Login| Sign Up| Help| Contact|

Patent Searching and Data


Title:
NOVEL FLAVONOIDS O-Α-GLUCOSYLATED ON THE B CYCLE, METHOD FOR THE PRODUCTION THEREOF AND USES
Document Type and Number:
WIPO Patent Application WO/2015/144731
Kind Code:
A1
Abstract:
The invention relates to a method for producing derivatives of O-α-glucosylated flavonoid, comprising at least one step of incubating a glucansucrase with a flavonoid and at least one sucrose, the flavonoid being a flavonoid which is monohydroxylated or hydroxylated in a non-vicinal manner on the B cycle. The invention also relates to novel O-α-glucosylated flavonoid derivatives, and to the use thereof.

Inventors:
MOREL, Sandrine (Château d'Auzeville, Auzeville-Tolosane, F-31320, FR)
ANDRE, Isabelle (3 rue de l'Aqueduc, Toulouse, F-31500, FR)
BRISON, Yoan (Apt.9, 2 rue du Général Albert d'Amade, Toulouse, F-31200, FR)
CAMBON, Emmanuelle (5 rue des Blanquiers, Montpellier, F-34000, FR)
MALBERT, Yannick (17 rue Antonin Bacou, Saint-Alban, F-31140, FR)
POMPON, Denis (5 rue Henry Russell, Pechabou, F-31320, FR)
REMAUD-SIMEON, Magali (1 rue Benjamin Charrié, Ramonville, F-31520, FR)
URBAN, Philippe (Le Carré Tolosan, Bât. B Apt. B01, 85 avenue Tolosane Ramonville-saint-Agne, F-31520, FR)
Application Number:
EP2015/056307
Publication Date:
October 01, 2015
Filing Date:
March 24, 2015
Export Citation:
Click for automatic bibliography generation   Help
Assignee:
INSTITUT NATIONAL DE LA RECHERCHE AGRONOMIQUE (147 rue de l'UNIVERSITE, Paris, F-75007, FR)
INSTITUT NATIONAL DES SCIENCES APPLIQUEES DE TOULOUSE (135 avenue de Rangueil, TOULOUSE cedex 4, F-31077, FR)
CENTRE NATIONAL DE LA RECHERCHE SCIENTIFIQUE (3 rue Michel Ange, PARIS cedex 16, F-75794, FR)
International Classes:
C12P19/46; A61K8/60; A61K31/7048; A61Q19/02; C07H15/203; C07H17/07; C12P19/60
Domestic Patent References:
WO2008140440A12008-11-20
WO2005094770A12005-10-13
WO2013043031A12013-03-28
Foreign References:
KR20060063703A2006-06-12
EP2145615A12010-01-20
KR20060063703A2006-06-12
US20110183930A12011-07-28
EP2100966A12009-09-16
US20090071534A12009-03-19
JP2002060304A2002-02-26
JP2003104818A2003-04-09
CN102477024A2012-05-30
CN101002557A2007-07-25
Other References:
DATABASE WPI Week 200126, Derwent World Patents Index; AN 2001-251629, XP002731022
BERTRAND A ET AL: "Leuconostoc mesenteroides glucansucrase synthesis of flavonoid glucosides by acceptor reactions in aqueous-organic solvents", CARBOHYDRATE RESEARCH, PERGAMON, GB, vol. 341, no. 7, 22 May 2006 (2006-05-22), pages 855 - 863, XP025010397, ISSN: 0008-6215, [retrieved on 20060522], DOI: 10.1016/J.CARRES.2006.02.008
MOON Y H ET AL: "Synthesis, Structure Analyses, and Characterization of Novel Epigallocatechin Gallate (EGCG) Glycosides Using the Glucansucrase from Leuconostoc mesenteroides B-1299CB", JOURNAL OF AGRICULTURAL AND FOOD CHEMISTRY, AMERICAN CHEMICAL SOCIETY, US, vol. 54, no. 4, 22 February 2006 (2006-02-22), pages 1230 - 1237, XP002696285, ISSN: 0021-8561, [retrieved on 20060121], DOI: 10.1021/JF052359I
MOON ET AL: "Synthesis and characterization of novel quercetin-alpha-d-glucopyranosides using glucansucrase from Leuconostoc mesenteroides", ENZYME AND MICROBIAL TECHNOLOGY, STONEHAM, MA, US, vol. 40, no. 5, 8 March 2007 (2007-03-08), pages 1124 - 1129, XP005918028, ISSN: 0141-0229, DOI: 10.1016/J.ENZMICTEC.2006.08.019
SACHIKO ESAKI ET AL: "Preparation and Taste of Certain Glycosides of Flavanones and of Dihydrochalcones.", BIOSCIENCE, BIOTECHNOLOGY, AND BIOCHEMISTRY, vol. 58, no. 8, 1 January 1994 (1994-01-01), pages 1479 - 1485, XP055145098, ISSN: 0916-8451, DOI: 10.1271/bbb.58.1479
ELISE CHAMPION ET AL: "Applying Pairwise Combinations of Amino Acid Mutations for Sorting Out Highly Efficient Glucosylation Tools for Chemo-Enzymatic Synthesis of Bacterial Oligosaccharides", JOURNAL OF THE AMERICAN CHEMICAL SOCIETY, vol. 134, no. 45, 14 November 2012 (2012-11-14), pages 18677 - 18688, XP055146341, ISSN: 0002-7863, DOI: 10.1021/ja306845b
ANNABELLA TRAMICE ET AL: "Direct enzymatic glucosylation of naringin in grapefruit juice by [alpha]-D-glucosidase from the marine molluscAplysia fasciata", BIOTECHNOLOGY JOURNAL, vol. 3, no. 4, 1 April 2008 (2008-04-01), pages 545 - 554, XP055146408, ISSN: 1860-6768, DOI: 10.1002/biot.200700161
Y. BRISON ET AL: "Functional and Structural Characterization of -(1->2) Branching Sucrase Derived from DSR-E Glucansucrase", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 287, no. 11, 9 March 2012 (2012-03-09), pages 7915 - 7924, XP055146551, ISSN: 0021-9258, DOI: 10.1074/jbc.M111.305078
WERNER S R ET AL: "Expression of a Dianthus flavonoid glucosyltransferase in Saccharomyces cerevisiae for whole-cell biocatalysis", JOURNAL OF BIOTECHNOLOGY, ELSEVIER SCIENCE PUBLISHERS, AMSTERDAM, NL, vol. 142, no. 3-4, 15 July 2009 (2009-07-15), pages 233 - 241, XP026305465, ISSN: 0168-1656, [retrieved on 20090611], DOI: 10.1016/J.JBIOTEC.2009.05.008
QUIDEAU S ET AL., ANGEW. CHEM. INT. END., vol. 50, 2011, pages 586 - 621
HARBOME J ET AL., PHYTOCHEMISTRY, vol. 55, 2000, pages 481 - 504
KO J H ET AL., FEMS MICROBIOL. LETT., vol. 258, 2006, pages 263 - 268
GURUNG R.B. ET AL., MOL. CELLS, vol. 36, no. 4, 2013, pages 355 - 361
CHOI S H ET AL., BIOTECHNOL. LETT., vol. 34, 2012, pages 499 - 505
WANG L ET AL., CARBOHYDR. RES., vol. 368, 2013, pages 73 - 77
HENRISSAT B; DAVIES GJ, CURR. OP. STRUCT. BIOL., vol. 7, 1997, pages 637 - 644
NAKAHARA ET AL., APPL. ENVIRON MICROBIOL., vol. 61, 1995, pages 2768 - 2770
MEULENBELD G ET AL., APPL. ENV. MICROBIOL., vol. 65, 1999, pages 4141 - 4147
MEULENBELD G HARTMANS S., BIOTECHNOL. BIOENG., vol. 70, 2000, pages 363 - 369
BERTRAND A ET AL., CARBOHYDR. RES., vol. 341, 2006, pages 855 - 863
MOON ET AL., JOURNAL OF MOLECULAR CATALYSIS B : ENZYMATIC., vol. 40, 2006, pages 1 - 7
MOON Y H ET AL., ENZYME MICROB. TECHNOL., vol. 40, 2007, pages 1124 - 1129
CHO H K ET AL., ENZYME MICROB. TECHNOL., vol. 49, no. 2, 2011, pages 246 - 253
KIM G E ET AL., ENZYME MICROB TECHNOL., vol. 50, 2012, pages 50 - 56
WOO H J ET AL., ENZYME MICROB. TECHNOL., vol. 51, 2012, pages 311 - 318
BRISON ET AL., J. BIOL. CHEM., vol. 287, 2012, pages 7915 - 24
HOUBEN WEIL: "methode der Organischen Chemie", vol. 15-1, 1974, THIEME, pages: 15 - II
MERRIFIELD RB, NATURE, vol. 207, no. 996, 1965, pages 522 - 523
MERRIFIELD RB, SCIENCE, vol. 150, no. 693, 1965, pages 178 - 185
MOLINIER-FRENKEL, J. VIRAL., vol. 76, 2002, pages 127 - 135
KARAYAN ET AL., VIROLOGY, 1994, pages 782 - 795
NOVELLI ET AL., VIROLOGY, vol. 185, 1991, pages 365 - 376
MOULIS ET AL.: "Understanding the polymerization mechanism of glycoside-hydrolase family 70 glucansucrases", J. BIOL. CHEM., vol. 281, 2006, pages 31254 - 31267
HEIM ET AL., J. NUTR. BIOCHEM., vol. 13, 2002, pages 572 - 584
HARBOME J. ET AL., PHYTOCHEMISTRY, vol. 55, 2000, pages 481 - 504
QUIDEAU S. ET AL., ANGEW. CHEM. INT. END., vol. 50, 2011, pages 586 - 621
KATSENIS K., CURR. VASE. PHARMACOL., vol. 3, no. 1, 2005, pages 1 - 9
MENG ET AL., NANO LETT., vol. 8, no. 10, 2008, pages 3266 - 72
NARAYAN M. R., RENEW. SUST. ENERG. REV., vol. 16, 2012, pages 208 - 215
BENAVENTE-GARCIA ET AL., J. AGRIC. FOOD CHEM., vol. 45, no. 12, 1997, pages 4505 - 4515
SINGH ET AL., NATURAL PRODUCT SCIENCES, vol. 3, no. 1, 1997, pages 49 - 54
DIWAN; SAXENA, INT. J. CHEM. SCI., vol. 8, no. 2, 2010, pages 777 - 782
REGNAULT-ROGER ET AL., J. STORED PROD RES, vol. 40, 2004, pages 395 - 408
BARKAT ALI KHAN ET AL., ASIAN J. CHEM., vol. 23, no. 2, 2011, pages 903 - 906
ZHU W.; GAO J., J. INVEST. DERMATOL. SYMPOSIUM PROCEEDINGS, vol. 13, 2008, pages 20 - 24
KIM J.H. ET AL., J. INVEST. DERMATOL., vol. 128, 2008, pages 1227 - 1235
Attorney, Agent or Firm:
JUPIN, Claude (Cabinet Nony, 3 rue de Penthièvre, Paris, 75008, FR)
Download PDF:
Claims:
REVENDICATIONS

1. Procédé de fabrication de dérivés de flavonoïde O-α-glucosylés comprenant au moins une étape d'incubation d'une glucane-saccharase avec un flavonoïde et au moins un saccharose, dans lequel:

(A) ledit flavonoïde est de formule (I) suivante :

dans laquelle

le cycle C représente un cycle choisi dans le groupe constitué des cycles de formule (II), (III). (IV) ou (V) suivantes :

(II)

(IV) (V)

dans lesquels l'un des groupements R1, R2 ou R3 représente un cycle B de formule (VI) suivante :

dans lequel :

(a) un seul des groupements choisi parmi R8, R9, R10, Ru et R! 2 représente un groupement hydroxyle,

les autres groupements parmi R8, R9, Rio, Ru et R12. identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en C1-C10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O. N ou S : un atome d'halogène ; un aryle en C5-C9 ; un hétérocycle en C4-C9 ; un groupement (Ci-C3)alcoxy ; un acyle en C2-C3 ; un alcool en C C3 ; un groupement -COOH ; -NH2 ; -CONH2 ; -CHO ; -SH ; -C(0)0(C2-C3) ; une aminé en C1-C3 ; une imine en Q-C3 ; un groupement nitrile ; un halogénoalkyle en d-C3 ; un thioalkyle en C1-C3 ; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;

ou

(b) R8 et un seul des groupements choisis parmi R10, Ru et Ri2 représentent un groupement hydroxyle.

R9 et les autres groupements parmi Rio, Ru et Ri2, identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydroearboné en C1-C10 linéaire ou ramifié, saturé ou in saturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O. N ou S ; un atonie d'halogène ; un aryle en C5-C9 ; un hétérocycle en C4-C9 ; un groupement (Ci-C3)alcoxy ; un acylc en C2-C3 ; un alcool en d-C3 ; un groupement -COOH ; -N¾ ; -CONH2 ; -CHO ; -SH ; -C(0)0(C2-C3) ; une amine en 1 -C3 ; une imine en C1-C3 ; un groupement nitrile ; un halogénoalkyle en C1-C3 ; un thioalkyle en C1-C3; un groupement -C(W) ; et un groupement --O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;

ou

(c) Ry et un seul des groupements choisis parmi Ru et Ri représentent un groupement hydroxyle,

les groupements Rs, Rio, et l'autre groupement parmi R, , et R12 , identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en Ci -Cm linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O, N ou S ; un atome d'halogène ; un aryle en C5-C9 ; un hétéroeyele en C4-Cy ; un groupement (Ci-C3)alcoxy ; un acyle en C2-C3 ; un alcool en C1-C3 ; un groupement -COOH ; -NH2 ; -CONH2 ; -CHO ; -SH ; -C(0)0(C2-C3) ; une aminé en C]-C3 ; une imine en C1 -C3 ; un groupement nitrile ; un halogénoalkyle en Ci-C3 ; un thioalkyle en C 1 -C3; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;

ou

(d) Rio et R12 représentent un groupement hydroxy.

les groupements Rs, R<>, et Ru , identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en C1-C10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O, N ou S ; un atome d'halogène ; un aryle en C5-C9 ; un hétéroeyele en C4-Cg ; un groupement (C[-C3)alcoxy ; un acyle en C2-C3 ; un alcool en Q-C3 ; un groupement - COOH ; -NH2 ; -CONH2 ; -CHO ;-SH ; -C(0)0(C2-C3) ; une aminé en C1-C3 ; une imine en C 1 -C3 ; un groupement nitrile ; un halogénoalkyle en C1-C3 ; un thioalkyle en Ci-C3; un groupement -C( W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;

ou

(e) Rg, Rio et R12 représentent un groupement hydroxy.

les groupements R9 et Ru, identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en C1-C10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O. N ou S : un atome d'halogène ; un aryle en C5-C9 ; un hétéroeyele en C4-C9 ; un groupement (Ci~C3)alcoxy ; un acyle en C2-C3 ; un alcool en Ci-C3 ; un groupement -COOH ; -NH2 ; -CONH2 ; -CHO ; -SH ; -C(0)0(C2-C3) ; une aminé en C1-C3 ; une imine en Ci-C3 ; un groupement nitrile ; un halogénoalkyle en C1-C3 ; un thioalkyle en CrC3; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;

les groupements R1} R2 et R3 qui ne représentent pas un cycle B de formule (VI), identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un alkyle en Ci-C6, linéaire ou ramifié ; un groupement -OH ; une aminé en C]-C3 ; un groupement -COOH ; -C(0)0(C2-C3) ; un groupement -C(W) ; et un groupement -O(VV) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;

Ri', R2' et R3', identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en Ci -Cm linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O. N ou

5 ; un atome d'halogène ; un aryle en C5-C9 ; un hétérocycle en C4-C9 ; un groupement (Ci-CN)alcoxy ; un acyle en C2-C3 ; un alcool en Ci-C3 ; un groupement -COOH ; -NH2 ; -CONH2 ; -CHO ; -SH ; -C(0)0(C2-C3) ; une aminé en C2-C3 ; une aminé en C1-C3 ; une imine en C 1-C3 ; un groupement nitrile ; un halogénoalkyle en Ci-C3 ; un thioalkyle en C)-C3 ; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;

ou les groupements R1 et R ' lorsque Rj ne représente pas un cycle B de formule (VI). ou R2 et R2' lorsque R2 ne représente pas un cycle B de formule (VI), ou R3 et R3' lorsque R3 ne représente pas un cycle B de formule (VI). forment ensemble un groupement =0;

R4, R5, R<, et R ;. identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en CrC10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O. N ou S ; un atome d'halogène ; un aryle en C5-C9 ; un hétérocycle en C4-C9 ; un groupement (Ci-C3)alcoxy ; un acyle en C2-C3 ; un alcool en C1-C3 ; un groupement -OH ; -COOH ; -NH2 ; -CONH2 ; -CHO ; -SH ; -C(0)0(C2-C3) ; une aminé en C1-Q ; une imine en Ci-C ; un groupement nitrile ; un halogénoalkyle en C] -C3 ; un thioalkyle en C1-C3 ; un groupement -C( W) ; et un groupement— 0( W) ; W représentant une chaîne constituée de 1 à

6 glycoside(s) ; (B) ladite glucane-saecharase étant choisie dans le groupe comprenant :

- une séquence ayant au moins 80 % d'identité avec la SEQ JD NO : 1 , ladite séquence ayant un acide aminé X] représentant un acide aminé choisi dans le groupe constitué de A, C. E, F, G, H, I, K, M, N, P, Q, S, T, V et Y;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 2, ladite séquence ayant un acide aminé X2 représentant un acide aminé choisi dans le groupe constitué de A, C, D, F, G, H, K, L, M, N, P, S, V et Y ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 3, ladite séquence ayant un acide aminé X3 représentant un acide aminé choisi dans le groupe constitué de A, C, G, I, K, M, N et W ;

- une séquence ayant au moins 80 % d'identité avec la séquence SEQ ID NO : 4, ladite séquence ayant un acide aminé X4 représentant un acide aminé choisi dans le groupe constitué de C, I, N, P. V et W ;

- une séquence ayant au moins 80 % d'identité avec la séquence SEQ ID NO : 5, ladite séquence ayant un acide aminé X5 représentant un acide aminé choisi dans le groupe constitué de A, C. D, G, I, K. L, M, R, V et W ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 6, ladite séquence ayant un acide aminé X6 représentant un acide aminé choisi dans le groupe constitué de C, G, Q, S et T ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 7, ladite séquence ayant un acide aminé X7 représentant un acide aminé choisi dans le groupe constitué de A et G ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 8 ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 9, ladite séquence ayant un acide aminé X8 représentant un acide aminé choisi dans le groupe constitué de C. 1 et L ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 10 ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 1 1 : et

- une séquence ayant au moins 80% d'identité avec la SEQ ID NO : 1 2. ladite séquence ayant des acides aminés X9, X10, X11, X12 et X13, avec :

(i) XQ représentant, indépendamment de X10, X11, X12 et X13, un acide aminé choisi dans le groupe constitué de G, S, V, C, F, N, I, L et W ; X10 représentant, indépendamment de X X11, X12 et X13, un acide aminé choisi dans le groupe constitué de L, 1. H, Y et F ;

à l'exception du cas où Xc, représente W et X10 représente F ;

X11 représentant A ;

X12 représentant F ; et

X11 représentant L ;

(ii) X9 représentant W ;

X10 représentant F;

X11 représentant, indépendamment de X9, Χκ,, X12 et X11, un acide aminé choisi dans le groupe constitué de E et A ;

X12 représentant, indépendamment de Xc,, X10, X11 et X13, un acide aminé choisi dans le groupe constitué de L et F ; et

X13 représentant L ;

à l'exception du cas où X11 représente A et Xj2 représente F ;

ou

(iii) Xg représentant W ;

X i d représentant F ;

X11 représentant A ;

X12 représentant, indépendamment de X9, X10, X11 et X13, un acide aminé choisi dans la liste constituée de A, R, D. N, C, E, Q, G. H, I, L, K, M, P, S. T, W. Y et V ; et

X13 représentant, indépendamment de X9, X10, X11 et X , un acide aminé choisi dans la liste constituée de A. R, D. N, C, E, Q, G. H, I, K, M. F. P, S. T, W, Y et V.

2. Procédé selon la revendication 1 , dans lequel un seul des groupements choisi parmi R,s. R9, R1o, Rn et R12, de préférence R1o, représente un groupement hydroxyle,

les autres groupements parmi R8, R9, R]0. Rn et R!2, identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en Ci -Cm linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hetéroatome choisi parmi O, N ou S ; un atome d'halogène ; un aryle en C5-C9 ; un hétéroeyele en C4-C9 ; un groupement (Ci-C3)alcoxy ; un acyle en C2-C3 ; un alcool en C1-C3 ; un groupement -COOH ; -NH2 ; -CON¾ ; -CHO ; -SH ; -C(0)0(C2-C3) ; une aminé en C1-C3 ; une imine en C1 -C3 ; un groupement nitrile ; un halogénoalkyle en C 1 -C3 ; et un thioalkyle en C1-C3 ; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;

les groupements R8, R9, Ru et Rn représentant de préférence des atomes d'hydrogène.

3. Procédé selon la revendication 2, dans lequel Rm représente un groupement hydroxyle et R8, R9, Ru et R12 représentent des atomes d'hydrogène.

4. Procédé selon la revendication 1, dans lequel :

R8 et un seul des groupements choisis parmi R1o, Ru et R12, de préférence R1o, représentent un groupement hydroxyle,

R() et les autres groupements parmi R1o, Ru et R12, identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en C 1 -C 10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O, N ou S ; un atome d'halogène ; un aryle en C5-C9 ; un hétérocycle en C4-C9 ; un groupement (Ci-C3)alcoxy ; un acyle en C2-C3 ; un alcool en C1-C3 ; un groupement -COOH ; -NH2 ; ~CON¾ ; -CHO ; -SH ; -C(0)0(C2-C3) ; une aminé en C 1 -C3 ; une iminc en C1-C3 ; un groupement nitrile ; un halogénoalkyle en Ci-C3 ; un thioalkyle en Ci-C3; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s).

5. Procédé selon la revendication 4, dans lequel R1o représente un groupement hydroxyle et R9, Ru et R12 représentent des atomes d'hydrogène.

6. Procédé selon l'une quelconque des revendications précédentes, dans lequel le cycle C représente un cycle de formule (II) ou (IV) telles que définies en revendication 1.

7. Procédé selon l'une quelconque des revendications précédentes, dans lequel R1 représente un cycle B de formule (VI) telle que définie en revendication 1.

8. Procédé selon l'une quelconque des revendications précédentes, dans lequel R1' et R2' représentent des atomes d'hydrogène, R2 représente un atome d'hydrogène ou un groupement -OH, et R3 et R3' forment ensemble un groupement =0.

9. Procédé selon l'une quelconque des revendications précédentes, dans lequel deux des groupements R4. R5, R,, et R7. de préférence R4 et R(1. représentent un groupement hydroxyle, les deux autres groupements étant tels que définis en revendication 1.

10. Procédé selon l'une quelconque des revendications précédentes, dans lequel R5 et R? représentent des atomes d'hydrogène.

1 1 . Procédé selon l'une quelconque des revendications précédentes, dans lequel ledit flavonoïde est de formule (VII). (VIII) ou ( IX) suivantes :

12. Procédé selon l'une quelconque des revendications précédentes, dans lequel la glucane-saecharase est choisie dans le groupe comprenant :

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 1 , ladite séquence ayant un acide aminé X1 représentant un acide aminé choisi dans le groupe constitué de H, N ou S ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 2, ladite séquence ayant un acide aminé X2 représentant un acide aminé choisi dans le groupe constitué de A. C, F, L, M, S ou V ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 3, ladite séquence ayant un acide aminé X3 représentant une acide aminé choisi dans le groupe constitué de A et N ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 4, ladite séquence ayant un acide aminé X4 représentant une acide aminé choisi dans le groupe constitué de C. I. N, P. V ou W ; - une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 5, ladite séquence ayant un acide aminé X5 représentant un acide aminé choisi dans le groupe constitué de C, . R ou V :

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 9, ladite séquence ayant un acide aminé X8 représentant un acide aminé choisi dans le groupe constitué de C ou L ; et

- une séquence ayant au moins 80% d'identité avec la SEQ ID NO : 12, ladite séquence ayant des acides aminés XQ, XJ O, XH, X12 et X13, avec :

(i) X9 représentant un acide aminé choisi dans le groupe constitué de G, V, C et F ;

X10 représentant F ; X11 représentant A ; X12 représentant F ; et X13 représentant

L ;

(ii) X9 représentant, indépendamment de X10, X1 1 , X12 et X,3. un acide aminé choisi dans le groupe constitué de S, N, L et I ;

X10 représentant, indépendamment de X». X11, X12 et X13, un acide aminé choisi dans le groupe constitué de L, I, H et Y ;

X11 représentant A ; X!2 représentant F ; et X13 représentant L ;

(iii) X9 représentant W ; X10 représentant F ; X11 représentant A ou E ; X12 représentant L ; et X13 représentant L ; ou

ladite séquence ayant au moins 80% d'identité avec la SEQ ID NO : 12 est la séquence SEQ ID NO : 1 3.

1 3. Dérivé de flavonoïde Ο-α-glycosylé obtenu par le procédé tel que défini dans l'une quelconque des revendications 1 à 12, dans lequel :

le cycle C représente le cycle de formule (IV) dans lequel le groupement R, représente un cycle B de formule (VI) ; et

au moins le cycle B est O-α-glycosylé.

14. Composé de formule (X) suivante

dans laquelleX représente une chaîne constituée d'au moins deux groupements α-glucoside, et X15 et X1(„ identiques ou différents, sont choisis dans le groupe comprenant un atome hydrogène : un alkyle en Ci-C(„ linéaire ou ramifié ; un groupement -C(0)0(C2-C3) ; et une chaîne constituée de 1 à 600.000 groupements α-glucoside.

15. Composé de formule XI) suivante :

dans laquelle

X17 représente une chaîne constituée de 1 à 600.000 groupements α-glucoside, et X18 et X19, identiques ou différents, sont choisis dans le groupe comprenant un atome hydrogène ; un alkyle en Ci-C6, linéaire ou ramifié ; un groupement -C(0)0(C2-C3) ; et une chaîne constituée de 1 à 600.000 groupements α-glucoside.

1 6. Utilisation cosmétique, à titre d'agent antioxydant, d'au moins un dérivé de flavonoïde Ο-α-glycosylé tel que défini dans l'une des revendications 14 et 15. 1 7. Dérivé de flavonoïde O-α-glycosylé tel que défini dans l'une des revendications 14 et 15, pour son utilisation pharmaceutique dans le traitement et/ou la prévention de l'hépatotoxicité, des allergies, de l'inflammation, des ulcères, des tumeurs, des troubles ménopausiques, ou des maladies neurodégénératives.

18. Dérive de flavonoïde Ο-α-glycosylé tel que défini dans l'une des revendications 14 et 15, pour son utilisation pharmaceutique à titre de veinotonique.

19. Utilisation d'un dérivé de flavonoïde O-α-glycosylé tel que défini dans l'une des revendications 14 et 1 5, à titre d'agent photovoltaïque, d'agent répulsif des insectes, d'agent de blanchiment, d'agent pesticide, fongicide et/ou bactéricide.

Description:
Nouveaux flavonoïdes Ο-α-glucosylés sur le cycle B, procédé d'obtention et utilisations.

Domaine de l'invention

La présente invention se rapporte au domaine de la glucosylation de flavonoïdes et plus particulièrement de lα-glucosylation de certains flavonoïdes, afin d'obtenir des dérivés de flavonoïdes Ο-α-glucosylés, notamment sur leur cycle aromatique B, au niveau de fonctions hydroxyle non vicinales.

La présente invention concerne également les composés O-α-glucosylés obtenus à l'issu d'un procédé de glucosylation de l'invention et la mise en œuvre de ces composés à différentes fins, notamment cosmétiques ou thérapeutiques.

Art antérieur

Les flavonoïdes sont des composés ayant une structure carbonée en C 6 -C 3 -C 6 dont le squelette est un système cyclique de type 1 -benzopyrane, dans lequel le cycle aromatique est défini en tant que cycle A et le cycle pyranique est défini en tant que cycle C, et qui comprend également un substituant phénylique, sur le cycle pyranique, en tant que cycle B.

Ils constituent un groupe de 8000 composés largement répandus dans le règne végétal où ils sont responsables de la couleur d'une partie des fleurs et des fruits. Ils peuvent ainsi y intervenir dans la protection contre les radiations solaires, dans la résistance contre les micro-organismes pathogènes de la plante et contre les animaux herbivores, ainsi que dans les relations d'interaction avec les autres organismes de l'environnement, tels que les champignons symbiotiques, les bactéries voire les insectes (Quideau S et al., Angew. Chem. Int. End. 201 1 50 : 586-621).

11 leur est par ailleurs attribué de nombreuses propriétés biologiques notamment des propriétés antioxydantes, antihépatotoxiques, antiallergiques, antiinflammatoires, anti ulcéreuses et antitumorales (Harborne J et al., Phytochemistry 2000 55 : 481-504 ; Quideau S et al., Angew. Chem. Int. End. 201 1 50 : 586-621 ).

Les flavonoïdes peuvent être hydroxylés en de nombreuses positions, et ces groupements hydroxyle sont fréquemment méthylés, acétylés, prénylés ou sulfatés. Dans les plantes, ils sont le plus souvent présents sous forme d'hétérosides solubles C- ou O-glycosylés.

Il existe à ce jour plusieurs voies d'obtention de flavonoïdes glucosylés.

De nombreux flavonoïdes existent naturellement sous la forme d'hétérosides. ln vivo, la glucosylation repose sur l'utilisation de glucosyl-transférases de type Leloir, capables de transférer le résidu glucosyle d'un nucléotide-sucre (UDP-glucose) sur le squelette du flavonoïde. Ces enzymes, contribuant à la synthèse de métabolites secondaires dans les plantes, sont reconnues pour avoir un large spectre de substrats accepteurs.

Toutefois, leurs niveaux de production par les cellules végétales sont très faibles et la réaction de β-glucosylation est la plus courante, comparativement à Γα-glucosylation. La glucosylation cellulaire peut avoir diverses incidences et influer sur l'adressage et/ou la toxicité des produits obtenus. Ainsi, bien que ce ne soit pas une règle absolue, il faut relever que généralement la glycosylation des flavonoïdes permet d'accroître la stabilité et la solubilité, et par conséquence la disponibilité, de ces molécules.

Plusieurs UDP glycosyl-transférases ont été isolées et clonées dans différents microorganismes. Les formes naturelles ou recombinantes de ces enzymes peuvent ainsi être mises en œuvre in vitro pour la production de flavonoïdes glucosylés.

Par exemple, l'UDP glycosyl-transférase (UGT) de Bacillus cereus a été exprimée dans Escherichia coli (E. coli). Cette enzyme glucosyle Papigénine, la génistéine, le kaempférol, la lutéoline, la naringénine et la quercétine. La position 3 est la position préférentiellement glucosylée, mais en l'absence de fonction hydroxyle sur cette position, la glucosylation a lieu sur la position 7. Les produits obtenus par l'enzyme recombinante sont identiques à ceux produits par l'enzyme sauvage (Ko J H et ai, FEMS Microbiol. Lett. 2006, 258 : 263-268).

De même, l'UDP-glucosyltransférase YjiC de Bacillus licheniformis DSM 13 a été utilisée pour glucosyler Papigénine. Deux formes β-mono-glucosylées, en position 4' ou en position 7, ont été obtenues. Une forme β-diglucosylée sur les positions 4' et 7 a également été caractérisée structural ement (Gurung R.B. et ai, Mol. Cells 2013, 36(4) : 355-361 ).

L'oléandomycine glycosyl-transférase (OleD GT) de Streptomyces antibioticus a été exprimée dans E. coli BL 21. L'enzyme purifiée catalyse la glucosylation de plusieurs flavonoïdes : apigénine, chrysine, daidzéine, génistéine, kaempférol, lutéoline, naringénine et quercétine, à partir d'UDP-glucose. La meilleure conversion (90 %) a été obtenue avec la naringénine à 20 μΜ en 5 h. Aucune indication sur la position de glucosylation n'est précisée dans la publication. (Choi S H et al., Biotechnol. Lett. 2012, 34 : 499-505).

L'UDP-glycosyltransférase RhGTl de Rosa hybrida a été testée sur une collection de 24 flavonoïdes. Elle montre des résultats comparables à ceux obtenus avec l'oléandomycine glycosyl-transférase en terme de reconnaissance d'accepteurs (Wang L et al., Carbohydr. Res. 2013, 368 : 73-77).

A ce jour, six UDP-glycosyl-transférases microbiennes sont connues pour avoir une activité de glucosylation sur les flavonoïdes (Wang L et ai, Carbohydr. Res. 2013, 368 : 73-77).

La glycosylation des flavonoïdes in vitro peut être réalisée par l'emploi d'enzymes du type glycoside-hydrolases, transglycosylases de type cyclodextrine- glucanotransférase ou glycoside-phosphorylases.

Plus particulièrement, la glycosylation enzymatique des flavonoïdes in vitro peut être réalisée via la mise en œuvre de glucane-saccharases. Une telle voie de synthèse conduit à l'obtention de flavonoïdes α-glucosylés, et repose sur l'utilisation de glucane- saccharases appartenant aux familles 13 ou 70 des glycosides-hydrolases (GH 13 et GH 70) (Classification CAZy - Henrissat B, Davies GJ, Curr. Op. Struct. Biol. 1 97, 7 : 637- 644).

Les glucane-saccharases sont des transglucosylases qui catalysent à partir de saccharose la synthèse d'homopolymères, constitués d'unités α-D-glucosyle, appelés glucane. Ces glucanes sont généralement de très haute masse molaire (10 8 Da), et présentent des structures variées dues à la présence de différents types de liaisons osidiques (α-1 ,2, α-1 ,3, α-1 ,4, et/ou α-1 ,6) ainsi qu'à leur localisation dans le polymère. Des isomères du saccharose et du glucose sont aussi produits à partir du saccharose mais en très faibles quantités comparativement au polymère.

Plus particulièrement, ces enzymes sont capables de glucosyler des molécules hydroxylées dites « accepteurs », introduites dans le milieu réactionnel en supplément du saccharose, tels que des flavonoïdes. Le degré de glucosylation de l'accepteur dépend de sa structure ainsi que de celle de l'enzyme. Ainsi, un accepteur efficace, ou bon accepteur, pourra détourner quasi totalement la synthèse de polymères au profit de sa propre glucosylation. Au contraire, un accepteur inefficace, ou mauvais accepteur, ne pourra que très faiblement détourner la synthèse de polymères et ne sera donc que très peu, voire pas, glucosylé.

C'est pourquoi ces enzymes sont étudiées depuis de nombreuses années afin notamment de proposer des outils enzymatiques innovants, performants pour la synthèse de molécules originales, et répondant à des besoins industriels notamment en termes de synthèse de nouveaux gluco-conjugués d'intérêt. En effet, pour des raisons évidentes, l'industrie est en recherche constante de nouveaux composés, pouvant notamment être produits dans des quantités suffisantes, et notamment à un coût le plus faible possible.

Dès 1995, la glucosylation de la catéchine avec une glucosyltransférase de

Streptococcus sobrinus 6715 (sérotype g) a été réalisée, dans un tampon phosphate 100 mM (pH 6) en présence de 1 g L de catéchine et de 2 % de saccharose (Nakahara et al., Appl. Environ Microbiol. 1995, 61 : 2768-2770). Le produit monoglucosylé obtenu avec un rendement de 13,7 % est la 4'-O-α-D-glucopyranosyl-(+)-catéchine.

Une enzyme similaire, la glucosyltransférase-D de Streptococcus mutons GS-5 a également été testée quelques années après sur le même substrat ( eulenbeld G et ai, Appl. Env. Microbiol. 1999, 65 : 4141 -4147). Deux produits de monoglucosylation ont ainsi été isolés : la 4'-O-α-D-glucopyranosyl-(+)-catéchine et la 7-O-α-D-glucopyranosyl- (+)-catéchine, ainsi qu'un produit di-glucosylé, la 4',7-O-α-D-glucopyranosyl-(+)- catéchine.

Une étude a été réalisée en 2000 pour déterminer la spécificité de la glucosyltransférase-D de Streptococcus mutons GS-5. Plusieurs accepteurs ont été testés (catéchol, 3-méthoxycatéchol, 3-méthylcatéchol, 4-méthylcatéchol, phénol, 3-hydroxyphénol, alcool benzylique, alcool 2-hydroxybenzylique, alcool 2-méthoxybenzylique, l -phényl-l,2-éthanediol, 4-méthylphénol, 3-méthylphénol, alcool 3,5-dihydroxybenzylique, 2-méthoxy-4-méthylphénol, alcool 2-méthoxybenzylique, alcool 3-méthoxybenzylique et catéchine) (Meulenbeld G Hartmans S., Biotechnol. Bioeng. 2000, 70 : 363-369). Seuls les accepteurs possédant deux groupements hydroxyle adjacents, et donc vicinaux, sur le cycle aromatique B ont été glucosylés.

Quelques années plus tard, la glucosylation enzymatique d'une flavone (la lutéoline) et de deux flavanols (la quercétine et la myricétine) a été effectuée en utilisant deux glucane-saccharases : la dextrane-saccharase de Le conostoc mesenteroides NRRL B-512F et l'alternane-saccharase de Leuconostoc mesenteroides NRRL B-23192 (Bertrand A et al., Carbohydr. Res. 2006, 341 : 855-863). Les réactions ont été effectuées dans un mélange de solvants aqueux-organiques pour améliorer la solubilité des substrats. Un taux de conversion de 44 % a été atteint après 24 heures de réaction catalysée par la dextrane- saccharase dans un mélange à 70 % de tampon aqueux acide acétique/acétate de sodium et de 30 % de bis(2-méthoxyéthyl) éther. Deux produits ont été caractérisés par RMN : la 3'-O-α-D-glucopyranosyllutéoline et la 4'-O-α-D-glucopyranosyllutéoline. En présence de l'alternane-saccharase, trois produits supplémentaires, à savoir la 4'-O-α-D-triglucopyranosyllutéoline et deux formes de

4'-O-α-D-diglucopyranosyllutéoline, ont été obtenus avec un taux de conversion en lutéoline de 8 %.

Les deux enzymes ont également été utilisées pour glucosyler la quercétine et la myricétine avec des taux de conversion respectifs de 4 % et 49 %. Aucune glucosylation n'a toutefois été observée lorsque ces deux enzymes ont été utilisées avec de la diosmétine, de la diosmine et de la 7-P-D-glucopyranosyldiosmétine.

La glucosylation de la quercétine en présence de saccharose et de glucane- saccharase de la souche Leuconostoc mesenteroides NRRL B-1299 a également été décrite dans la demande coréenne KR20060063703.

L'épigallocatéchine gallate a également été glucosylée en présence de saccharose et de la glucane-saccharase de Leuconostoc mesenteroides B-1299CB (Moon et al., Journal of Molecular Catalysis B : Enzymatic. 2006, 40 : 1-7). Un mélange de trois produits a été obtenu :

- un produit de monoglucosylation : la 4"-O-α-D-glucopyranosylépigallocatéchine gallate (1 ,7 %) ; et

- deux produits de di-glucosylation : la 7,4"-O-α-D-glucopyranosylépigallocatéchine (22,7 %) et la 4',4"-di-O-α-D-glucopyranosylépigallocatéchine gallate (23,8 %).

La glucosylation de la quercétine a été réalisée en 2007 en présence de saccharose et de la glucane-saccharase de Leuconostoc mesenteroides B-1299CB (Moon Y H et al, Enzyme Microb. Technol. 2007, 40 : 1 124-1 129). Un mélange de deux produits monoglucosylés est obtenu : la 4'-O-α-D-glucopyranosylquercétine et la 3'-O-α-D-glucopyranosylquercétine.

L'amylosaccharase de Deinococ us geothermalis a été exprimée dans E. coîi et étudiée pour la glucosylation de la (+)-catéchine et la 3'-O-α-D-maltosyIcatéchine (Cho H et al. , Enzyme Microb. Technol. 201 1 , 49(2) : 246-253).

Dans la demande de brevet américain US 201 10183930A1 , Auriol et al. ont décrit la préparation de dérivés phénoliques obtenus par condensation enzymatique entre des composés phénoliques sélectionnés parmi les pyrocatéchols ou leurs dérivés, et le résidu glucosyle provenant du saccharose. La production de ces dérivés de composés phénoliques est réalisée avec une glucosyltransférase (EC 2.4.1.5). Les O-α-D-glucosides de composés phénoliques synthétisés présentent une solubilité dans l'eau supérieure à celle de leur parent polyphénol.

Ces composés y sont notamment décrits pour leur utilisation en tant qu'agent antioxydant, antiviral, antibactérien, immunostimulant, antiallergique, antihypertenseur, anti-ischémique, antiarythmique, antithrombique, hypocholestérolémiant, antilipopéroxidant, hépatoprotecteurs, anti-inflammatoires, anticarcinogènes, antimutagènes, antinéoplasiques et vasodilatateurs.

La glucosylation de Tastragaline en présence de saccharose et de la glucane- saccharase de Leuconostoc mesenteroides B-512FMCM a également été réalisée (Kim G E et al.. Enzyme Microb Technol. 2012, 50 : 50-56). Neuf produits ont été isolés, à savoir :

- deux produits de monoglucosylation : le kaempférol-3-O-P-D- glucopyranosyl-(l→6)-O-α-D-glucopyranoside et le kaempférol-3-O-p-D-glucopyranosyl- (l→3)-O-α-D-glucopyranoside ; et

- sept produits de polyglucosylation de l'astragaline (liaisons de type α-(l→6)).

La glucosylation de l'ampélopsine a en outre été réalisée en présence de saccharose et de la glucane-saccharase de Leuconostoc mesenteroides B-1299CB4. Cinq produits de glucosylation ont été isolés et le produit de monoglucosylation caractérisé : il s'agit de la 4'-O-α-D-glucopyranosylampélopsine (Woo H J et ai, Enzyme Microb. Technol. 2012 51 : 31 1 -318).

Toutefois, à la connaissance des inventeurs, et malgré le très grand nombre d'expérimentations effectuées depuis de nombreuses années dans le domaine, la glucosylation de flavonoïdes monohydroxylés ou hydroxylés de façon non-vicinale, sur le cycle B, n'a jamais été réalisée.

Il existe en conséquence un besoin, dans l'état de la technique, pour la disponibilité de flavonoïdes α-glucosylés, et notamment O-α-glucosylés, sur des groupements hydroxylés non vicinaux, notamment sur le cycle B.

Résumé de l'invention

Ainsi, la présente invention fournit un procédé de fabrication de dérivés de flavonoïde O-α-glucosylés comprenant au moins une étape d'incubation d'une glucane- saccharase avec un flavonoïde et au moins un saccharose, dans lequel:

(A) ledit flavonoïde est de formule (I) suivante :

dans laquelle

le cycle C représente un cycle choisi dans le groupe constitué des cycles de formules (II), (111), (IV) ou (V) suivantes:

dans lesquels :

l'un des groupements R1 , R2 ou R3 représente un cycle B de formule (VI)

dans lequel :

(a) un seul des groupements choisi parmi R 8 , R 9 , R 10 , R 11 et R 12 représente un groupement hydroxyle,

les autres groupements parmi R 8 , R 9 , R 10 , R 11 et R 12 , identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en C 1 -C 10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O, N ou S ; un atome d'halogène ; un aryle en C 5 -C 9 ; un hétérocycle en C 4 -C 9 ; un groupement (C 1 -C 3 )alcoxy ; un acyle en C 2 -C 3 ; un alcool en C 1 -C 3 ; un groupement -COOH ; -NH 2 ; -CONH 2 ; -CHO ; -SH ; -C(O)O(C 2 -C 3 ) ; une aminé en C 1 -C 3 ; une imine en C 1 -C 3 ; un groupement nitrile ; un halogénoalkyle en C 1 -C 3 ; un thioalkyle en C 1 -C 3 ; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;

ou

(b) R 8 et un seul des groupements choisis parmi R 10 , R 11 et R 12 représentent un groupement hydroxyle,

R 9 et les autres groupements parmi R 10 , R 11 et R 12 , identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en C 1 -C 10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O, N ou S ; un atome d'halogène ; un aryle en C 5 -C 9 ; un hétérocycle en C 4 -C 9 ; un groupement ( C 1 -C 3 )alcoxy ; un acyle en C 2 -C ; un alcool en C 1 -C 3 ; un groupement -COOH ; -NH 2 ; -CONH 2 ; -CHO ; -SH ; -C(O)O(C 2 -C 3 ) ; une aminé en C 1 -C 3 ; une imine en C 1 -C 3 ; un groupement nitrile ; un halogénoalkyle en C 1 -C 3 ; un thioalkyle en C 1 -C 3 ; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;

ou

(c)R 9 et un seul des groupements choisis parmi R 11 et R 12 représentent un groupement hydroxyle,

les groupements R 8 , R 10 , et l'autre groupement parmi R 11 et R 12 , identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en C 1 -C 10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O, N ou S ; un atome d'halogène ; un aryle en C 5 -C 9 ; un hétérocycle en C 4 -C 9 ; un groupement (C 1 -C 3 )alcoxy ; un acyle en C 2 -C 3 ; un alcool en C 1 -C 3 ; un groupement -COOH ; -NH 2 ; -CONH 2 ; -CHO ; -SH ; -C(O)O(C 2 -C 3 ) ; une aminé en C 1 -C 3 ; une imine en C 1 -C 3 ; un groupement nitrile ; un halogénoalkyle en C 1 -C 3 ; un thioalkyle en C 1 -C 3 ; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;

ou

(d) R 10 et R 12 représentent un groupement hydroxy,

les groupements R 8 , R 9 et R 11 , identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en C 1 -C 10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O, N ou S ; un atome d'halogène ; un aryle en C 5 -C 9 ; un hétérocycle en C 4 -C 9 ; un groupement (C 1 -C 3 )alcoxy ; un acyle en C 2 -C 3 ; un alcool en C 1 -C 3 ; un groupement -COOH ; -NH 2 ; -CONH 2 ; -CHO ; -SH ; -C(O)O(C : -C 3 ) ; une aminé en C 1 -C 3 ; une imine en C 1 -C 3 ; un groupement nitrile ; un halogénoalkyle en C 1 -C 3 ; un thioalkyle en C 1 -C 3 ; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;

ou

(e) R 8 , R 10 et R 12 représentent un groupement hydroxy,

les groupements R 9 et R 11 , identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en C 1 -C 10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O, N ou S ; un atome d'halogène ; un aryle en C5-G) ; un hétérocycle en C 4 -C 9 ; un groupement (C 1 -C 3 )alcoxy ; un acyle en C 2 -C 3 ; un alcool en C 1 -C 3 ; un groupement -COOH ; -NH 2 ; -CONH 2 ; -CHO ;-SH ; -C(O)O(C 2 -C 3 ) ; une aminé en C 1 -C 3 ; une imine en C 1 -C 3 ; un groupement nitrile ; un halogénoalkyle en C 1 -C 3 ; un thioalkyle en C 1 -C 3 ; un groupement

-C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;

les groupements R 1 , R 2 et R 3 qui ne représentent pas un cycle B de formule (VI), identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un alkyle en C 1 -C 6 , linéaire ou ramifié ; un groupement -OH ; une aminé en C 1 -C 3 ; un groupement-COOH ; -C(O)O(C 2 -C 3 ) ; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;

R 1 \ R 2 ' et R 3 \ identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en C 1 -C 10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O, N ou S ; un atome d'halogène ; un aryle en C 5 -C 9 ; un hétérocycle en C 4 -C 9 ; un groupement

(C 1 -C 3 )alcoxy ; un acyle en C -C 3 ; un alcool en C 1 -C 3 ; un groupement -COOH ; -NH 2 ; -CONH 2 ; -CHO ; -SH ; -C(O)O(C 2 -C 3 ) ; une aminé en C 2 -C 3 ; une aminé en C 1 -C 3 ; une imine en C 1 -C 3 ; un groupement nitrile ; un halogénoalkyle en C 1 -C 3 ; un thioalkyle en C 1 -C 3 ; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;

ou les groupements R 1 et RT lorsque R 1 ne représente pas un cycle B de formule (VI), ou R 2 et R 2 ' lorsque R 2 ne représente pas un cycle B de formule (VI), ou R 3 et R ' lorsque R 3 ne représente pas un cycle B de formule (VI), forment ensemble un groupement =0;

R , R5, RÔ et R 7 , identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en C 1 -C 10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O, N ou S ; un atome d'halogène ; un aryle en Cs-Ci» ; un hétérocycle en C 4 -Cg ; un groupement

(C 1 -C 3 )alcoxy ; un acyle en C 2 -C 3 ; un alcool en C 1 -C 3 ; un groupement -OH ; -COOH ; -NH 2 ; -CONH 2 ; -CHO ; -SH ; -C(O)O(C 2 -C 3 ) ; une aminé en d-C 3 ; une imine en C 1 -C 3 ; un groupement nitrile ; un halogénoalkyle en C 1 -C 3 ; un thioalkyle en C 1 -Cj ; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ;

et

(B) ladite glucane-saccharase étant choisie dans le groupe comprenant :

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 1, ladite séquence ayant un acide aminé X 1 représentant un acide aminé choisi dans le groupe constitué de A, C, E, F, G, H, I, , M, N, P, Q, S, T, V et Y ;

- une séquence ayant au moins 80 % d'identité avec la SEQ 1D NO : 2, ladite séquence ayant un acide aminé X 2 représentant un acide aminé choisi dans le groupe constitué de A. C, D, F, G, H, K, L, M, N, P, S, V et Y ;

- une séquence ayant au moins 80 % d'identité avec la SEQ BD NO : 3, ladite séquence ayant un acide aminé X 3 représentant un acide aminé choisi dans le groupe constitué de A, C, G, I, K., M, N et W ;

- une séquence ayant au moins 80 % d'identité avec la séquence

SEQ ID NO : 4, ladite séquence ayant un acide aminé X 4 représentant un acide aminé choisi dans le groupe constitué de C, I, N, P, V et W ;

- une séquence ayant au moins 80 % d'identité avec la séquence SEQ ID NO : 5, ladite séquence ayant un acide aminé X 5 représentant un acide aminé choisi dans le groupe constitué de A, C, D, G, I, K, L, M, R, V et W ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 6, ladite séquence ayant un acide aminé X 6 représentant un acide aminé choisi dans le groupe constitué de C, G, Q, S et T ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 7, ladite séquence ayant un acide aminé X 7 représentant un acide aminé choisi dans le groupe constitué de A et G ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 8 ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 9, ladite séquence ayant un acide aminé Xg représentant un acide aminé choisi dans le groupe constitué de C, I et L ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 10 ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 1 1 ; et - une séquence ayant au moins 80% d'identité avec la SEQ ID NO : 12, ladite séquence ayant des acides aminés X 9 , X 10 , X 11 , X 12 et X 13 , avec :

(i) X 9 représentant, indépendamment de X 10 , X 11 , X 12 et X 13 , un acide aminé choisi dans le groupe constitué de G, S, V, C, F, N, I, L et W ;

X 10 représentant, indépendamment de XQ, X 11 , X 12 et X 13 , un acide aminé choisi dans le groupe constitué de L, I, H, Y et F ;

à l'exception du cas où X 9 représente W et X 10 représente F ;

X 11 représentant A ;

X 12 représentant F ; et

X 13 représentant L ;

(ii) X 9 représentant W ;

X 10 représentant F ;

X 11 représentant, indépendamment de X 9 , X 10 , X 11 et X 13 , un acide aminé choisi dans le groupe constitué de E et A ;

X 12 représentant, indépendamment de X 9 , X 10 , X 11 et X 13 , un acide aminé choisi dans le groupe constitué de L et F et

X 13 représentant L ;

à l'exception du cas où X 11 représente A et X 12 représente F ;

ou

(iii) X 9 représentant W ;

X 10 représentant F ;

Xu représentant A ;

X 12 représentant, indépendamment de X<>, Χ )0 , X 11 et X 13 , un acide aminé choisi dans la liste constituée de A, R, D, N, C, E, Q, G, H, I, L, , M, P, S, T, W, Y et V, de préférence I ; et

X 13 représentant, indépendamment de X 9 , X 1() , X 11 et X 12 , un acide aminé choisi dans la liste constituée de A, R, D, N, C, E, Q, G, H, I, K, M, F, P, S, T, W, Y et V, de préférence I.

Les inventeurs ont en effet montré, de manière totalement inattendue, que certaines glucane-saccharases spécifiques mutées, décrites ci-après dans le présent texte, possèdent la capacité de générer de nouveaux flavonoïdes O-α-glucosylés sur des groupements hydroxyles non vicinaux, notamment sur le cycle B. Ces enzymes mutées possèdent en effet une activité de glucosylation supérieure, voire très supérieure à leur formes sauvages, de ces flavonoïdes spécifiques, habituellement considérés comme étant de mauvais récepteurs, car très difficiles à glucosyler, notamment sur le cycle B.

Plus particulièrement, une glucane-saccharase mise en œuvre dans un procédé de l'invention est choisie dans le groupe comprenant :

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 1 , ladite séquence ayant un acide aminé X 1 représentant un acide aminé choisi dans le groupe constitué de H, N ou S ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 2, ladite séquence ayant un acide aminé X 2 représentant un acide aminé choisi dans le groupe constitué de A, C, F, L, M, S ou V ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 3, ladite séquence ayant un acide aminé X 3 représentant une acide aminé choisi dans le groupe constitué de A et N ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 4, ladite séquence ayant un acide aminé X 4 représentant une acide aminé choisi dans le groupe constitué de C, I, N, P, V ou W ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 5, ladite séquence ayant un acide aminé X 5 représentant un acide aminé choisi dans le groupe constitué de C, , R ou V ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 9, ladite séquence ayant un acide aminé X 8 représentant un acide aminé choisi dans le groupe constitué de C ou L ; et

- une séquence ayant au moins 80% d'identité avec la SEQ ID NO : 12, ladite séquence ayant des acides aminés X 9 , X 10 , X 11 et X 13 , avec :

(i) X 9 représentant un acide aminé choisi dans le groupe constitué de G, V, C et

F ;

X 10 représentant F ; X 11 représentant A ; X 12 représentant F ; et X 13 représentant L ; (ii) X 9 représentant, indépendamment de X 9 , X 10 , X 11 et X 13 , un acide aminé choisi dans le groupe constitué de S, N, L et I ;

X 10 représentant, indépendamment de X 9 , X 11 , X 12 et X 13 , un acide aminé choisi dans le groupe constitué de L, I, H et Y ;

X 11 représentant A ; X 12 représentant F ; et X 13 représentant L ;

(iii) X 9 représentant W ; X 10 représentant F ; X 11 représentant A ou E ; X 12 représentant L ; et X 13 représentant L ; ou

ladite séquence ayant au moins 80% d'identité avec la SEQ ID NO : 12 est la séquence SEQ ID NO : 13.

L'invention a également pour objet un dérivé de flavonoïde O-α-glycosylé obtenu par le procédé de l'invention, et notamment de formule (I) telle que définie ci- dessus dans laquelle le cycle C représente le cycle de formule (IV) dans lequel le groupement R 1 représente un cycle B de formule (VI) ; et au moins le cycle B est O-α-glycosylé.

La présente invention permet en effet avantageusement d'obtenir des dérivés de flavonoïde selon l'invention au moins O-α-glycosylés, en particulier O-α-glucosylés, sur le cycle B.

L'invention concerne en outre un composé de formule (X) suivante :

dans laquelleX 14 représente une chaîne constituée d'au moins deux groupements

α-glucoside, et X 1 5 et X 16 , identiques ou différents, sont choisis dans le groupe comprenant un atome hydrogène ; un alkyle en C 1 -C 6 , linéaire ou ramifié ; un groupement -C(O)O(C 2 -C 3 ) ; et une chaîne constituée de 1 à 600.000 groupementsα-glucoside. Une chaîne constituée de 1 à 600.000 groupements α-glucoside selon l'invention peut plus particulièrement être constituée de 1 à 500.000 groupements α-glucoside, de 1 à 400.000 groupements α-glucoside, de 1 à 300.000 groupements α-glucoside, de 1 à 200.000 groupements α-glucoside, de 2 à 100.000 groupements α-glucoside, de 5 à 50.000 groupements α-glucoside, de 10 à 25.000 groupements α-glucoside ou de 10 à 10.000 groupements α-glucoside.

L'invention est encore relative à un composé de formule (XI) suivante :

dans laquelle

X 17 représente une chaîne constituée de 1 à 600.000 groupements α-glucoside, et

X 18 et X 19 , identiques ou différents, sont choisis dans le groupe comprenant un atome hydrogène ; un alkyle en C 1 -C 6 , linéaire ou ramifié ; un groupement -C(O)O(C 2 -C ) ; et une chaîne constituée de 1 à 600.000 groupements α-glucoside.

La présente invention concerne également l'utilisation cosmétique, à titre d'agent antioxydant, d'au moins un dérivé de flavonoïde Ο-α-glycosylé conforme à l'invention.

La présente invention vise en outre un dérivé de flavonoïde O-α-glycosylé conforme à l'invention, pour son utilisation pharmaceutique dans le traitement et/ou la prévention de l'hépatotoxicité, des allergies, de l'inflammation, des ulcères, des tumeurs, des troubles ménopausiques, ou des maladies neurodégénératives.

Un autre aspect de l'invention concerne un dérivé de flavonoïde O-α-glycosylé conforme à l'invention pour son utilisation pharmaceutique à titre de veinotonique.

Enfin, la présente invention est relative à l'utilisation d'un dérivé de flavonoïde

Ο-α-glycosylé conforme à l'invention à titre d'agent photovoltaïque, d'agent répulsif des insectes, d'agent de blanchiment, d'agent pesticide, fongicide et/ou bactéricide. Dans le cadre de la présente invention, et sauf mention différente dans le texte, on entend par :

- groupement hydrocarboné en C 1 -C 10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O, N ou S : un alkyle ou un alkylène ;

- alkyle : un groupe aliphatique hydrocarboné saturé, linéaire ou ramifié, comprenant de 1 à 10, de préférence de 1 à 6 atomes de carbone ;

- cycloalkyle : un groupe alkyle cyclique comprenant de 3 à 10 chaînons, de préférence de 3 à 8 chaînons. Le groupe cycloalkyle est éventuellement substitué par un ou plusieurs atomes d'halogène et/ou groupes alkyles ;

- hétérocycle : un groupe alkyle cyclique comprenant de 4 à 9 chaînons, de préférence de 3 à 8 chaînons, et constitué de 1 à 3 cycles, comprenant entre 3 et 6 atomes de carbone et 1 ou plusieurs hétéroatomes, par exemple 1, 2 ou 3 hétéroatomes, de préférence 1 ou 2, choisis parmi l'azote, l'oxygène et le soufre. Le groupe hétérocycle est éventuellement substitué par un ou plusieurs atomes d'halogène et/ou groupes alkyles ;

- groupe alkyle partiellement cyclique : on entend un groupe alkyle dont seulement une partie forme un cycle ;

- alkylène : un groupe alkylène divalent, linéaire ou ramifié, comprenant de 1 à 10, de préférence de 1 à 6, atomes de carbone ;

- aryle : un groupe aromatique cyclique comprenant entre 5 et 9 atomes de carbone, par exemple un groupe phényle ;

- hétéroaryle : un groupe aromatique cyclique comprenant entre 3 et 10 atomes dont 1 ou plusieurs hétéroatomes, par exemple entre 1 et 4 hétéroatomes, tels que l'azote, l'oxygène ou le soufre, ce groupe comprenant un ou plusieurs cycles, de préférence 1 ou 2 cycles. Les hétérocycles peuvent comprendre plusieurs cycles condensés. Les hétéroaryles sont éventuellement substitués par un ou plusieurs groupes alkyles ou un atome d'oxygène. A titre d'exemples, on peut citer les groupes thiényle, pyridinyle, pyrazolyle, imidazolyle. thiazolyle et triazolyle ;

- halogène : un atome de chlore, de fluor, de brome ou d'iode ;

- alcool en C 1 -C 3 : un alcool choisi parmi le méthanol, l'éthanol, le propanol et l'isopropanol ; - un (C 1 -C 3 )alcoxy : un groupement choisi parmi un méthoxyle, un éthoxyle, un propyloxyle, et un isopropyloxyle ;

- acyle en C 2 -C 3 : un groupement choisi parmi un acétyle, un propylacétyle et un isopropylacétyle ;

- aminé en C 1 -C 3 : un groupement choisi parmi une méthylamine, une éthylamine et une propylamine ;

- imine en C 1 -C 3 : un groupement choisi parmi une méthylimine, une éthylimine et une propylimine ;

Dans la présente demande le terme « glycoside » est employé afin de désigner un motif glycoside.

Les motifs glycoside sont connus de l'homme du métier.

A titre d'exemples de glycosides monosaccharides, les glycosides suivants peuvent être cités : glucose, fructose, sorbose, mannose, galactose, talose, allose, gulose, idose, glucosamine, N-acétylglucosamine, mannoamine, galactosamine, acide glucuronique, rhamnose, arabinose, acide galacturonique, fucose, xylose, lyxose et ribose.

A titre d'exemples de glycosides di- ou oligo- saccharides, les glycosides suivants peuvent être cités:

- di-saccharides: maltose, gentiobiose, lactose, cellobiose, isomaltose, melibiose, laminaribiose, chitobiose, xylobiose, mannobiose, sophorose, nigerose, kojibiose, rutinose, robinose,

- oligo-sacchacaride: panose, galactotriose, β-glucotriose, β-glucotétraose, galactotétraose, les maltodextrines notamment, maltotriose, isomaltotriose, maltotetraose, maltopentaose, maltoheptaose.

Peuvent également être cités à titre d'exemples de glycosides:

- les dérives de l'amidon, notamment le maltose, les maltodextrines,

- les dérivés de la cellulose,

- les pectines et leurs dérivés,

- la chitine, le chitosane et leurs dérivés,

- les glucoaminoglucanes et leurs dérivés,

- les dérivés du xyloglucanes,

- les galactomannanes et leurs dérivés. Au sens de l'invention, on entend par « une chaîne constituée de 1 à 6 glycoside(s) » un enchaînement de 1 à 6 glycosides mentionnés ci-dessus.

De même, au sens de la présente invention, on entend par « une chaîne constituée de 1 à 600.000 groupements o-glucoside un enchaînement de une à 600.000 unités glucosyle liées les unes aux autres par des liaisons a.

Description des figures

La Figure 1 illustre les efficacités de glucosylation de l'apigénine (histogramme - Ordonnée de gauche - %), les niveaux d'activité relative sur saccharose seul (● points noirs - Ordonnée de droite - UA) et les concentrations massiques en apigénine glucosylée (valeurs portées au-dessus de l'histogramme - mg/L), des enzymes ASNp WT, DSR-S vardelA4N WT et de leurs mutants ASNp I228F, ASNp I228L, ASNp I228M, ASNp F229A, ASNp F229N, ASNp A289W, ASNp F290C, ASNp F290K et DSR-S vardelA4N S512C.

La Figure 2 illustre la superposition des chromatogrammes UV (λ340 nm) pour les six mutants représentatifs des six catégories de profils de produits de glucosylation de l'apigénine. Le nom des enzymes correspondants à ces réactions est indiqué à côté de chaque chromatogramme : ASNp A289W, DSR-S vardelA4N S512C, ASNp F290 , ASNp F290C, ASNp F229N et ASNp 1228F. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units).

La Figure 3 illustre la superposition des chromatogrammes UV (λ340 nm) pour les sept mutants représentatifs des six catégories de profils de produits de glucosylation de la naringénine. Le nom des enzymes correspondants à ces réactions est indiqué à côté de chaque chromatogramme : ASNp F290V, ASNp R226N, ASR C-APY del, «-1 ,2 BrS, ASNp A289C, ASNp A289P/F290C et ASNp I228A. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units).

La Figure 4 illustre le profil de chromatographie UV obtenu après glucosylation de l'apigénine, pour l'enzyme ASNp sauvage (ASNp WT), en comparaison avec le standard d'apigénine. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units).

La Figure 5 illustre le profil de chromatographie UV obtenu après glucosylation de l'apigénine, pour l'enzyme mutante ASNp I228F. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units). La nature des différents pics est indiquée directement sur le profil.

La Figure 6 illustre le profil de chromatographie UV obtenu après glucosylation de l'apigénine, pour l'enzyme mutante ASNp I228L. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units).

La Figure 7 illustre le profil de chromatographie UV obtenu après glucosylation de l'apigénine, pour l'enzyme mutante ASNp I228M. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units). La nature des différents pics est indiquée directement sur le profil.

La Figure 8 illustre le profil de chromatographie UV obtenu après glucosylation de l'apigénine, pour l'enzyme mutante ASNp F229A. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units). La nature des différents pics est indiquée directement sur le profil.

La Figure 9 illustre le profil de chromatographie UV obtenu après glucosylation de l'apigénine, pour l'enzyme mutante ASNp F229N. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units). La nature des différents pics est indiquée directement sur le profil.

La Figure 10 illustre le profil de chromatographie UV obtenu après glucosylation de l'apigénine, pour l'enzyme mutante ASNp A289W. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units). La nature des différents pics est indiquée directement sur le profil.

La Figure 11 illustre le profil de chromatographie UV obtenu après glucosylation de l'apigénine, pour l'enzyme mutante ASNp F290C. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units). La nature des différents pics est indiquée directement sur le profil.

La Figure 12 illustre le profil de chromatographie UV obtenu après glucosylation de l'apigénine, pour l'enzyme mutante ASNp F290K. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units). La nature des différents pics est indiquée directement sur le profil.

La Figure 13 illustre le profil de chromatographie UV obtenu après glucosylation de l'apigénine, pour l'enzyme mutante DSR-S vardelA4N S512C. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units). La nature des différents pics est indiquée directement sur le profil.

La Figure 14 illustre le spectre de masse haute résolution en mode électrospray positif pour la forme mono-glucosylée de l'apigénine obtenue avec l'enzyme mutante DSR-S vardelA4N S512C. En abscisse : rapport m/z ; En ordonnée : abondance relative.

La Figure 15 illustre le spectre MS MS haute résolution en mode électrospray négatif pour la forme mono-glucosylée de l'apigénine (à m/z 431 ,11) obtenue avec l'enzyme mutante DSR-S vardelA4N S512C. En abscisse : rapport m/z ; En ordonnée : abondance relative.

La Figure 16 illustre le spectre de masse haute résolution en mode électrospray positif pour la forme mono-glucosylée de l'apigénine obtenue avec l'enzyme mutante ASNp A289W. En abscisse : rapport m/z ; En ordonnée : abondance relative.

La Figure 17 illustre le spectre de masse haute résolution en mode électrospray positif pour les formes di-glucosylées de l'apigénine obtenue avec l'enzyme mutante ASNp A289W. En abscisse : rapport m/z ; En ordonnée : abondance relative.

La Figure 18 illustre le spectre MS MS haute résolution en mode électrospray négatif pour une des deux formes di-glucosylées de l'apigénine (à m/z 593,16) obtenue avec l'enzyme mutante ASNp A289W. En abscisse : rapport m/z ; En ordonnée : abondance relative.

Structure de l'ion m/z à 353,0667, signature d'une glucosylation de chacune des deux positions 5 et 7 du cycle A de l'apigénine.

La Figure 19 illustre le spectre MS/MS haute résolution en mode électrospray négatif pour une des deux formes di-glucosylées de l'apigénine (à m/z 593,16) obtenue avec l'enzyme mutante ASNp A289W. En abscisse : rapport m/z ; En ordonnée : abondance relative.

Fragmentation de la forme di-glucosylée sur la position 4' du cycle B de l'apigénine conduisant à l'ion m/z à 269,0451.

La Figure 20 illustre le profil de chromatographie UV obtenu après glucosylation de la naringénine, pourr l'enzyme ASNp sauvage (ASNp WT), en comparaison avec le standard de naringénine. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units). La Figure 21 illustre le profil de chromatographie UV obtenu après glucosylation de la naringénine, pour l'enzyme mutante ASNp 1228 A. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units).

La Figure 22 illustre le profil de chromatographie UV obtenu après glucosylation de la naringénine, pour l'enzyme mutante ASNp A289C. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units).

La Figure 23 illustre le profil de chromatographie UV obtenu après glucosylation de la naringénine, pour l'enzyme sauvage tronquée ASR-C-APY-del. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units).

La Figure 24 illustre le profil de chromatographie UV obtenu après glucosylation de la naringénine, pour l'enzyme mutante ASNp A289P/F290C. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units).

La Figure 25 illustre le profil de chromatographie UV obtenu après glucosylation de la naringénine, pour l'enzyme sauvage α- 1 ,2 BrS. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units).

La Figure 26 illustre le profil de chromatographie UV obtenu après glucosylation de la naringénine, pour l'enzyme mutante ASNp F290V. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units).

La Figure 27 illustre le profil de chromatographie UV obtenu après glucosylation de la naringénine, pour l'enzyme mutante ASNp R226N. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units).

La Figure 28 illustre le spectre RMN 2D 1 H COSY de la 4 , -O-α-D-glucopyranosylnaringénine. En abscisse et ordonnée : déplacement chimique, en partie par million (ppm).

La Figure 29 illustre le spectre RMN 1D 13 C Jmod de la

4'-O-α-D-glucopyranosylnaringénine. En abscisse et ordonnée : déplacement chimique, en partie par million (ppm). La Figure 30 illustre le spectre RMN 2D HMBC de la 4'-O-α-D-glucopyranosylnaringénine. En abscisse et ordonnée : déplacement chimique, en partie par million (ppm).

La Figure 31 illustre la superposition des profils chromatographiques obtenus par LC-UV-MS pour les produits de glucosylation de la morine par l'enzyme ΔN 123 -GBD-CD2 WT et trois des mutants les plus efficaces pour glucosyler ce flavonoîde. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units).

La Figure 32 illustre la superposition des profils chromatographiques obtenus par LC-UV-MS pour les produits de glucosylation de la naringénine par l'enzyme ΔN 123 -GBD-CD2 et trois de ses mutants efficaces pour glucosyler ce flavonoîde. En abscisse : Temps de rétention en minutes ; En ordonnée : Absorbance en mAU (Milliabsorbance Units). Description détaillée de l'invention

Afin de rendre disponibles de nouveaux flavonoïdes O-α-glucosylés, le demandeur a mis au point un nouveau procédé de synthèse de nouvelles structures d'α-gluco-flavonoïdes spécifiquement glycosylés sur des hydroxyles non vicinaux, en particulier du cycle B. Ce procédé met en œuvre des glucane-saccharases spécifiques mutées, identifiées par le demandeur, aptes à effectuer une telle glucosylation.

Ces enzymes spécifiques ne nécessitent pour cela que la présence de saccharose, une agro-ressource renouvelable et bon marché. A ce titre, un procédé selon l'invention est avantageusement peu coûteux. Glucane-saccharases de l'invention

La présente invention concerne en premier lieu un procédé de fabrication de dérivés de flavonoîde O-α-glucosylés comprenant au moins une étape d'incubation d'une enzyme de l'invention avec un flavonoîde de formule (I) et au moins un saccharose.

Comme indiqué précédemment, les enzymes de l'invention sont avantageusement aptes à glucosyler des flavonoïdes au niveau de fonction(s) hydroxyle(s) non-vicinale(s), notamment présentent sur le cycle B. Ces enzymes consistent plus particulièrement en des glucane-saccharases appartenant aux familles 13 et 70 des glycoside-hydrolases (GH13 et GH70).

Les glucane-saccharases appartenant à la famille 13 sont naturellement produites par les bactéries des genres Deinococcus, Neisseria ou Alteromonas.

Les glucane-saccharases appartenant à la famille 70 sont quant à elles naturellement produites par des bactéries lactiques des genres Leuconostoc, Lactobacillus, Sireptococcus ou Weisscla sp..

Comme indiqué précédemment, différentes glucane-saccharases sauvages des familles 13 ou 70 des glycoside-hydrolases ont déjà été utilisées pour la production de flavonoïdes glucosylés, mais aucune d'entre elle n'a à ce jour été décrite comme étant capable de glucosyler les flavonoïdes plus particulièrement visés dans la présente invention, à savoir ceux monohydroxylés sur le cycle B ou possédant des fonctions hydroxyles non-vicinales sur le cycle B.

Or, comme montré dans les exemples, les inventeurs ont déterminé des variants de ces enzymes, mutés au niveau de leur site de fixation aux flavonoïdes, et aptes à glucosyler de tels composés de manière efficace.

L'ensemble des enzymes sauvages ou mutées décrites dans la présente demande qui étaient connues de l'homme du métier n'avait à ce jour jamais été mis en œuvre afin de glucosyler des flavonoïdes selon l'invention.

La séquence nucléotidique de la forme sauvage de l'enzyme ASNp

(AmyloSucrase Neisseria polysacchareà) (famille GH13) a pour référence GenBank AJ01 1781.1 tandis que sa séquence polypeptidique a pour référence Uniprot Q9ZEU2.

La séquence nucléotidique de la forme sauvage de l'enzyme DSR-S (issue de la souche Leuconostoc mesenteroides B-512F) a pour référence GenBank 109598.

La séquence nucléotidique de la forme sauvage de l'enzyme DSR-E (issue de la souche Leuconostoc mesenteroides NRRL B-1299) a pour référence GenBank AJ430204.1 et la référence Uniprot Q8G9Q2.

L'enzyme AN123-GBD-CD2 (séquence SEQ ID NO . 12) est une forme tronquée de l'enzyme DSR-E susmentionnée, comme décrit dans Brison et al, J. Biol. Chem., 2012, 287, 7915-24. Des références bibliographiques décrivant ces enzymes mutées sont indiquées dans les Tableaux 1 et 4. En outre, la méthode d'obtention des enzymes mutées est décrite dans la demande de brevet européen EP 2 100 966 Al .

Les séquences peptides des différentes enzymes mutées ou non selon l'invention sont indiquées dans la présente demande. Ainsi, une enzyme selon l'invention peut être synthétisée par des méthodes classiques de chimie de synthèse, soit des synthèses chimiques homogènes en solution ou en phase solide. A titre illustratif, l'homme de l'art peut utiliser les techniques de synthèse de polypeptide en solution décrite par HOUBEN WEIL (1974, In méthode der Organischen Chemie, E. Wunsh éd., volume 15-1 et 15-II, Thieme, Stuttgart.). Une enzyme selon l'invention peut être également synthétisée chimiquement en phase liquide ou solide par des couplages successifs des différents résidus d'acides aminés (de l'extrémité N-terminale vers l'extrémité C-terminale en phase liquide, ou de l'extrémité C-terminale vers l'extrémité N-terminale en phase solide). L'homme de l'art peut notamment utiliser la technique de synthèse peptidique en phase solide décrite par Merrifield (MERRIFIELD RB, (1965a), Nature, vol.207 (996): 522-523 ; MERRIFIELD RB, ( 1 65b), Science, vol.150 (693): 178- 185.)

Selon un autre aspect, une enzyme selon l'invention peut être synthétisée par recombinaison génétique, par exemple selon un procédé de production comprenant les étapes suivantes :

(a) préparer un vecteur d'expression dans lequel a été inséré un acide nucléique codant la séquence peptidique d'une enzyme de l'invention, ledit vecteur comprenant également les séquences régulatrices nécessaires à l'expression dudit acide nucléique dans une cellule hôte choisie ;

(b) transfecter une cellule hôte avec le vecteur recombinant obtenu à l'étape (a) ;

(c) cultiver la cellule hôte transfectée à l'étape b) dans un milieu de culture approprié;

(d) récupérer le surnageant de culture des cellules transfectées ou le lysat cellulaire desdites cellules, par exemple par sonication ou par choc osmotique ; et

(e) séparer ou purifier, à partir dudit milieu de culture, ou à partir du culot de lysat cellulaire, l'enzyme de l'invention ainsi obtenue. Pour purifier une enzyme selon l'invention qui a été produite par des cellules hôtes transfectées ou infectées par un vecteur recombinant codant ladite enzyme, l'homme de l'art peut avantageusement mettre en œuvre des techniques de purification décrites par Molinier-Frenkel (2002, J. Viral. 76, 127- 135), par arayan et al. (1994, Virology 782- 795) ou par Novelli et al. ( 1991 , Virology 185, 365-376).

Ainsi, des glucane-saccharases utilisables dans un procédé de l'invention sont choisies dans un groupe comprenant :

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 1 , ladite séquence ayant un acide aminé X 1 représentant un acide aminé choisi dans le groupe constitué de A, C, E, F, G, H, I, K, M, N, P, Q, S, T, V et Y;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 2, ladite séquence ayant un acide aminé X 2 représentant un acide aminé choisi dans le groupe constitué de A, C, D, F, G, H, K, L, M, N, P, S, V et Y ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 3, ladite séquence ayant un acide aminé X 3 représentant un acide aminé choisi dans le groupe constitué de A, C, G, I, K, M, N et W ;

- une séquence ayant au moins 80 % d'identité avec la séquence SEQ ID NO :

4, ladite séquence ayant un acide aminé X 4 représentant un acide aminé choisi dans le groupe constitué de C, I, N, P, V et W ;

- une séquence ayant au moins 80 % d'identité avec la séquence SEQ ID NO :

5, ladite séquence ayant un acide aminé X 5 représentant un acide aminé choisi dans le groupe constitué de A, C, D, G, I, K, L, M, R, V et W ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 6, ladite séquence ayant un acide aminé X 6 représentant un acide aminé choisi dans le groupe constitué de C, G, Q, S et T ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 7, ladite séquence ayant un acide aminé X 7 représentant un acide aminé choisi dans le groupe constitué de A et G ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 8 ; - une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 9 ; ladite séquence ayant un acide aminé X 8 représentant un acide aminé choisi dans le groupe constitué de C, I et L

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 10 ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 1 1 ; et

- une séquence ayant au moins 80% d'identité avec la SEQ ID NO : 12, ladite séquence ayant des acides aminés X 9 , X 10 , X 11 , X 12 et X 13 , avec :

(i) X 9 représentant, indépendamment de X 10 , X 11 , X 12 et X 13 , un acide aminé choisi dans le groupe constitué de G, S, V, C, F, N, I, L et W ;

X 10 représentant, indépendamment de X 9 , X 11 , X 12 et X 13 , un acide aminé choisi dans le groupe constitué de L, I, H, Y et F ;

à l'exception du cas où X 9 représente W et X 10 représente F ;

X 11 représentant A ;

X 12 représentant F ; et

X 13 représentant L ;

(ii) X 9 représentant W ;

X 10 représentant F;

X 11 représentant, indépendamment de X 9 , X 10 , X 12 et X 13 , un acide aminé choisi dans le groupe constitué de E et A ;

X 11 représentant, indépendamment de X 9 , X 10 , X 11 et X 1 , un acide aminé choisi dans le groupe constitué de L et F ;

à l'exception du cas où X 11 représente A et X 12 représente F ;

X 11 représentant L ;

ou

(iii) X 9 représentant W ;

X 10 représentant F ;

X 11 représentant A ;

X 12 représentant, indépendamment de X 9 , X 10 , X 11 et X 13 , un acide aminé choisi dans le groupe constitué de A, R, D, N, C, E, Q, G, H, 1, L, K, M, P, S, T, W, Y et V ; et X 1 3 représentant, indépendamment de X 9 , X 10 , X 11 , et X !2 , un acide aminé choisi dans le groupe constitué de A, R, D, N, C, E, Q, G, H, I, , M, F, P, S, T, W, Y et V. Selon un mode de réalisation de l'invention, une séquence ayant au moins

80 % d'identité avec la SEQ ID NO : 12 indiquée ci-dessus est de préférence telle que :

(i) X 9 représente, indépendamment de X 10 , X 11 , X 12 et X 13 , un acide aminé choisi dans le groupe constitué de G, S, V, C, F, N, I, L et W ;

X 10 représente, indépendamment de X 9 , X 11 , X 12 et X 13 , un acide aminé choisi dans le groupe constitué de L, I, H, Y et F ;

à l'exception du cas où X 9 représente W et X 10 représente F ;

X 11 représente A ;

X 12 représente F ; et

X 1 3 représente L ;

ou

(ii) X 9 représente W ;

X 10 représente F;

X 11 représente, indépendamment de X 9 , X 10 , X 12 et X 13 , un acide aminé choisi dans le groupe constitué de E et A ;

X 12 représente, indépendamment de X 9 , X 10 , X 12 et X 13 , un acide aminé choisi dans le groupe constitué de L et F ;

à l'exception du cas où X 11 représente A et X 12 représente F ;

X 13 représente L ;

ou

est la séquence SEQ ID NO : 13.

Dans cette séquence SEQ ID NO : 13, X 9 représente W, X 10 représente F, X 11 représente A, X 12 représente I, X 11 représente I, et l'acide aspartique (D) en position 432 est substitué par un acide glutamique (E).

Il doit être compris de cette formulation que les acides aminés définis comme étant respectivement X 1 , X 2 , X 3 , X 4 . X 5 , X 6 , X 7 , X 8 , X 9 , X 10 . X 11 , X 12 et X 13 sont présents et tels que définis ci-dessus dans les glucane-saccharases de l'invention ayant au moins 80 % d'identité avec, respectivement, une séquence SEQ ID NO : 1 à 7, 9 et 12, telles que définies ci-dessus.

Comme montré dans les exemples, toutes les enzymes possédant l'une de ces séquences peptidiques présentent une capacité statistiquement supérieure à celle de l'enzyme sauvage à glucosyler les flavonoïdes de l'invention, présentant des fonctions hydroxyle non-vicinales, notamment sur le cycle B.

La présente invention englobe également les séquences dont la séquence d'acides aminés a au moins 80 %, 81 %, 82 %, 83 %, 84 %, 85 %, 86 %, 87 %, 88 %, 89 %, 90 %, 91 %, 92 %, 93 %, 94 %, 95 %, 96 %, 97 %, 98 %, 99 % ou 100 % d'identité en acides aminés avec l'une des séquences SEQ ID NO : 1 à 12 telles que définies précédemment et une activité biologique de même nature.

Par activité biologique de même nature en ce qui concerne les séquences peptidiques 1 à 12, on entend une même capacité à glucosyler des flavonoïdes monohydroxylés ou hydroxylés de façon non-vicinale sur le cycle B.

Le « pourcentage d'identité » entre deux séquences d'acides nucléiques ou d'acides aminés, au sens de la présente invention, est déterminé en comparant les deux séquences alignées de manière optimale, à travers une fenêtre de comparaison.

La partie de la séquence nucléotidique dans la fenêtre de comparaison peut ainsi comprendre des additions ou des délétions (par exemple des « gaps ») par rapport à la séquence de référence (qui ne comprend pas ces additions ou ces délétions) de manière à obtenir un alignement optimal entre les deux séquences.

Le pourcentage d'identité est calculé en déterminant le nombre de positions auxquelles une base nucléique identique (ou un acide aminé identique) est observé pour les deux séquences comparées, puis en divisant le nombre de positions auxquelles il y a identité entre les deux bases nucléiques (ou entre les deux acides aminés) par le nombre total de positions dans la fenêtre de comparaison, puis en multipliant le résultat par cent afin d'obtenir le pourcentage d'identité en nucléotides (ou en acides aminés) des deux séquences entre elles.

L'alignement optimal des séquences pour la comparaison peut être réalisé de manière informatique à l'aide d'algorithmes connus.

De manière tout à fait préférée, le pourcentage d'identité de séquence est déterminé à l'aide du logiciel CLUSTAL W (version 1.82) les paramètres étant fixés comme suit : ( 1) CPU MODE = ClustalW mp ; (2) ALIGNMENT = « full » ; (3) OUTPUT FORMAT = « aln w/numbers » ; (4) OUTPUT ORDER - « aligned » ; (5) COLOR ALIGNMENT = « no » ; (6) KTUP (word size) = « default » ; (7) WINDOW LENGTH = « default » ; (8) SCORE TYPE = « percent » ; (9) TOPDIAG = « default » ; (10) PAIRGAP = « default » ; (11) PHYLOGENETIC TREE TREE TYPE = « none » ; (12) MATRIX = « default » ; (13) GAP OPEN = « default » ; (14) END GAPS = « default » ; (15) GAP EXTENSION = « default » ; ( 16) GAP DISTANCES = « default » ; (17) TREE TYPE = « cladogram » et (18) TREE GRAP DISTANCES = « hide ».

Plus particulièrement, la présente invention concerne également les séquences dont la séquence d'acides aminés a 100 % d'identité en acides aminés avec les acides aminés 225 à 450 des séquences SEQ ID NO : 1 à 9, ou 100 % d'identité en acides aminés avec les acides aminés 2130 à 2170 de la séquence SEQ ID NO : 12 et au moins 80 %, 81 %, 82 %, 83 %, 84 %, 85 %, 86 %, 87 %, 88 %, 89 %, 90 %, 91 %, 92 %, 93 %, 94 %, 95 %, 96 %, 97 , 98 %, 99 % ou 100 % d'identité en acides aminés avec le reste des séquences SEQ ID NO : 1 à 12 telles que définies précédemment, et une activité biologique de même nature.

Parmi les séquences d'intérêt de l'invention, certaines d'entre elles s'avèrent plus particulièrement intéressantes en termes d'activité de glucosylation.

Ainsi, selon un mode de réalisation, les glucane-saccharases préférentiellement utilisées dans un procédé de l'invention sont choisies dans le groupe comprenant :

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 1 , ladite séquence ayant un acide aminé X 1 représentant un acide aminé choisi dans le groupe constitué de H, N ou S ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 2, ladite séquence ayant un acide aminé X 2 représentant un acide aminé choisi dans le groupe constitué de A, C, F, L, M, S ou V ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 3, ladite séquence ayant un acide aminé X 3 représentant une acide aminé choisi dans le groupe constitué de A et N ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 4, ladite séquence ayant un acide aminé X 4 représentant une acide aminé choisi dans le groupe constitué de C. I, N. P, V ou W ; - une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 5, ladite séquence ayant un acide aminé X 5 représentant un acide aminé choisi dans le groupe constitué de C, K, R ou V ;

- une séquence ayant au moins 80 % d'identité avec la SEQ ID NO : 9, ladite séquence ayant un acide aminé X 8 représentant un acide aminé choisi dans le groupe constitué de C ou L ; et

- une séquence ayant au moins 80% d'identité avec la SEQ ID NO : 12, ladite séquence ayant des acides aminés X 9 , X 10 , X 11 , X 12 et X 13 , avec :

(i) X 9 représentant un acide aminé choisi dans le groupe constitué de G, V, C et F ;

X 10 représentant F ; X 11 représentant A ; X 12 représentant F ; et X 13 représentant L ;

(ii) X 9 représentant, indépendamment de X 10 , X 11 , X 12 et X 13 , un acide aminé choisi dans le groupe constitué de S, N, L et I ;

X 10 représentant, indépendamment de X 9 , X 11 , X 12 et X 11 , un acide aminé choisi dans le groupe constitué de L, I, H et Y ;

X 11 représentant A ; X 12 représentant F ; et X 11 représentant L ;

(iii) X 9 représentant W ; X 10 représentant F ; X 11 représentant A ou E ; X 12 représentant L et X 13 représentant L ; ou

ladite séquence ayant au moins 80% d'identité avec la SEQ ID NO : 12 est la séquence SEQ ID NO : 13.

Selon un mode préféré, une séquence ayant au moins 80% d'identité avec la SEQ ID NO : 12, possédant les acides aminés X 9 , X 10 , X 11 , X 12 et X 13 , est telle que :

(i) X 9 représentant un acide aminé choisi dans le groupe constitué de G, V, C et F ;

X 10 représentant F ; X 11 représentant A ; X 12 représentant F ; et X 13 représentant L ;

(ii) X<) représentant, indépendamment de X 9 , X 10 , X 11 et X 13 , un acide aminé choisi dans le groupe constitué de S et I ;

X 10 représentant, indépendamment de X 9 , X 11 , X 12 et X 13 , un acide aminé choisi dans le groupe constitué de L, I et Y ;

X 11 représentant A ; X 12 représentant F ; et X 13 représentant L ; ou (iii) X 9 représentant W ; X 1() représentant F ; Xu représentant A ou E ; X 12 représentant L et Xu représentant L ; ou

ladite séquence ayant au moins 80% d'identité avec la SEQ ID NO : 12 est la séquence SEQ 1D NO : 13.

Les mutants plus particulièrement intéressants selon l'invention de SEQ ID

NO : 12 sont notamment indiqués à l'Exemple 1 1 de la présente demande.

Les enzymes dont les séquences ont au moins 80% d'identité avec les SEQ ID NO 1 à 1 1 présentent en effet toutes une efficacité de glucosylation sur les flavonoïdes de l'invention supérieure de 5 %, 10 %, 15 %, 20 %, 25 %, 30 %, 35 %, 40 %, 45 %, 50 %, 55 % ou 60 % comparative ent et respectivement à une activité de 0,5 +/- 0,5 % ou 4,7 +/- 1 ,7 % pour l'enzyme sauvage (voir notamment les Tableaux 2, 3, 5 et 6).

Les enzymes dont la séquence a au moins 80% d'identité avec la SEQ ID NO 12 présentent une efficacité de glucosylation sur les flavonoïdes de l'invention supérieure de 5 %, 10 %, 15 %, 20 %, 25 %, 30 %, 35 %, 40 %, 45 % ou 50 % comparativement et respectivement à une activité de 20,4 +/- 3,2 % ou 13,9 +/- 4,7 % pour l'enzyme sauvage (voir notamment les Tableaux 7 et 8).

Flavonoïdes, dérivés et mises en œuyre

a) Flavonoïdes mis en œuyre dans un procédé de l'invention

Les flavonoïdes spécifiquement mis en œuvre dans un procédé de l'invention sont de formule (I) telle que décrite précédemment.

Selon un mode de réalisation, un seul des groupements choisi parmi R 8 , R 9 , R 10 , R 11 et R 12 , représente un groupement hydroxyle,

les autres groupements parmi R 8 , R 9 , R 10 , R 11 et R 12 , identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en C 1 -C 10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O, N ou S ; un atome d'halogène ; un aryle en C 5 -C 9 ; un hétérocycle en C 4 -C 9 ; un groupement (C 1 -C 3 )alcoxy ; un acyle en C 2 -C 3 ; un alcool en C 1 -C 3 ; un groupement -COOH ; -NH 2 ; -CONH 2 ; -CHO ; -SH ; -C(O)O(C 2 -C 3 ) ; une aminé en C 1 -C 3 ; une imine en C 1 -C 3 ; un groupement nitrile ; un halogénoalkyle en C 1 -C 3 ; et un thioalkyle en C 1 -C 3 ; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s) ; De préférence, le groupement R 10 représente un groupe hydroxyle.

De préférence, les groupements X 8 , R 9 , R 11 et R 12 représentent des atomes d'hydrogène.

Selon un mode de réalisation préféré, le groupement R 10 représente un groupe hydroxyle et les groupements R 8 , R 9 , R 11 et R 12 représentent des atomes d'hydrogène.

Selon un mode de réalisation, le cycle C représente un cycle de formule (II) ou (IV) telle que définies précédemment. Selon un mode de réalisation, le cycle C représente un cycle de formule (II). Selon un autre mode de réalisation, le cycle C représente un cycle de formule (IV).

Selon un mode de réalisation de l'invention, le groupement R] représente un cycle B de formule (VI) telle que définie précédemment.

Selon un mode de réalisation, le cycle C représente un cycle de formule (II) et le groupement R 1 représente un cycle B de formule (VI) telle que définie précédemment.

Selon un autre mode de réalisation, le cycle C représente un cycle de formule (IV) et le groupement R 1 représente un cycle B de formule (VI) telle que définie précédemment.

Selon un mode de réalisation, les groupements R 1 ', R 2 et R 2 ' représentent des atomes d'hydrogène, et R 3 et R 3 ' forment ensemble un groupement =0.

Selon un mode de réalisation préféré, le groupement R 1 représente un cycle B de formule (VI), les groupements R 1 ', R 2 et R ' représentent des atomes d'hydrogène, et R 3 et R 3 ' forment ensemble un groupement =O.

Selon un mode de réalisation préféré, le cycle C représente un cycle de formule (II) ou (IV), le groupement R 1 représente un cycle B de formule (VI), les groupements R 1 ', R 2 et R 2 ' représentent des atomes d'hydrogène, et R 3 et R 3 ' forment ensemble un groupement =O.

Selon un mode de réalisation, deux des groupements R 4 , R 5 , R 6 et R 7 représentent un groupement hydroxyle, les deux autres groupements étant tels que précédemment définis. De préférence, les deux groupements représentant un groupement hydroxyle sont les groupements R 4 et R 6 .

Selon un mode de réalisation, deux des groupements R 4 , R 5 , R 6 et R 7 représentent un groupement hydroxyle, les deux autres groupements représentant un atome d'hydrogène. Selon un mode de réalisation, les groupements R et R 7 représentent des atomes d'hydrogène.

Selon un mode de réalisation préféré, les groupements R4 et représentent un groupement hydroxyle et les groupements R5 et R représentent un atome d'hydrogène.

Selon un autre mode de réalisation, X 8 et un seul des groupements choisis parmi R 10 , R 11 et R 12 représentent un groupement hydroxyle,

R 9 et les autres groupements parmi R 10 , R 11 et R 12 , identiques ou différents, étant choisis dans le groupe comprenant un atome d'hydrogène ; un groupement hydrocarboné en C 1 -C 10 linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu par au moins un hétéroatome choisi parmi O, N ou S ; un atome d'halogène ; un aryle en C 5 -C 9 ; un hétérocycle en C 4 -C 9 ; un groupement (C 1 -C 3 )alcoxy ; un acyle en C 2 -C 3 ; un alcool en C 1 -C 3 ; un groupement -COOH ; -NH 2 ; -CONH 2 ; -CHO ; -SH ; -C(O)O(C -C 3 ) ; une aminé en C 1 -C 3 ; une imine en C 1 -C 3 ; un groupement nitrile ; un halogénoalkyle en C 1 -C 3 ; un thioalkyle en C 1 -C 3 ; un groupement -C(W) ; et un groupement -O(W) ; W représentant une chaîne constituée de 1 à 6 glycoside(s)

De préférence, le groupement R^ représente un groupe hydroxyle.

De préférence, les groupements R 9 , R 11 et R 12 représentent des atomes d'hydrogène.

Selon un mode de réalisation préféré, les groupements R 8 et R 10 représentent un groupe hydroxyle et les groupements R<>, R 11 et R 12 représentent des atomes d'hydrogène.

Selon un mode de réalisation, le cycle C représente un cycle de formule (II) ou (IV), de préférence (II), telle que définies précédemment.

Selon un mode de réalisation de l'invention, le groupement R 1 représente un cycle B de formule (VI) telle que définie précédemment.

Selon un mode de réalisation, les groupements R 1 ' et R 2 ' représentent des atomes d'hydrogène, R 2 représente un atome d'hydrogène ou un groupement -OH, de préférence un groupement -OH, et R 3 et R 3 ' forment ensemble un groupement =0.

Selon un mode de réalisation préféré, le groupement R 1 représente un cycle B de formule (VI), les groupements R 1 ' et R 2 ' représentent des atomes d'hydrogène, R 2 représente un groupement -OH, et R 3 et R ' forment ensemble un groupement =0. Selon un mode de réalisation préféré, le cycle C représente un cycle de formule (II), le groupement R 1 représente un cycle B de formule (VI), le groupement R 2 représente un groupement -OH, et R 3 et R 3 ' forment ensemble un groupement =0.

Selon un mode de réalisation, un flavonoïde mis en œuvre dans un procédé de l'invention est de formule (VII), (VIII) ou (IX) suivantes :

Un flavonoïde de l'invention peut être mis en œuvre dans un procédé de l'invention à un ratio molaire saccharose sur flavonoïde compris entre 1 et 35 000, le mélange réactionnel comprenant au moins F(les) enzyme(s), le saccharose et le(s) flavonoïde(s) récepteur(s).

De préférence, le ratio molaire saccharose sur flavonoïde est compris entre 7 et 292, le mélange réactionnel comprenant au moins l'(les) enzyme{s), le saccharose et le(s) flavonoïde(s) récepteur(s). b) Dérivés de flavonoïdes O-ct-glucosylés

La présente invention concerne également certains dérivés de flavonoïde Ο-α-glucosylé. Ceux sont aptes à être obtenus à partir d'un procédé de l'invention.

La présente invention vise plus particulièrement des composés de formule (X) suivante : dans laquelle X ]4 représente une chaîne constituée d'au moins deux groupements

α-glucoside, et X1 et X| ( „ identiques ou différents, sont choisis dans le groupe comprenant un atome d'hydrogène ; un alkyle en C 1 -C 6 , linéaire ou ramifié ; un groupement -C(0)<D(C 2 -C 3 ) ; et une chaîne constituée de 1 à 600.000 groupements α-glucoside

Comme illustré dans Moulis et al. Understanding the polymerization mechanism of glycoside-hydrolase family 70 glucansucrases, J. Biol. Chem. 2006, 281 : 31254-31267, un composé selon l'invention, et glucosylé à l'aide d'une glucane- saccharase conforme à l'invention, peut en effet comprendre une chaîne constituée de 1 à 600.000 groupements α-glucoside.

La présente invention vise également des composés de formule (XI) suivante :

dans laquelle

X 17 représente une chaîne constituée de 1 à 600.000 groupements α-glucoside, et

X i8 et X|9, identiques ou différents, sont choisis dans le groupe comprenant un atome hydrogène ; un alkyle en C 1 -C 6 , linéaire ou ramifié ; un groupement -C(O)O(C 2 - C 3 ) ; et une chaîne constituée de 1 à 600.000 groupements α-glucoside. c) Mise en œuyre des dérivés de flavonoïdes Ο-α-glucosylés de l'invention

Selon un mode de réalisation, les dérivés de flavonoïdes O-α-glucosylés de l'invention peuvent être utilisés à titre d'agent antioxydant (Heim et al, J. Nutr. Biochem., 2002, 13 : 572-584).

Selon un mode de réalisation, les dérivés de flavonoïdes Ο-α-glucosylés de l'invention peuvent être mis en œuvre pour leur utilisation pharmaceutique dans le traitement et/ou la prévention de l'hépatotoxicité, des allergies, de l'inflammation, des ulcères, des tumeurs, des troubles ménopausiques ou des maladies neurodégénératives (Harbome J. et al, Phytochemistry, 2000 55 : 481-504 ; Quideau S. et al., Ange . Chem. Int. End. 201 1 , 50 : 586-621 ).

Selon un mode de réalisation, les dérivés de flavonoïdes O-α-glucosylés de l'invention peuvent être mis en œuvre pour leur utilisation pharmaceutique à titre de veinotonique. ( atsenis K., Curr. Vase. Pharmacol. 2005, 3(1 ), 1 -9)

De plus, selon un mode de réalisation de l'invention, les dérivés de flavonoïdes Ο-α-glucosylés de l'invention peuvent être mis en œuvre à titre :

- d'agent photovoltaïque (voir notamment à cet effet le document Meng et al., Nano Lett. 2008, 8(10), 3266-72 ; Narayan M. R., Renew. Sust. Energ. Rev. 2012, 16, 208- 215 ; US 2009/0071534 Al )

- d'agent répulsif des insectes (voir notamment à cet effet les documents JP 2002060304 ; JP 2003104818 ; Benavente-garcia et al, J. Agric. Food Chem., 1997, 45

(12), 4505^1515 ; Singh et al., Natural product sciences, 1997, 3(1), 49-54; Diwan et Saxena, Int. J. Chem. Sci., 2010, 8(2), 777-782 ; Regnault-Roger et al., J. Stored Prod Res, 2004, 40, 395^08) ;

- d'agent de blanchiment (voir notamment à cet effet le document Barkat Ali Khan et al, Asian J. Chem., 201 1 , 23(2), pp 903-906 ; demandes de brevet

WO 2008140440 Al ; WO 2005094770 Al ; Zhu W. & Gao J., J. Invest. Dermatol. Symposium Proceedings, 2008, 13, 20-24 ; Kim J.H. et al., J. Invest. Dermatol., 2008, 128, 1227-1235) ; ou

- d'agent pesticide, fongicide et/ou bactéricide (voir notamment à cet effet les documents WO 2013043031 , CN 102477024 et CN 101002557).

La présente invention est aussi illustrée, sans n'y être aucunement limitée, par les exemples qui suivent. EXEMPLES

Exemple 1 : Production et mise en œuyre de glucane-saccharases recombinantes pour la glucosylation de l'apigénine et de la naringénine

Une librairie de 183 variants incluant 174 mutants, simples ou doubles, construits à partir de l'amylosaccharase de N. polysaccharea (famille GH13 des glycoside- hydrolases) et 10 variants, construits à partir des glucane-saccharases DSR-S, ASR et α- 1 ,2 BrS (appartenant à la famille GH70) ont été testés pour leur aptitude à glucosyler l'apigénine et la naringénine.

L'origine des glucane-saccharases sélectionnées pour l'étude est reportée dans les Tableaux 1 et 4.

Les Tableaux 1 et 4 illustrent en effet un certain nombre des glucane- saccharases testées dans les exemples du présent texte et précise : colonne 1 : l'organisme dont Penzyme est originaire ; colonne 2 : les différentes enzymes sauvages testées ainsi que les positions mutées du site actif de ces enzymes sauvages dans les glucane-saccharases mutées également testées ; colonne 3 : les spécificités de liaisons majoritaires lors de la synthèse du polymère naturel ; colonne 4 : les références bibliographiques dans lesquelles ces enzymes, aussi bien sous formes sauvages que mutées, ont été décrites dans l'état de la technique.

Ces enzymes ont été utilisées sous forme recombinante et sont exprimées chez Eschcrichia coli.

1.1. Production des enzymes en microplaques

L'ensemble des souches d' Eschcrichia coli surexprimant les glucane- saccharases hétérologues des familles GH13 et GH70, sauvages ou leurs mutants, sont maintenues au format microplaque 96 puits afin de faciliter les futures étapes de criblage de glucosylation des flavonoïdes.

A partir des microplaques source, une pré-culture de ces souches d'E. coli est réalisée pendant 22 heures à 30°C, 700 rpm dans des microplaques 96 puits, dans 200 xL de milieu de culture LB supplémenté avec 100 μg mL d'ampicilline. Ces précultures sont utilisées à leur tour pour ensemencer les microplaques « deep-well » dont chaque puits contient 1 mL par puits de milieu auto-inductible ZYM5052 contenant notamment 0,2 % (p/v) d'α-lactose, 0,05 % (p/v) de D-glucose, 0,5 % (p/v) de glycérol et 0,05 % (p/v) de L-arabinose (Studier et ai, 2005).

Après 22 heures de culture à 30°C et à 700 rpm, la suspension cellulaire est centrifugée pendant 20 minutes à 3000 g à 4°C. Les culots cellulaires sont resuspendus dans les microplaques « deep-well » 96 puits, avec 300 μί de tampon phosphate salin (24 mM phosphate de sodium/potassium et 274 mM NaCl) contenant 0,5 g L de lysozyme et 5 mg/L de RNAse pancréatique bovine.

Puis on réalise une incubation de 30 minutes à 30°C sous agitation, ces microplaques étant ensuite stockées une nuit à -80°C. Après décongélation, les microplaques sont vigoureusement agitées puis centrifugées pendant 20 minutes à 3000 g à 4 °C.

Les lysats cellulaires centrifugés contenant les enzymes recombinantes sont transférés dans des microplaques 96 puits « deep-well » propres.

1.2. Mise en œuyre des réactions d'accepteur

Les extraits enzymatiques obtenus sont utilisés pour mener les réactions de criblage enzymatique de glucosylation de flavonoïdes. L'activité enzymatique de chaque lysat cellulaire centrifugé est évaluée au format microplaque, en poids final après 30 minutes d'incubation en présence de 146 m M final de saccharose, par dosage des sucres réducteurs par Facidc 3,5-dinitrosalicylique (DNS). Finalement, après dilution dans de Peau ultrapure, Tabsorbance est lue à 540 nm.

Les réactions d'accepteurs des flavonoïdes sont ensuite réalisées en microplaques « deep-well », dans un volume de 300 μί, à des concentrations finales, en saccharose de 146 mM, en flavonoïde de 2,5 mM (apigénine) ou 5 mM (naringénine) (initialement dissous dans 100 % DMSO), et 140 μί de lysat cellulaire centrifugé.

La concentration finale en DMSO dans le milieu réactionnel est de 3 % (v/v). L'incubation est menée à 30°C et à 700 rpm. Au bout de 24 heures, les enzymes sont dénaturées à 95°C pendant 15 minutes. Ces microplaques sont stockées à - 80°C en vue de l'évaluation rapide de la glucosylation des flavonoïdes par chromatographie en phase liquide couplée à la spectrométrie de masse (HPLC-MS ou LC-MS).

1.3. Techniques analytiques

En vue de leurs analyses par HPLC-MS, les milieux réactionnels extensivement homogénéisés sont dilués au l/30 c dans du DMSO. La séparation des flavonoïdes et de leurs formes glucosylées est effectuée en phase inverse avec une colonne ProntoSIL Eurobond® 53x3,0 mm 120-3-C18-AQ (porosité de 120 Â, granulométrie de 3 μηι, greffage C l 8, Bischoff Chromatography, Allemagne).

Cette colonne est maintenue à 40°C sur un système HPLC Dionex Ultimate

3000 équipé d'un détecteur UV/Vis. Ce système est couplé à un spectromètre de masse, simple quadrupole (Thermo Scientific, MSQ Plus).

La phase mobile est composée d'un mélange eau ultrapure (Solvant A) / acétonitrile de qualité LC-MS (solvant B) contenant chacun 0,05 % (v/v) d'acide formique. La séparation est assurée en 10 minutes par un gradient en solvant B défini comme suit ;

0 min, 15 % (v/v) ;

3 min, 25 % (v/v) ;

6.5 min, 49,5 % (v/v) ;

6.6 min, 80 % (v/v) ;

6,8 min, 15 % (v/v) ; et

10 min, 15 % (v/v).

L'ionisation en spectrométrie de masse sur l'équipement MSQ Plus est réalisée en mode électrospray positif (ESI+) pour l'apigénine et négatif (ESI-) pour la naringénine.

La tension du capillaire est réglée à 3000 V, celle du cône à 75 V. La température du bloc source est fixée à 450°C.

Le système LC-MS/MS utilisé pour l'analyse en spectrométrie de masse haute résolution ou en fragmentation MS/MS comprend un système de séparation chromatographique Ultimate 3000 (Dionex) couplé à un spectromètre de masse hybride piège linéaire/Orbitrap (LQT Orbitrap, Thermo Fischer Scientific). L'ionisation en spectrométrie de masse sur l'équipement LQT Orbitrap est cette fois-ci réalisée soit en mode électrospray positif (ESI+) soit en mode négatif (ESI-). Exemple 2 : Détermination des efficacités de glucosylation de rapigénine par l'amylosaccharase recombinante de N. polysaccharea et par ses variants

Les réactions en présence d'accepteur ont été mises en œuvre en appliquant les conditions décrites dans l'exemple 1.

L'efficacité de glucos lation du flavonoïde a été déterminée à partir de la formule suivante :

Efficacité de glucosylation =

(∑(aire de pic de(s) flavonoïde(s) glucosylé(s))) / (∑(aire de pic de(s) flavonoïde(s) glucosylé(s)) + aire du pic de flavonoïde aglycone résiduel) x 100

Les efficacités de glucosylation des flavonoïdes, exprimées en pourcentage, ont été calculées à partir des aires des pics des différents produits analysés, comme décrit dans l'exemple 1 , par HPLC équipé d'un détecteur UV (λ340 nm), après 24 h de réaction. Les valeurs obtenues sont reportées dans le Tableau 2.

Le Tableau 2 illustre l'efficacité de glucosylation, au cours du criblage en microplaques, de l'apigénine pour la forme sauvage de l'ASNp (amylosaccharase recombinante de N. polysaccharea) ainsi que pour ses 174 mutants de son site actif. En ordonnée : les positions de mutation de l'enzyme sauvage (ASNp WT) ; en abscisse : l'acide aminé substituant celui présent dans la séquence de l'enzyme sauvage.

Ainsi, à titre illustratif, le pourcentage de 1 ,7 % indiqué ligne 2, colonne 2 a été obtenu à l'aide d'une enzyme muté en position 226 par la substitution de l'acide aminé R (Arginine) par l'acide aminé A (Alanine).

Chaque case représente une mutation simple sur les positions R226, 1228, F229, A289, F290, 1330, V331 , D394 et R446 ou une mutation double, à savoir deux mutations simples au niveau de deux de ces positions.

La barre grise dans chaque case figure le niveau d'efficacité de glucosylation par rapport au mutant le plus efficace.

Les résultats obtenus pour l'enzyme sauvage sont indiqués au dessus du Tableau 2 ainsi qu'aux intersections R226R, I228I, F229F, A289A, F290F, I330I, V331 V, D394D et R446R.

Les 3 variants double mutants sont indiqués sous le Tableau 2. Pour la forme sauvage de l'enzyme ASNp (Amylosucrase Neisseria polysaccharea), l'efficacité de glucosylation est très faible (0,5 ± 0,5 ; n=16). Les efficacités de glucosylation obtenus pour R226R, I228I, F229F, A289A, F290F, I330I, V331V, D394D et R446R données dans le Tableau 2 sont également comprises dans la gamme de valeurs 0,5 ± 0,5.

Avec une efficacité de glucosylation de l'apigénine supérieure à celle de l'enzyme sauvage (supérieure à 1 %), un grand nombre d'enzymes mutantes ressortent de ce criblage.

Plus particulièrement, avec une efficacité de glucosylation de l'apigénine supérieure à 5 %, huit enzymes ressortent plus particulièrement du criblage.

Les efficacités de glucosylation pour ces huit enzymes mutées sont respectivement les suivantes : ASNp I228F : 9,9 %; ASNp I228L : 1 1 ,1 %; ASNp I228M : 5,4 %; ASNp F229A : 5,6 %; ASNp F229N : 5,7 %; ASNp A289W : 22,1 %; ASNp F290C : 5,4 %; et ASNp F290K : 8,9 %.

Cela illustre l'intérêt d'employer des enzymes issues de l'ingénierie dirigée pour la glucosylation d'accepteurs faiblement reconnus tels que les flavonoïdes monohydroxylés ou hydroxylés de façon non-vicinale, notamment sur le cycle B. Exemple 3 ; Détermination des efficacités de glucosylation de l'apigénine par les glucane-saccharascs de la famille GH70

Les glucane-saccharases de la famille GH70 testées pour leur activité de glucosylation de l'apigénine sont répertoriées dans le Tableau 4.

Le Tableau 4 illustre les glucane-saccharases de la famille GH70 (glycoside- hydrolase 70) testées dans les exemples du présent texte.

Ainsi, ASR C-APY-del WT représente la forme tronquée de l'ASR (alternane- saccharase), DSR-S vardelA4N WT représente la forme tronquée sauvage DSR-S (dextransucrase) et, par exemple, DSR-S vardelA4N F353T représente la forme tronquée de la DSR-S mutée en position 353 par la substitution de l'acide aminé F (Phénylalanine) par l'acide aminé T (Thréoninc). Les résultats de glucosylation de l'apigénine par les glucane-saccharases de la famille GH70 sont reportés dans le Tableau 5.

Le Tableau 5 illustre l'efficacité de glucosylation de l'apigénine pour la forme sauvage du variant tronqué de DSR-S (vardelA4N WT), pour la forme sauvage tronquée de PASR (ASR C-APY-del WT), pour la forme sauvage de l'enzyme α- 1 ,2 BrS, et pour sept mutants de DSR-S vardelA4N.

La barre grise dans chaque case figure le niveau d'efficacité de glucosylation par rapport au mutant le plus efficace. Alors que la forme sauvage du variant tronqué de DSR-S

(DSR-S vardelA4N WT) ne présente qu'une très faible activité de glucosylation (0,5 %), le mutant S512C présente une efficacité de glucosylation de l'apigénine plus élevée (13,9 %). Exemple 4 ; Comparaison des efficacités de glucosylation de l'apigénine pour les enzymes les plus efficaces

Parmi les enzymes testées des familles de GH13 et GH70, neuf mutants ont des efficacités de glucosylation de l'apigénine supérieures à 5 %, à savoir ASNp I228F, ASNp I228L, ASNp I228M, ASNp F229A, ASNp F229N, ASNp A289W, ASNp F290C, ASNp F290K et DSR-S (vardelA4N S512C). Ces efficacités sont comparées pour ces neuf mutants les plus efficaces, avec leurs activités relatives en présence de saccharose seul (voir Figure 1 ).

Les activités d'hydrolyse du saccharose des enzymes sauvages, ASNp WT (GH13) ou DSR-S vardelA4N WT (GH70), ont été prises comme références pour le calcul des activités relatives d'hydrolyse du saccharose de leurs mutants respectifs.

Bien que les mutants présentent des activités sur saccharose seul plus faibles que celles des enzymes sauvages, les efficacités de glucosylation de ces mêmes mutants sont de 10 à 44 fois plus importantes que pour les enzymes sauvages. Plus globalement, le coefficient de corrélation entre les efficacités de glucosylation de l'apigénine et les activités d'hydrolyse du saccharose, calculé pour l'ensemble des enzymes mutantes de l'amylosaccharase de N. polysaccharea, est de 0,08. Cela illustre l'intérêt du procédé pour identifier des enzymes peu actives sur saccharose seul mais capables de glucosyler les flavonoïdes de l'invention.

Dans le cas de l'enzyme mutante ASNp A289W, une concentration massique de 149 mg/mL d'apigénine glucosylée est atteinte.

II s'agit de concentration minimale obtenue en microplaque. Ainsi, un facteur

10 d'amélioration peut être attendu après optimisation du milieu.

Exemple 5 : Analyse LC-MS des produits de glucosylation de Papigénine

Les neufs mutants mentionnés à l'exemple 4 peuvent être classés en 6 catégories suivant le profil de produits de glucosylation obtenu en LC-MS. La superposition des chromatogrammes UV (X 3 40 nm) pour un représentant de chacun de ces 6 catégories de profils (respectivement ASNp A289W, DSR-S (vardelA4N S512C), ASNp F290K, ASNp F290C, ASNp F229N et ASNp I228F) est présentée en Figure 2.

La superposition de ces chromatogrammes met en évidence la diversité de formes d'apigénine glucosylée à laquelle il est possible d'aboutir.

Les profils LC-MS obtenus pour ASNp WT et les neuf mutants les plus efficaces mentionnés à l'exemple 4 sont représentés aux Figures 4 à 13.

Les masses molaires telles que déterminées par LC-MS dans l'exemple 1 du pic d'apigénine glucosylée le plus intense pour chacun des neufs mutants sont les suivantes :

Figure 5 : 432,7 g/mol

Figure 6 : 432,7 g/mol

Figure 7 : non déterminée

Figure 8 : 432,8 g/mol

Figure 9 : 432,7 g/mol

Figure 10 : 594,8 g/mol

Figure 1 1 : donnée non disponible

Figure 12 : donnée non disponible

Figure 13 : 432,7 g/mol.

L'enzyme sauvage a une très faible efficacité de glucosylation sur Papigénine

(0,5 %). En effet, si on compare le standard d'apigénine avec les produits finaux de la réaction de glucosylation, on détecte l'apparition sur le chromatogramme UV de plusieurs pics, de très faibles intensités, d'apigénine glucosylée (Figure 4).

Les mutants I228F (Figure 5), I228L (Figure 6) et I228M (Figure 7) ont des profils de produits similaires entre eux. Toutefois, des variations entre les proportions des différentes formes d'apigénine glucosylée sont observées avec le mutant I228M (Figure 7).

Le groupe de mutants F229A (Figure 8) et F229N (Figure 9) présentent également des profils de produits similaires.

Enfin, le mutant F290K a un profil de produits plus complexe que celui du mutant F290C.

Exemple 6 : Analyse LC-MS haute résolution et LC-MS/MS des produits de glucosylation de Papigénine

Une étude a été réalisée, par LC-MS haute résolution et LC-MS/MS (résultats obtenus chez Imagif), sur les produits de glucosylation de Papigénine obtenus avec les enzymes mutantes ASNp A289W et DSR-S vardelA4N S512C.

Le produit de glucosylation de Papigénine produit par le mutant d'enzyme DSR-S vardelA4N S512C est une forme monoglucosylée (Figure 13) dont le temps de rétention est de 4,23 min, et dont le rapport m/z en mode électrospray positif a été déterminé à 433,1 1 19 (Figure 1 ). L'analyse LC-MS/MS en mode électrospray négatif de cette forme monoglucosylée produite par DSR-S vardelA4N S512C a conduit à l'identification de deux ions majoritaires dont les rapports m/z ont été déterminés à 269.0451 et 268.9360 (Figure 15), permettant ainsi de supporter l'obtention d'une O- glucosylation sur la position 4' du cycle B de l'apigénine.

L'enzyme ASNp A289W glucosyle Papigénine pour donner un produit monoglucosylé dont le temps de rétention est de 4,25 min (Figure 10) et dont le rapport m/z en mode électrospray positif a été déterminé à 433,1 120 (Figure 16). Cette analyse a également montré que le pic de produit de glucosylation éluant à 3,68 min (Figure 10) correspond à une diglucosylation de l'apigénine. Le rapport m/z en mode électrospray positif a été déterminé à 595, 1645 (Figure 17). L'analyse LC-MS/MS en mode électrospray négatif révèle que deux formes diglucosylées de l'apigénine co-éluent à 3,68 min. L'analyse LC-MS/MS en mode électrospray négatif de la première forme diglucosylée produite par ASNp A289W a conduit à l'identification de trois ions majoritaires dont les rapports m/z ont été déterminés à 353,0660, 31 1 ,0555 et 269,0451 (Figure 18). Cela permet ainsi de supporter l'obtention d'une forme diglucosylée pour laquelle chacune des positions 5 et 7 du cycle A est O-glucosylée. L'analyse LC-MS/MS en mode électrospray négatif de la seconde forme diglucosylée produite par ASNp A289W a conduit à l'identification d'un seul ion majoritaire dont le rapport m/z a été déterminé à 269.0451 (Figure 19), permettant ainsi de supporter l'obtention d'une di-O-glucosylation sur la position 4' du cycle B, uniquement, de l'apigénine.

Exemple 7 : Détermination des efficacités de glucosylation de la naringénine par Tamylosaccharase recombinante de TV. polysaccharea et par ses variants

Les réactions en présence d'accepteur ont été mises en œuvre en appliquant les conditions décrites dans l'exemple 1.

L'efficacité de glucosylation du flavonoïde a été déterminée à partir de la formule énoncée à l'exemple 2. Les efficacités de glucosylation des flavonoïdes, exprimées en pourcentage, ont été calculées à partir des aires des pics des différents produits analysés, comme décrit dans l'exemple 1 , par HPLC équipé d'un détecteur UV (λ340 nm), après 24 h de réaction. Les valeurs obtenues sont reportées dans le Tableau 3.

Le Tableau 3 illustre l'efficacité de glucosylation, au cours du criblage en microplaques, de la naringénine pour la forme sauvage de l'ASNp (amylosaccharase recombinante de N. polysaccharea) ainsi que pour les 174 mutants de son site actif. En ordonnée : les positions de mutation de l'enzyme sauvage (ASNp WT) ; en abscisse : l'acide aminé substituant celui présent dans la séquence de l'enzyme sauvage.

Ainsi, à titre illustratif, le pourcentage de 2,4 % indiqué ligne 2, colonne 2 a été obtenu à l'aide d'une enzyme muté en position 226 par la substitution de l'acide aminé R (Arginine) par l'acide aminé A (Alanine).

Chaque case représente une mutation simple sur les positions R226, 1228, F229, A289, F290, 1330, V331 , D394 et R446 ou une mutation double, à savoir deux mutations simples au niveau de deux de ces positions. La barre grise dans chaque case figure le niveau d'efficacité de glucosylation par rapport au mutant le plus efficace.

Les résultats obtenus pour l'enzyme sauvage sont indiqués en-haut du Tableau 3 ainsi qu'aux intersections R226R, I228I, F229F, A289A, F290F, I330I, V331V, D394D et R446R. Les résultats obtenus pour les enzymes doublement mutées sur les positions 289 et 290 sont indiquées en bas du Tableau 3.

Pour la forme sauvage de l'enzyme ASNp l'efficacité de glucosylation est réduite (4.7 ± 1.7; n=1 ).

Avec une efficacité de glucosylation de la naringénine supérieure à celle de l'enzyme sauvage (supérieure à 6,4 %), un grand nombre d'enzymes mutantes ressortent de ce criblage.

Plus particulièrement, avec une efficacité de glucosylation de la naringénine supérieure à 10 %, seize enzymes mutantes ressortent plus particulièrement du criblage. Sept de ces enzymes mutantes ont en particulier une efficacité de glucosylation de la naringénine supérieure à 20 % et deux d'entre elles ont une efficacité supérieure à 50 %.

Les efficacités de glucosylation pour ces seize enzymes mutées sont respectivement les suivantes : ASNp R226H : 13,5 %; ASNp R226N : 16,0 %; ASNp R226S : 14,1 %; ASNp I228A : 70,2 %; ASNp I228C : 30,9 %; ASNp I228S : 16,4 %; ASNp I228V : 12,3 %; et ASNp A289C : 27,8 % ; ASNp A2891 : 11 ,2 % ; ASNp A289N : 14,5 % ; ASNp A289P : 10,3 % ; ASNp A289V : 21 ,8 % ; ASNp F290R : 1 1 ,2 % ; ASNp F290V : 21 ,1 % ; ASNp A289P/F290C : 50,9 % ; ASNp A289P/F290L : 22,9 %.

La glucosylation de la naringénine illustre l'intérêt d'employer des enzymes issues de l'ingénierie dirigée pour la glucosylation d'accepteurs faiblement reconnus tels que les flavonoïdes.

Exemple 8 : Détermination des efficacités de glucosylation de la naringénine par les glucane-saccharases de la famille GH70

Les glucane-saccharases de la famille GH70 testées pour leur activité de glucosylation de l'apigénine sont répertoriées dans le Tableau 4. Les résultats de glucosylation de la naringénine par les glucane-saccharases de la famille GH70 sont reportés dans le Tableau 6.

Le Tableau 6 illustre l'efficacité de glucosylation de la naringénine pour la forme sauvage du variant tronqué de DSR-S (vardelA4N WT), pour la forme sauvage tronquée de l'ASR (ASR C-APY-del WT), pour la forme sauvage de l'enzyme α- 1 ,2 BrS et pour sept mutants de DSR-S vardelA4N.

La barre grise dans chaque case figure le niveau d'efficacité de glucosylation par rapport au mutant le plus efficace.

La forme sauvage du variant tronqué de l'ASR (ASR C-APY-del WT) présente une efficacité de glucosylation de 27,1 %. L'enzyme sauvage α- 1 ,2 BrS présente une efficacité de glucosylation de la naringénine de 26,8 %.

Exemple 9 : Analyse LC-MS des produits de glucosylation de a naringénine

Les dix-huit mutants ayant une efficacité de glucosylation de la naringénine supérieure à 10 % discutés aux exemples 7 et 8 peuvent être classés en sept catégories suivant le profil de produits de glucosylation, obtenu en LC-MS. La superposition des chromatogrammes UV (λ340 nm) pour un représentant de chacune de ces sept catégories de profils est présentée en Figure 3.

La superposition de ces chromatogrammes met en évidence la diversité de formes de naringénine glucosylée à laquelle il est possible d'aboutir.

Les profils LC-MS obtenus pour ASNp WT, les cinq enzymes mutantes de l'ASNp et les deux glucane-saccharases de la famille GH70 les plus efficaces sont représentés aux Figures 20 à 27.

Les masses molaires, telles que déterminées par LC-MS dans l'exemple 1 , du pic de naringénine glucosylée le plus intense pour chacun de ces profils sont les suivantes :

Figure 20 : non déterminé

Figure 21 : 433,6 g/mol

Figure 22 : 595,5 g/mol

Figure 23 : 758,4 g/mol

Figure 24 : 595,5 g/mol Figure 25 : 433,8 g/mol

Figure 26 : 433,8 g/mol

Figure 27 : 758,0 g/mol

L'enzyme sauvage (Figure 20) a une efficacité réduite de glucosylation sur l naringénine (4,7 %). En effet, si on compare le standard de naringénine avec les produits finaux de la réaction de glucosylation, on détecte l'apparition sur le chromatogramme UV de plusieurs pics, de faibles intensités, de naringénine glucosylée (Figure 20).

Les profils de glucosylation de la naringénine obtenus avec les enzymes ASNp R226N, ASNp I228A, ASNp A289C, ASNp F290V, ASNp A289P F290C, ASR-C-APY- del ou α- 1 ,2 BrS sont tous distincts (Figures 21 à 27).

Exemple 10 : Production, purification et détermination structurale par RMN de la 4 , -O-α-D-glucopyranosylnaringénine par le mutant I228A de l'ASNp

Production de la 4 , -O-α-D-glucopyranosylnaringénine

La production des produits de glucosylation est réalisée avec l'enzyme ASNp

I228A sur 204 mg de naringénine. Les conditions réactionnelles sont les suivantes : concentration finale en saccharose 146 mM, en naringénine 5 mM (initialement dissoute dans du DMSO à 150 mM), tampon PBS pH 7,2, ASNp 1228A 0,5 U/mL et eau ultrapure qsp 145 mL. La réaction est menée sous agitation à 30°C pendant 24 h. Au terme de la réaction, l'enzyme est thermiquement inactivée. Le mélange réactionnel est conservé à - 20°C.

Purification de la 4'-O-α-D-glucopyranosylnaringénine

Une étape de pré-purification est réalisée par extraction sur phase solide (SPE) sur une cartouche contenant 5 g de phase stationnaire Cl 8. Après conditionnement de la colonne, le mélange réactionnel centrifugé est déposé sur la colonne et percole par gravité.

Après les étapes de lavage avec de l'eau ultrapure, l'élution est réalisée avec du méthanol.

L'éluat est séché sous un flux d'azote gazeux avant d'être repris dans 100% DMSO à une concentration de 100 g/L.

Les différentes formes glucosylées de la naringénine sont séparées à température ambiante par HPLC-UV semi-préparative sur un équipement Waters. Une colonne Cl 8 250 x 10 mm munie d'une précolonne permet de séparer les différentes formes glucosylées de la naringénine avec une phase mobile aqueuse à 0,05% (v/v) d'acide formique avec un gradient d'acétonitrile (B). Les différentes étapes du gradient sont les suivantes : 0 min, 22% B ; 1 min, 22% B ; 17 min, 25% B ; 21 min, 29% B ; 21 ,5 min, 95% B ; 24,5 min, 95% B ; 25 min, 22% B ; 27,5 min, 22 % B. Sur la base du signal UV, les fractions d'élution sont collectées de manière automatisée. La pureté des fractions d'élution est évaluée par LC-UV-MS avec une colonne analytique Cl 8 250 x 4,6 mm (gradient décrit ci-dessus)

Les fractions d'élution contenant une forme monoglucosylée de la naringénine pure à 96%, éluant à un temps de rétention de 18,4 min en HPLC-UV semi-préparative, sont rassemblées et séchées grâce un équipement GeneVac. Le produit est ensuite solubilisé dans 300 de méthanol deutéré, séché sous un flux d'azote gazeux puis lyophilisé pendant 48h.

Caractérisation structurale de la 4'-O-α-D-glucopyranosylnariniiénine La détermination structurale de ce produit de mono-glucosylation a été effectuée par RMN.

Les spectres 1H, 1 H-1 H COSY, JMod, 1 H-13C HMBC ont été enregistrés sur un équipement Bruker Avance 500 MHz à 298 K (500 MHz pour 1 H et 125 MHz pour l3 C) avec une sonde 5 mm z-gradient TBI. Les données ont été acquises et traitées grâce au logiciel TopSpin 3. L'échantillon a été analysé dans du méthanol deutéré.

L'attribution des différents signaux RMN est portée sur les Figures 28, 29 et

30. Le composé identifié est la 4'-O-α-D-glucopyranosylnaringénine. La constante de couplage 3 JH-i. H-2 du proton anomérique H-l " du résidu glucosyle est de 3,4 Hz.

Exemple 11 : Glucosylation de la naringénine et de la morine par l'enzyme ANm-GBD-CD2 et ses mutants

Des variants simples ou doubles construits à partir de la glucane-saccharase AN i23-GBD-CD2 (appartenant à la famille GH70 des glycoside-hydrolases) ont été testés pour leur aptitude à glucosyler la naringénine et la morine. Les résultats de glucosylation de ces deux flavonoïdes, par des variants de AN| 2 3 -GBD-CD2, sont reportés dans les Tableaux 7 et 8. Concernant la morine, l'enzyme sauvage la glucosyle avec une efficacité de glucosylation de 20,4 ± 3,2%.

Quatorze mutants glucosylent ce flavonol plus efficacement que l'enzyme sauvage, à savoir W403G, W403S-F404L, W403V, W403C, W403F, F431 I-D432E- L434I, F431 L, A430E-F431 L, W403F-F404I, W403C-F404I, W403N-F404Y, W403N- F404H, W403I-F404Y et W403L-F404L. Les efficacités de glucosylation obtenues pour ces mutants sont représentées dans le Tableau 7.

Parmi eux, neuf mutants glucosylent la morine avec une efficacité de glucosylation supérieure ou égale à 30% (mutants W403G, W403S-F404L, W403V, W403C, W403F, F4311-D432E-L434I, F431 L, A430E-F431 L et W403F-F404I). Deux mutants ont même une efficacité de glucosylation de la morine supérieure ou égale à 40%, voire à 45% (mutants W403S-F404L et W403G). Les meilleures efficacités de glucosylation ont été obtenues avec les mutants W403S-F404L (49,5%) et W403G (66,7%). Des produits de glucosylation de la morine ont été détectés par LC-UV-MS (Figure 31 ). Un composé mono-glucosylé, deux composés diglucosylés et un composé triglucosylé ont été identifiés. Le meilleur mutant pour la glucosylation de la morine est le variant W403G qui synthétise quatre fois plus de morine di-glucosylé que l'enzyme sauvage. La naringénine est glucosylée par ANi 2 3-GBD-CD2 WT avec un rendement de glucosylation de 13,9 ± 4,7% (Tableau 8).

Neuf variants présentent une efficacité de glucosylation supérieure à 20%, à savoir W403I-F404Y, W403V, W403G, W403F, W403S-F404L, W403C, F431 I-D432E- L434I, F431 L et A430E-F431 L. Les efficacités de glucosylation obtenues sont représentées dans le Tableau 8.

Sept d'entre eux ont une efficacité de glucosylation supérieure ou égale à 25 % (W403I-F404Y, W403V, W403G, W403F, W403S-F404L, W403C, et F431 I-D432E- L434I). Plus particulièrement, trois variants ont une efficacité de glucosylation supérieure ou égale à 30 %, voire à 35% (W403G, W403F, W403I-F404Y). Le meilleur taux de conversion de 59,3% a été obtenu avec le variant W4031-F404Y. Concernant les produits de glucosylation de la naringénine, des produits de réaction ont été détectés par LC-UV- M S (Figure 32). Un composé monoglucosylé. deux composés diglucosylés et un composé triglucosylé ont été identifiés par spectrométrie de masse.

La naringénine est peu glucosylée par l'enzyme sauvage (14%) et l'essentiel est monoglueosylée (13%). En particulier, un variant de la banque W403-F404 présente une augmentation de la production du produit mono-glucosylé. jusqu'à 49% avec le mutant W4031-F404Y. Finalement, un variant (W403S-F404L) convertit 10% de la naringénine en composé triglucosylé (contre seulement 1% pour l'enzyme sauvage).

Liaisons

majoritaires

Organisme Glucane-saccharase Références

dans le polymère

naturel

Albenne C. et al, J. Biol. Chem. , 2004 279(1)

726-734

ASNp WT et 152 mutants Champion E., 2008. Thèse de doctorat, INSA,

Neisseria simples et 3 mutants Toulouse

polysaccharea doubles du site actif -(l→4)

(EC 2.4.1.4) (Positions 228, 229, 289, Champion C. et al, J. Am. Chem. Soc., 2009,

290, 330, 331 , 394, 446) 131 , 7379-7389

Champion C. et al., J. Am. Chem. Soc, 2012,

134, 18677-18688

EP08290238.8

Tableau 1

nd : donnée non disponible

Tableau 2 54

nd : donnée non disponible

Tableau 3 Liaisons

Organisme Clueane-saecharase majoritaires dans le Références

polymère naturel

Moulis. C, 2006. Thèse de

Leuconostoc doctorat, INSA, Toulouse et mesenteroides B-512F DSR-S varde WN WT -(l→6) Moulis C. et al., FEMS (EC 2.4.1.5) Microbiol. Lett, 2006

261 203-210

7 mutants de DSR-S

vardeLd4N : F353T ou S512C

Leuconostoc ou F353W ou

Irague R. et al, Anal. Chem. mesenteroides B-512F H463R/T464D/S512T ou -(l→6)

2011 83(4) 1202-1206 (EC 2.4.1.5) H463R/T464V/S512T ou

D460A/H463S/T464L ou

D460M/H463 Y/T464M/S512C

Joucla. G., 2003. Thèse de

Leuconostoc

doctorat, INSA, Toulouse et mesenteroides NRRL B- a-(l→3)

ASR C-APY-del Joucla G et al, FEBSLett. 1355 / -(l→6)

2006 580(3) 763-768 (EC 2.4.1.140)

Leuconostoc

mesenteroides NRRL B- Mutant de DSR-E B ri son et al , J. Biol. Chem., a-(l→2)

1299 AN 123 -GBD-CD2 2012, 287, 7915-24

Tableau 4

Tableau 5

Le nombre indiqué dans chaque case est le pourcentage d'efficacité de glucosylation.

Tableau 6

Le nombre indiqué dans chaque case est le pourcentage d'efficacité de glucosylation

Morine Na ri ngénine

Tableau 7 Tableau 8

Efficacités de glucosylation de la morine (Tableau 7) et de la naringénine (Tableau 8) par la glucane-saccharase ANi23-GBD-CD2 sauvage et les meilleurs mutants issus du criblage secondaire.

SEQUENCES :

Série SEQ ID NO : 1 : (Protéines = séquences mutées de la glucane-saccharase ASNp (Amylosucrase Neisseria polysaccharea) R226Xj)

SPNSQYLKTRILDIYTPEQRAGIE SEDWRQFSRRMDTHFPKLMNELDSV YGNNEALLPMLEMLLAQAWQSYSQRNSSLKDIDIARENNPDWILSNKQVGGVCYV DLFAGDL GLKDKIPYFQELGLTYLHLMPLF CPEGKSDGGYAVSSYRDVNPALGT IGDLREVIAALHEAGISAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMP DQYDRTLX,EIFPDQHPGGFSQLEDGRWVWTTFNSFQWDLNYSNPWVFRAMAGEM LFLANLGVDILRMDAVAFIWKQMGTSCENLPQAHALIRAFNAVMRIAAP AVFFKSE AIVHPDQVVQYIGQDECQIGYNPLQMALLWNTLATREWLLHQALTYRHNLPEHT AWVNYVRSHDDIGWTFADEDAAYLGISGYDHRQFLNRFFVNRFDGSFARGVPFQY NPSTGDCRVSGTAAALVGLAQDDPHAVDRIKLLYSIALSTGGLPLIYLGDEVGTLND DDWSQDSNKSDDSRWAHRPRYNEALYAQRNDPSTAAGQIYQDLRHMIAVRQSNP RFDGGRLVTFNTNNKHIIGYIRNNALLAFGNFSEYPQTVTAHTLQ AMPFKAHDLIGG KTVSLNQDLTLQPYQVMWLEIA

Série SEQ ID NO : 2 : (Protéines = séquences mutées de la glucane-saccharase ASNp (Amylosucrase Neisseria polysaccharea) I228Xi>

SPNSQYLKTRILDIYTPEQRAGIEKSEDWRQFSRRMDTHFPKLMNELDSV YGNNEALLPMLEMLLAQAWQSYSQRNSSLKDroiARENNPDWILSNKQVGGVCYV DLFAGDLKGLKDKIPYFQELGLTYLHLMPLFKCPEGKSDGGYAVSSYRDVNPALGT IGDLREVIAALHEAG1SAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMP DQYDRTLREX 2 FPDQHPGGFSQLEDGRWVWTTFNSFQWDLNYSNPWVFRAMAGE MLFLANLGVDILRMDAVAFIWKQMGTSCENLPQAHALffiAFNAVMRIAAPAVFFKS EAWHPDQVVQYIGQDECQIGYNPLQMALLWNTLATREVNLLHQALTYRHNLPEH TAWVNYVRSHDDIGWTFADEDAAYLGISGYDHRQFLNRPFVM FDGSFARGVPFQ YNPSTGDCRVSGTAAALVGLAQDDPHAVDRIKLLYSIALSTGGLPLIYLGDEVGTLN DDDWSQDSN SDDSRWAHRPRYNEALYAQRNDPSTAAGQIYQDLRHMIAVRQSN PRFDGGRLX FNTNN HIIGYIRNNALLAFGNFSEYPQTVTAHTLQAMPFKAHDLIG GKTVSLNQDLTLQPYQVMWLEIA Série SEQ ID NO : 3 : (Protéines = séquences mutées de la glucane-saccharase ASNp (Amylosucrase Neisseria polysaccharea) F229X 3

SPNSQYL TRILDIYTPEQRAGIEKSEDWRQFSRRMDTHFP LM ELDSV YGNNEALLPMLEMLLAQAWQSYSQRNSSLKDIDIAREN PDWILSNKQVGGVCYV DLFAGDLKGLKDKIPYFQELGLTYLHLMPLFKCPEGKSDGGYAVSSYRDVNPALGT IGDLREVIAALHEAGISAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMP DQYDRTLREIX 3 PDQHPGGFSQLEDGRWVWTTFNSFQWDLNYSNPWVFRAMAGE MLFLANLGVDILRMDAVAFIWKQMGTSCENLPQAHALIRAFNAVMRIAAPAVFFKS EAIVHPDQVVQYIGQDECQ1GYNPLQMALLWNTLATREVNLLHQALTYRHNLPEH TAWVNYVRSHDDIGWTFADEDAAYLGISGYDHRQFL RFFVNRFDGSFARGVPFQ YNPSTGDCRVSGTAAALVGLAQDDPHAVDR1 LLYSIALSTGGLPLIYLGDEVGTLN DDDWSQDSNKSDDSRWAHRPRY EALYAQR DPSTAAGQIYQDLRHMIAVRQS PRFDGGRLVTFNTNNKHIIGYIRN ALLAFGNFSEYPQTVTAHTLQAMPFKAHDLIG GKTVSLNQDLTLQPYQVMWLEIA

SEQ ID NO : 4 : (Protéine = séquence mutée de la glucane-saccharase ASNp (Amylosucrase Neisseria polysaccharea) Α289Χ^

S PN SQ Y L TR1 LDI YTPEQRAG IEKS EDWRQFSRRM DTHFPKLMNELDS V

YGNNEALLPMLEMLLAQAWQSYSQRNSSLKDIDIARENNPDWILSNKQVGGVCYV DLFAGDLKGLKDKJPYFQELGLTYLHLMPLFKCPEGKSDGGYAVSSYRDVNPALGT IGDLREVIAALHEAGISAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMP DQYDRTLREIFPDQHPGGFSQLEDGRWVWTTFNSFQWDLNYSNPWVFRAMAGEM LFLANLGVDILRMDAVX 4 FIWKQMGTSCENLPQAHALIRAFNAVMRIAAPAVFFKS EATVHPDQVVQYIGQDECQIGYNPLQMALLWNTLATREVNLLHQALTYRHNLPEH TAWVNYVRSHDDIGWTFADEDAAYLGISGYDHRQFLNRFFVNRFDGSFARGVPFQ YNPSTGDCRVSGTAAALVGLAQDDPHAVDRIKLLYSIALSTGGLPLIYLGDEVGTLN DDDWS QD SNKSDD SRW AHRPRYNE AL Y AQRNDP ST AAGQrYQDLRHMIA VRQ SN PRFDGGRLVTFNT WKHIIGYIRNNALLAFGNFSEYPQTVTAHTLQAMPFKAHDLIG GKTVSLNQDLTLQPYQVMWLEIA Série SEQ ID NO : 5 : (Protéines = séquences mutées de la glucane-saccharase ASNp (Amylosucrase Neisseria polysaccharea) F290X§)

SPN SQYLKTR I LDI YTPEQR AG 1 E S ED WRQFSRRM DTHFPK LMNE LOS V YGNNEALLPMLEMLLAQAWQSYSQRNSSLKDID1ARENNPDWILSNKQVGGVCYV DLFAGDLKGLKD IPYFQELGLTYLHL PLF CPEG SDGGYAVSSYRDVNPALGT IGDLREVIAALHEAGISAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMP DQYDRTLREIFPDQHPGGFSQLEDGRWVWTTFNSFQWDLNYSNPWVFRAMAGEM LFLANLGVDILRMDAVAX 5 IW QMGTSCENLPQAHALIRAFNAVMRIAAPAVFFKS EAIVHPDQVVQYIGQDECQIGYNPLQMALL WTLATREVNLLHQ ALTYRHNLPEH TAWVNYVRSHDDIGWTFADEDAAYLGISGYDHRQFLNRFFVNRFDGSFARGVPFQ YNPSTGDCRVSGTAAALVGLAQDDPHAVDRIKLLYSIALSTGGLPLIYLGDEVGTLN DDDWSQDSNKSDDSRWAHRPRYNEALYAQRNDPSTAAGQIYQDLRHMIAVRQSN PRFDGGRLVTFNTNNKHIIGYIRNNALLAFGNFSEYPQTVTAHTLQAMPFKAHDLIG GKTVSLNQDLTLQPYQVMWLEIA

Série SEQ 1D NO : 6 : (Protéines = séquences mutées de la glucane-saccharase ASNp (Amylosucrase Neisseria polysaccharea) V331X¾)

SPNSQYLKTRILDIYTPEQRAGIEKSEDWRQFSRRMDTHFPKLMNELDSV YGNNE ALLPMLEMLL AQ AWQ SYS QRNS SLKDDDIARENNPD WILSNKQ VGG VC YV DLFAGDL GLKDKIPYFQELGLTYLHLMPLFKCPEGKSDGGYAVSSYRDVNPALGT IGDLREVIAALHEAGISAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMP DQYDRTLREIFPDQHPGGFSQLEDGRWVWTTFNSFQWDLNYSNPWVFRAMAGEM LFLANLGVOILRMDAVAFIW Q GTSCENLPQAHALIRAFNAVMRIAAPAVFF SE AIX 6 HPDQWQYIGQDECQIGYNPLQMALLAVNTLATREVNLLHQALTYRHNLPEHT AWVNYVRSHDDIGWTFADEDAAYLGISGYDHRQFLNRFFVNRFDGSFARGVPFQY NPSTGDCRVSGTAAALVGLAQDDPHAVDRIKLLYSIALSTGGLPLIYLGDEVGTLND DDWSQDSNKSDDSRWAHRPRYNEALYAQRNDPSTAAGQIYQDLRHMIAVRQSNP RFDGGRLVTFNTNN HI1GYIRNNALLAFGNFSEYPQTVTAHTLQAMPFKAHDLIGG KTVSLNQDLTLQPYQVMWLEIA Série SEQ 1D NO : 7 : (Protéines = séquences mutées de la glucane-saccharase ASNp (Amylosucrase Neisseria polysaccharea) D394X 7 J

SPNSQYLKTRILDIYTPEQRAGIEKSEDWRQFSRRMDTHFPKLMNELDSV YGNNEALLPMLEMLLAQAWQSYSQRNSSLKDEDLARENNPDWILSNKQVGGVCYV DLFAGDLKGLKDKIPYFQELGLTYLHLMPLFKCPEGKSDGGYAVSSYRDVNPALGT IGDLREVIAALHEAGISAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMP DQYDRTLREIFPDQHPGGFSQLEDGRWVWTTFNSFQWDLNYSNPWVFRAMAGEM LFLANLGVDILRMDAVAFIWKQMGTSCENLPQ,A_HALIRAFNAV RIAAPAVFFKSE AWHPDQVVQYIGQDECQIGYNPLQMALLWNTLATREVNLLHQALTYRHNLPEHT AWVNYVRSHDX 7 IGWTFADEDAAYLGISGYDHRQFLNRFFWRFDGSFARGVPFQY NPSTGDCRVSGTAAALVGLAQDDPHAVDRIKLLYSIALSTGGLPLIYLGDEVGTLND DDWSQDSNKSDDSRWAHRPRYNEALYAQRNDPSTAAGQIYQDLRHMIAVRQSNP RFDGGRLVTFNTNNKHIIGYIRNNALLAFGNFSEYPQTVTAHTLQAMPFKAHDLIGG KT VS LNQDLTLQP YQ VMWLEI A

SEQ 1D NO : 8 ; (Protéine = séquence mutée de la glucane-saccharase ASNp (Amylosucrase Neisseria polysaccharea) R446Q

SPNSQYLKTRILDIYTPEQRAGIEKSEDWRQFSRRMDTHFPKLMNELDSV YGNNEALLPMLEMLLAQAWQSYSQRNSSLKDIDIARENNPDWILSNKQVGGVCYV DLFAGDLKGLKDKIPYFQELGLTYLHLMPLFKCPEGKSDGGYAVSSYRDVNPALGT IGDLREVIAALHEAGISAVVDFIF HTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMP DQYDRTLREIFPDQHPGGFSQLEDGRWVWTTFNSFQWDLNYSNPWVFRAMAGEM LFLANLGVDILRMDAVAFIWKQMGTSCENLPQAHALIRAFNAVMRIAAPAVFFKSE

ArVHPDQVVQYIGQDECQIGYNPLQMALLWNTLATREVNLLHQALTYRHNLPEHT AWVNYVRSHDDIGWTFADEDAAYLGISGYDHRQFLNRFFVNRFDGSFARGVPFQY NPSTGDCQVSGTAAALVGLAQDDPHAVDRI LLYSIALSTGGLPLIYLGDEVGTLND DDWSQDSNKSDDSRWAHRPRYNEALYAQRNDPSTAAGQIYQDLRHMIAVRQSNP RFDGGRLVTFNTNNKHIIGYIRNNALLAFGNFSEYPQTVTAHTLQAMPFKAHDLIGG KTVSLNQDLTLQPYQVMWLEIA Série SEQ ID NO : 9 : (Protéines = séquences doublement mutées de la glucane-saccharase ASNp (Amylosucrase Neisseria polysaccharea) A289P/F290X &

SPNSQYLKTRILDIYTPEQRAGIEKSEDWRQFSRRMDTHFPKLMNELDSV YGN EALLPMLEMLLAQAWQSYSQRNSSLKDIDIARENNPDWILSNKQVGGVCYV DLFAGDLKGLKDKIPYFQELGLTYLHLMPLFKCPEGKSDGGYAVSSYRDVNPALGT IGDLREVIAALHEAGISAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMP DQYDRTLREIFPDQHPGGFSQLEDGRWVWTTFNSFQWDLNYS PWVFRAMAGEM LFLANLGVDILRMDAVPXglWKQMGTSCENLPQAHALIRAFNAVMRIAAPAVFFKS EAIVHPDQVVQYIGQDECQIGYNPLQMALLWNTLATREVNLLHQALTYRHNLPEH TAWVNYVRSHDDIGWTFADEDAAYLGISGYDHRQFLNRFFVNRFDGSFARGVPFQ YNP STGDCRVS GT AAALVGLAQDDPH A VDRIKLLYS IALS TGGLPLIYLGDE VGTLN DDDWSQDSN SDDSRWAHRPRYNEALYAQRNDPSTAAGQIYQDLRHMIAVRQSN PRFDGGRLVTFNTN KHIIGYIR NALLAFGNFSEYPQTVTAHTLQAMPFKAHDLIG GKTVSLNQDLTLQPYQVMWLEIA

SEQ ID NO : 10 : (Protéine — séquence mutée de la glucane-saccharase tronquée DSR-S vardelMN ' - S512C)

TQQVSGKYVEKDGSWYYYFDDGKNAKGLSTIDNNIQYFYESG QAKG QYVTIDNQTYYFDKGSGDELTGLQSIDGNIVAFNDEGQQIFNQYYQSENGTTYYFD DKGHAATGIK IEGKNYYFDNLGQLKKGFSGVIDGQIMTFDQETGQEVSNTTSEIKE GLTTQNTDYSEHNAAHGTDAEDFENIDGYLTASSWYRPTGILPvNGTDWEPSTDTDF RPILS V WWPDK TQ VNYLNYM ADLGFISN ADSFETGD S Q S LLNE ASNY VQKS IEMK ISAQQSTEWLKDAMAAFIVAQPQWNETSEDMS DHLQNGALTYVNSPLTPDANSN FRLLNRTPTNQTGEQAYNLDNSKGGFELLLANQEDNSNVVVEAEQLNWLYYLMNF GTITA DADANFDGIRVDAVDNVDADLLQIAADYF LAYGVDQNDATANQHLSIL EDWSHNDPLYVTDQGSNQLTMDDYVHTQLIWSLTKSSDIRGTMQRFVDYYMVDR S DSTENEAIPNYSFVRAHDCEVQTVLAQrVSDLYPDVENSLAPTTEQLAAAFKVYN EDEKLADKKYTQYNMASAYAMLLTNKDTVPRVYYGDLYTDDGQYMAT SPYYD AINTLLI ARVQYVAGGQSMSVDSNDVLTSVRYGKDAMTASDTGTSETRTEGlGVrV SNNAELQLEDGHTVTLHMGAAHKNQAYRALLSTTADGLAYYDTDENAPVAYTDA NGDLIFTNESIYGVQNPQVSGYLAVWVPVGAQQDQDARTASDTTTNTSD VFHSN A LDSQVF EGFSNFQAFATDSSEYTNVVIAQNADQFKQWGVTSFQLAPQYRSSTD TSFLDSIIQNGYAFTDRYDLGYGTPTKYGTADQLRDAIKALHASGIQAIADWVPDQI YNLPEQELATVTRTNSFGDDDTDSDIDNALYWQSRGGGQYQEMYGGAFLEELQA LYPSLFKVNQISTGVPIDGSVKITEWAAKYFNGSNIQGKGAGYVLKDMGSNKYFKV VSNTEDGDYLPKQLTNDLSETGFTHDDKGIIYYTLSGYRAQNAFIQDDDNNYYYFD KTGHLVTGLQKIN HTYFFLPNGIELVKSFLQNEDGT YFDKKGHQVFDQYITDQN GNAYYFDDAGVMLKSGLATIDGHQQYFDQNGVQVKDKFVIGTDGYKYYFEPGSG NLAILRYVQNSKNQWFYFDGNGHAVTGFQTLNGKKQYFYNDGHQSKGEFIDADGD TFYTSATDGRLVTGVQKINGITYAFDNTGNLITNQYYQLADGKYMLLDDSGRAKT GFVLQDGVLRYFDQNGEQVKDAIIVDPDTNLS . SEQ 1D NO : 1 1 : (Protéine = séquence de lu glucane-saccharase a-1,2 BrS) MRQKETITRKKLYKSGKSWVAAATAFAVMGVSAVTTVSADTQTPVGT TQSQQDLTGQRGQDKPTTKEVIDKKEPVPQVSAQNAGDLSADAKTTKADDKQDTQ PTNAQLPDQGNKQTNSNSDKGVKESTTAPVKTTDVPSKSVTPETNTSINGGQYVEK DGQFVY1DQSGKQVSGLQNIEGHTQYFDPKTGYQTKGELKNIDDNAYYFDKNSGN GRTFTKISNGSYSEKDGMWQYVDSHDKQPVKGLYDVEGNLQYFDLSTGNQAKHQI RSVDGVTYYFDADSGNATAFKAVTNGRYAEQTTKDKDGNETSYWAYLDNQGNAI KGLNDVNGEIQYFDEHTGEQLKGHTATLDGTTYYFEG KGNLVSVVNTAPTGQYK INGDNVYYLDNN EAU GLYGINGNLNYFDLATGIQLKGQAKNIDGIGYYFDKDTG NGSYQYTLMAPSNKNDYTQHNVV NLSES FKNLVDGFLTAETWYRPAQILSHGT DWVASTDKDFRPLITVWWPNKDIQV YLRLMQNEGVLNQSAVYDLNTDQLLLNE AAQQAQIGIEKKISQTGNTDWLN VLFTTHDGQPSFIKQQYLWNSDSEYHTGPFQG GYLKYQNSDLTPNVNSKYRNADNSLDFLLANDVDNSNPIVQAEDLNWLYYLLNFG S ITTQGK ENN SN FD S 1 RI D A V D F V S N D L I QRT Y D Y LR AA Y G V DKN D F. AN AH LS L V E AGLDAGTTTIHQD ALIESDIREAMKKSLTNGPGSNISLSNLIQDKEGDKLIADRANNS TENVAIPNYSIIHAHDKDIQDKVGAAITDATGADWTNFTPEQLQKGLSLYYEDQRKI EKKYNQYNIPSAYALLLTNKDTVPRVYYGDMYQDDGQYMQKQSLYFDTITALME AR QFVAGGQTINVDDNGVLTSVRFGKGA TA DIGTNETRTQGIGVVIANDPSLK LSKDSKVTLHMG AAHRNQNYRALLLTTDNGIDS YS S SK AP VIKTDDNGDLVFSNQ DINDQLNTKVHGFLNSEVSGYLSAWVPLDATEQQDARTLPSEKSVNDG VLHSNA ALDSNLIYEAFSNFQPMPTNRNEYTWVL DKADTFKSWGITSFEMAPQYRSSQDKT FLDSTÎDNGYAFTDRYDLGFEKPTKYGNDEDLRQAIKQLHSSGMQVMADVVANQI YNLPGKEVASTNRVDW GN LSTPFGTQMYVVNTVGGGKYQ KYGGEFLDKLK AAYPDIFRSKOTEYDVKNYGGNGTGSVYYTVDSKTRAELDTDTKIKEWSAKYMN GTNVLGLGMGYVL DWQTGQYFNVSNQNMKFLLPSDLISNDITVQLGVPVTDKKII FDPASAYNMYSNLPEDMQVMDYQDDKKSTPSD PLSSYNNKQVQVTRQYTDSKGV SW LITFAGGDLQGQKLWVDSRALTMTPFKTMNQISFISYANRNDGLFLNAPYQVK GYQLAGMSNQYKGQQVTIAGVANVSGKDWSL1SFNGTQYWIDSQALNTNFTHDM NQKVFV TTSNLDGLFLNAPYRQPGYKLAGLAKNYNNQTVTVSQQYFDDQGTVW SQVVLGGQTVWVDNHALAQMQVRDTNQQLYVNSNGRNDGLFLNAPYRGQGSQLI GMTADYNGQHVQVTKQGQDAYGAQWRLITLNNQQVWVDSRALSTTIMQAMNDD MYVNSSQRTDGLWLNAPYTMSGAKWAGDTRSANGRYVHISKAYSNEVGNTYYLT NLNGQSTWIDKRAFTATFDQWALNATIVARQRPDGMFKTAPYGEAGAQFVDYVT N YNQQTVPVTKQH S DAQGNQ W YLAT VN GTQ Y WÏDQRS FS P VVTK VVDYQ AKI VP

RTTRDGVFSGAPYGEVNAKLV

NMATAYQNQVVHATGEYTNASGITWSQFALSGQEDKLWIDKRALQA

Série SEQ ID NO : 12 : (Protéine = séquence mutée de la glucane-saccharase AN 123 -GBD-CD2j (W403X 9 ; F404X,,, ; A430X, , ; F431X 12 ; et L434X 13 .)

MAHHHHHHVTSLYKKAGSAAAPFTMAQAGHYITKNGNDWQYDTNGE LAKGLRQDSNGKLRYFDLTTGIQAKGQFVTIGQETYYFSKDHGDAQLLPMVTEGH YGTITL QGQDTKTAWVYRDQNNTIL GLQNINGTLQFFDPYTGEQLKGGVAKYD DKLFYFESGKGNLVSTVAGDYQDGHYISQDGQTRYADKQNQLVKGLVTVNGALQ YFDNATGNQIKNQQVIVDGKTYYFDDKGNGEYLFTNTLDMSTNAFSTKNVAFNHD SSSFDHTVDGFLTADTWYRPKSILANGTTWRDSTDKDMRPLITVWWPNKNVQVNY LNFMKANGLLTTAAQYTLHSDQYDLNQAAQDVQVAIERRIASEHGTDWLQ LLFE SQNNNPSFVKQQFIWNKDSEYHGGGDAX 9 X 1 0QGGYLKYGNNPLTPTTNSDYRQPG NXnX 12 DFX 13 LANDVDNS PVVQAENLNWLHYLMNFGTITAGQDDANFDSIRIDAV DFIHNDTIQRTYDYLRDAYQVQQSEAKANQHISLVEAGLDAGTSTIHNDALIESNLR EAATLSLTNEPGKNKPLTNMLQDVDGGTLITDHTQNSTENQATPNYSIIHAHDKGV QEKVGAAITDATGADWTNFTDEQLKAGLELFY DQRATNKKYNSYNIPSrYALML TNKDTVPRMYYGDMYQDDGQYMAK SIYYDALVSLMTAR SYVSGGQTMSVDN HGLL SVRFGKDAMTA DLGTSATRTEGLGVIIGNDPKLQLNDSDKVTLDMGAAH KNQKYRAVILTTRDGLATFNSDQAPTAWTNDQGTLTFSNQEINGQDNTQIRGVANP QVSGYLAVWVPVGASDNQDARTAATTTENHDGKVLHSNAALDSNL1YEGFSNFQP ATTHDELTNVVIAKNADVFNNWGITSFEMAPQYRSSGDHTFLDSTIDNGYAFTDR YDLGFNTPTKYGTDGDLRATIQALHHA MQVMADVVDNQVYNLPGKEWSATRA GWGNDDATGFGTQLYVTNSVGGGQYQEKYAGQYLEALKAKYPDLFEGKAYDY WY NYANDGSNPYYTLSHGDRESIPADVAI QWSAK\ ' MNGTNVLGNGMGYVLK. DWHNGQYFKLDGDKSTLPKGGRADPAFLYKVVSAWSHPQFEK

Série SEQ 1D NO : 13 : (Protéine = séquence mutée de la glucane-sacchamse ANj23-GBD-CD2 (F431I ; D432E et L434L)

MAHHHHHHVTSLYKI GSAAAPFTMAQAGHYITKNGNDWQYDTNGE LAKGLRQDSNGKLRYFDLTTGIQAKGQFVTIGQETYYFSKDHGDAQLLPMVTEGH YGTITLKQGQDTKTAWVYRDQNNTIL GLQNINGTLQFFDPYTGEQLKGGVAKYD DKLFYFESGKGNLVSTVAGDYQDGHYISQDGQTRYADKQNQLVKGLVTVNGALQ YFDNATGNQIKNQQVrVDGKTYYFDDKGNGEYLFTNTLDMSTNAFSTKNVAFNHD SSSFDHTVDGFLTADTWYRPKSILANGTTWRDSTDKDMRPLITVWWPNKNVQVNY LNFMKANGLLTTAAQYTLHSDQYDLNQAAQDVQVAIERRIASEHGTDWLQKLLFE SQNNNPSFVKQQFIWNKDSEYHGGGDAWFQGGYLKYGNNPLTPTTNSDYRQPGN AIEFILANDVDNSNPVVQAENLN LHYLMNFGTITAGQDDANFDSIRIDAVDFIHND TIQRTYDYLRDAYQVQQSEAKANQHISLVEAGLDAGTSTUiNDALIESNLREAATLS LTNEPGKNKPLTNMLQDVDGGTLITDHTQNSTENQATPNYSIIHAHDKGVQEKVGA

A[TDATGADWTNFTDEQLKAGLELFYKDQRATNK.KYNSYNIPS1YAL LTNKDTVP RMYYGDMYQDDGQYMANKSIYYDALVSLMTARKSYVSGGQTMSVDNHGLLKSV RFGKDAMTANDLGTSATRTEGLGVIIGNDPKLQLNDSDKVTLDMGAAHKNQ YR AVILrrRDGLATFNSDQAPTAWTNDQGTLTFS QEINGQDNTQIRGVANPQVSGYL AVWVPVGASDNQDARTAATTTENHDGKVLHSNAALDSNLIYEGFSNFQPKATTHD ELTNVVIAKNADVFNNWGrrSFEMAPQYRSSGDHTFLDSTIDNGYAFTDRYDLGFN TPTKYGTDGDLRATIQALHHANMQVMADVVDNQVYNLPGKEVVSATRAGVYGN DDATGFGTQLYVTNSVGGGQYQEKYAGQYLEALKAKYPDLFEGKAYDYWYKNY ANDGSNPYYTLSHGDRESIPADVAIKQWSAKYMNGTNVLGNGMGYVLKDWHNG QYFKLDGDKSTLPKGGRADPAFLYKVVSAWSHPQFEK