearing plasmid and confirmed a return-of-resistance phenotype (data not shown).

As all five phages infecting S. thermophilus DGCC7854 are related cos-type phages, we could not rule out that the anti-CRISPR might be dependent upon interaction with partner proteins present in these phages. Furthermore, strain DGCC7854 contains only a single active CRISPR-Cas system (CRISPR1 ), as opposed to the two systems (CRISPR1 & CRISPR3) commonly active in S. thermophilus strains. We ported our anti-CRISPR vector over to the well-characterized model strain, S. thermophilus DGCC7710, which is sensitive to an unrelated virulent pac-type phage, 2972 - and for which we have strains immunized at either the CRISPR1 or CRISPR3 locus (Figure 2C). In this system, the anti-CRISPR activity was maintained, completely restoring phage sensitivity to a CRISPR1 -immunized strain, and partially restoring sensitivity for a CRISPR3-immunized strain. When we attempted immunizing assays on DGCC7710 bearing the acr gene, the number of surviving colonies fell sharply (Figure 2D). Moreover, the nature of those survivors changed drastically. The number of CRISPR3-immune colonies dropped, a number of previously undetectable non-CRISPR mutants were observed, and whereas CRISPR1 immunizations normally compose upwards of 90% of surviving colonies, only a single colony with a CRISPR1 spacer acquisition was recovered (Figure 2D). Of note, the CRISPR1 spacer in question targeted the plasmid (still present and carrying an intact acr gene), rather than the phage genome. This indicates that the Acr protein likely impedes Cas9-mediated cleavage, but not Cas9's role in spacer acquisition.

The Acr protein (SEQ ID NO:10) is 140 amino acids long and is predicted to contain a distinctive coiled-coil motif, which might act in a nucleic acid binding role, similar to HTH and AP2 motifs associated with other anti-CRISPR proteins. We have found several new anti- CRISPR genes both in phage genome (SEQ ID NO: 1 , 3, 5, 1 1 , 13, 15 and 17 encoding respectively anti-CRISPR protein as defined in SEQ ID NO: 2, 4, 6, 12 14, 16 and 18) as well as in the genome of Streptococcus strains (SEQ ID NO:5, 7, 19, 21 , 23 and 25 encoding respectively anti-CRISPR protein as defined in SEQ ID NO: 6, 8, 20, 22, 24 and 26).

Finally, despite the fact that the genome-editing tool SpCas9 (Cas9 from S. pyogenes) is more closely related to the Cas9 of the CRISPR3 system of S. thermophilus, we were keen to determine whether the Acr protein would have any effectiveness against SpCas9. We initially attempted to assay the effectiveness of Acr (pNZAcr) on SpCas9 (pCas9) in Escherichia coli, but despite the ability to clone each separately, the two systems were not able to co-exist. We suspect some aspect of the ACR-Cas9 interaction is pernicious to E. coli. Instead, we used a pCas9 derivative adjusted for use in Lactococcus lactis, with demonstrated efficacy in the genome-editing of virulent phages (Figure 3A). The pL2Cas9- 44 construct, targeting orf44 of the virulent phage p2, resulted in a 4 Log decrease in measurable phage titer (Figure 3B), which was completely restored by the presence of the acr gene. This is the strongest reported anti-CRISPR activity against SpCas9 to date.

The 4 Log reduction associated with pL2Cas9-44 was also accompanied by a 'tiny plaque' phenotype that proved difficult to quantify, as they were only observable on some technical replicates. The maximum number of tiny plaques observed is displayed in pale orange (Figure 3B). We characterized the phenotype and genotype of these smaller plaques, establishing that they were CRISPR-bypassing mutants genetically indistinguishable from those in the larger plaques, but arising only after several rounds of replication on the 'leaky' targeting strain. Notably, however, the expression of the ACR completely rescued both the titer and the tiny-plaque phenotype.

The Acr protein (SEQ ID NO:10) is the first anti-CRISPR protein with demonstrated activity from a virulent phage, is structurally distinct from previously characterized anti- CRISPRs, and displays the strongest in vivo activity against SpCas9 to date.

Example 2

Materials and Methods

Strain culturing, phage amplification, phage titreing, immunizing assays, characterization of surving colonies and transformation were done the same way as in example 1 .

Phage genome sequencing & annotation

DNA from the phage D181 1 was purified using a PureLink Viral RNA DNA kit

(Invitrogen, MA, USA). The purified DNA was sequenced on a MiSeq system using a MiSeq reagent kit v2 after preparation using the Nextera XT DNA library preparation kit (lllumina, British Columbia, Canada). The resulting reads assembled using Ray version 2.2.0 (32). The genome was annotated using NCBI ORF finder and GeneMark.hmm prokaryotic, and those annotations then manually curated based on comparisons to related phages.

Phage gene cloning and pNZAcr construction

Primers were designed to amplify a gene of interest, D181 1_026, and append 30 nt extensions overlapping the pNZ123 MCS (5'- ATTACAG CTCCAGATCCAGTACTG AATTCTTCG CTG AAAAAGTTTG G GAAGT-3 ' and 5 - GAAAATATGCACTCGAGAAGCTTGAGCTCTCCTCTCTCTTATGATAGTCTGCCA-3'). The amplified gene was then cloned by Gibson reaction into Xhol digested pNZ123. The resulting plasmid, pNZAcr-181 1 , was transformed into commercial NEB5a, isolated using a Qiaprep Spin Miniprep kit, and then transformed into the relevant S. thermophilus. The sequence of the insert was confirmed by sequencing using primers (5'-AATGTCACTAACCTGCCCCG and CATTGAACATG CTGAAG AG C-3 ' ).

Plasmid loss assays

Cultures carrying pNZAcr were serially grown in the absence of selection, inoculating fresh 10 ml of LM17 broth media with 100 μΙ of a culture grown to saturation. This was repeated 14 times. Dilutions of the resulting culture were spread upon plates in order to obtain isolated colonies, and 160 such colonies were then patch-plated on LM17 with and without chloramphenicol. Colonies, which grew on LM17 (all 120) but failed to grow on LM17 Cm (two), were screened by PCR to confirm plasmid loss using pNZinsF and pNZinsR, and their CRISPR1 locus was amplified to confirm the presence of the immunizing spacer. Colonies were then used to titer the phages D181 1 and D5842, and confirm that they had regained resistance to the phages from losing the plasmid. Results

In plaquing an additional phage (D181 1 ) upon the DGCC7854 strain, it was observed that this phage suffered a much smaller reduction in titer than 4 other related phages (Figure 1 , bottom). This phage was categorized as restrictive (black) phage.

We found a second new anti-CRISPR gene (acr2 gene, defined herein as SEQ ID NO:27 encoding an anti-CRISPR protein as defined in SEQ ID NO:28), which completely restored the immunized strain's sensitivity to the permissive phage D5842 (-5 Log increase), as well as increased sensitivity to the restrictive phage D181 1 back to wild-type levels (Figure 4A). We attribute this increase in titer for even the anti-CRISPR-containing phage D181 1 to high anti-CRISPR production before phage exposure, which would otherwise be a time- sensitive process whereby production must outrace CRISPR activity. In order to ensure the gain-of-sensitivity phenotypes were due only to this anti-CRISPR, we allowed loss of the anti- CRISPR -bearing plasmid and confirmed a return-of-resistance phenotype (data not shown).

Since D181 1 is related to the five other phages disclosed in example 1 , we could not rule out that the anti-CRISPR might be dependent upon interaction with partner proteins present in these phages. We ported our anti-CRISPR vector over to the well-characterized model strain, S. thermophilus DGCC7710, which is sensitive to an unrelated virulent pac-type phage, 2972 - and for which we have strains immunized at either the CRISPR1 or CRISPR3 locus (Figure 4B). In this system, the anti-CRISPR activity was maintained, completely restoring phage sensitivity to a CRISPR1 -immunized strain.

The Acr2 protein (SEQ ID NO:28) is 183 amino acids long. We have found several new anti-CRISPR genes both in phage genome (SEQ ID NO: 29, 31 , 33, 35, 37, 39, 41 , 43,

45, 47, 49, 51 , 53, 55, 57, 59, 61 , 63, 65, 67, 69, 71 , 73, 75, 77, 79 and 81 encoding respectively anti-CRISPR protein as defined in SEQ ID NO:, 30, 32, 34, 36, 38, 40, 42, 44,

46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68, 70, 80 and 82,) as well as in the genome of Streptococcus strains (SEQ ID NO: 83 and 85 encoding respectively anti-CRISPR protein as defined in SEQ ID NO: 84 and 86).

Example 3

Based on the location of the genes encoding the Acr1 and Acr2 proteins in phage genomes (examples 1 and 2), the corresponding region [immediately downstream of the lysin gene] was analyzed in silico in more than 250 phage genomes, considering more than 3,000 coding sequences (CDS). After clustering of these CDS based on blastn and a manual screening step (taking into account the genetic environment, predicted protein size, and elimination of genes with known function), 233 potential ACR genes (SEQ ID NOs 87 to 551 ) grouped into 84 families (Acr3 to Acr86 families) were identified.

These 84 families, and the corresponding SEQ ID NOs of the ACR genes and SEQ ID NOs of the ACR proteins encoded by these ACR genes are detailed in Table 1 above.

REFERENCES

Barrangou, R. et al. CRISPR provides acquired resistance against viruses in prokaryotes. Science 315, 1709-1712 (2007).

Bondy-Denomy, J., Pawluk, A., Maxwell, K. L. & Davidson, A. R. Bacteriophage genes that inactivate the CRISPR/Cas bacterial immune system. Nature 493, 429-32 (2013).

Bondy-Denomy, J. et al. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Nature 526, 136-139 (2015).

Chylinski K. et al. Classification and evolution of type II CRISPR-Cas systems. Nucleic Acid Research 42(10): 6091_6105 (2014).

Chowdhury, S. et al. Structure reveals mechanisms of viral suppressors that intercept a CRISPR RNA-guided surveillance complex. Cell 169, 47-57. e1 1 (2017). Jiang, W., Bikard, D., Cox, D., Zhang, F. & Marraffini, L. A. RNA-guided editing of bacterial genomes using CRISPR-Cas systems. Nat Biotechnol 31 , 233-239 (2013)

Jinek, M. et al. A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity. Science 337, 816-821 (2012).

Labrie, S. J., Samson, J. E. & Moineau, S. Bacteriophage resistance mechanisms. Nat Rev Micro 8, 317-327 (2010).

Lemay, M.-L, Tremblay, D. M. & Moineau, S. Genome engineering of virulent lactococcal phages using CRISPR-Cas9. ACS Synth Biol (2017).

Makarova, K. S. et al. An updated evolutionary classification of CRISPR-Cas systems. Nat Rev Microbiol 13, 722-736 (2015).

Makarova, K. S., Zhang, F. & Koonin, E. V. Snapshot: class 2 CRISPR-Cas systems. Cell 168, 328-328.e1 (2017).

Maxwell, K. L. et al. The solution structure of an anti-CRISPR protein. Nat Commun 7, 13134 (2016).

O'Sullivan, D. J. & Klaenhammer, T. R. High- and low-copy-number Lactococcus shuttle cloning vectors with features for clone screening. Gene 137, 227-231 (1993)

Pawluk, A., Bondy-Denomy, J., Cheung, V. H. W., Maxwell, K. L. & Davidson, A. R. A new group of phage anti-CRISPR genes inhibits the type l-E CRISPR-Cas system of Pseudomonas aeruginosa. MBio 5, e00896-14 (2014).

Pawluk, A. et al. Inactivation of CRISPR-Cas systems by anti-CRISPR proteins in diverse bacterial species. Nat Microbiol 1 , 16085 (2016a).

Pawluk, A. et al. Naturally occurring off-switches for CRISPR-Cas9. Cell 167, 1-10 (2016b). Rauch, B. J. et al. Inhibition of CRISPR-Cas9 with bacteriophage proteins. Cell 168, 150- 158.e10 (2017).

Samson, J. E., Magadan, A. H., Sabri, M. & Moineau, S. Revenge of the phages: defeating bacterial defences. Nat Rev Microbiol 1 1 , 675-87 (2013).

Schmakov et al. Diversity and evolution of class 2 CRISPR-Cas systems. Nat Rev Microbiol 15, 169-182 (2017)