Login| Sign Up| Help| Contact|

Patent Searching and Data


Title:
USE OF PFPI PEPTIDASES TO LIMIT THE PRESENCE OF ACRYLAMIDE IN FOOD PRODUCTS
Document Type and Number:
WIPO Patent Application WO/2017/207788
Kind Code:
A1
Abstract:
The invention relates to the use of a thermostable peptidase, obtained from a thermophilic bacterium, for the prevention and/or reduction of acrylamide formation during a food product preparation process involving at least one heat treatment step at 60 to 130°C.

Inventors:
RICHARME, Gilbert (22 ave des Gobelins, PARIS, PARIS, 75005, FR)
Application Number:
EP2017/063530
Publication Date:
December 07, 2017
Filing Date:
June 02, 2017
Export Citation:
Click for automatic bibliography generation   Help
Assignee:
UNIVERSITE PARIS DIDEROT PARIS 7 (5 rue Thomas Mann, PARIS, PARIS, 75013, FR)
CENTRE NATIONAL DE LA RECHERCHE SCIENTIFIQUE (CNRS) (3 rue Michel Ange, PARIS, PARIS, 75016, FR)
International Classes:
A21D8/04; A23F5/16; A23L2/02; A23L5/20; A23L7/13; A23L19/18; A23L33/00; A23C1/16; A23C9/00; A23C9/12
Domestic Patent References:
WO2014206915A12014-12-31
WO2014206914A12014-12-31
WO2014147189A12014-09-25
WO2012028945A22012-03-08
Foreign References:
US20110052758A12011-03-03
US20160128366A12016-05-12
Other References:
AMREIN TM; ANDRES L; MANZARDO, G.G.; AMADO R, J. AGRIC. FOOD CHEM., vol. 54, 2006, pages 10253 - 10261
BLUMENTHALS, I.I; ROBINSON, A.S.; KELLY, R.M., APPL. ENVIRON. MICROBIOL., vol. 56, 1990, pages 1992 - 1998
CHANG L., PH.D. THESIS, 2003
CHAVEROUX ET AL., MOL. CELL BIOL., vol. 29, 2009, pages 6515 - 6526
ERKEKOGLU P.; BAYDART., NUTRITION RES. REV., vol. 23, 2010, pages 323 - 333
FAFOURNOUX, P.; BRUHAT, A.; JOUSSE, C., BIOCHEM. J., vol. 351, pages 1 - 12
FROCK, A.D.; KELLY, R.M, CURR. OPIN. CHEM. ENG., vol. 12, 2012, pages 363 - 372
HALIO, S.B.; BAUER, M.W.; MUKUND, S.; ADAMS, M.; KELLY, R.M., APPL. ENVIRON. MICR., vol. 63, 1997, pages 289 - 295
KATCHALSKI-KATZIR, E., TRENDS BIOTECH., vol. 11, 1993, pages 471 - 478
MARIOTTI, S.; PEDRESCHI, F.; CARRASCO, J.A.; GRANBY, K., RECENT PAT. FOOD NUTR. AGRIC., vol. 3, 2011, pages 158 - 171
MATEO, C. ET AL., BIOMACROMOLECULES, vol. 11, 2010, pages 3112 - 3117
MOTTRAM, D.S.; WEDZICHA, B.L.; DODSON, A.T, NATURE, vol. 419, 2002, pages 448 - 449
RUZZO E.K ET AL., NEURON, vol. 80, 2013, pages 429 - 441
STADLER, R.H ET AL., NATURE, vol. 419, 2002, pages 449 - 450
TAREKE E.; RYDBERG P.; KARLSSON P.; ERIKSSON S; TÔRNQVIST M., J. AGRIC. FOOD CHEM., vol. 50, 2002, pages 4998 - 5006
TESSIER, F.J.; BIRLOUEZ-ARAGON I., AMINO ACIDS, vol. 42, 2012, pages 1119 - 1131
WOODLEY, J.M., CURR. OPIN. CHEM. BIOL., vol. 17, 2013, pages 310 - 316
YUAN, Y.; ZHAO, G.; CHEN, F.; LIU, J.; WU, J.; HU, X., FOOD CHEM., vol. 108, 2008, pages 885 - 890
ZHAN, D.; BAI, A.; YU, L; HAN, W.; FENG, Y., PLOS ONE, vol. 9, pages E103902
Attorney, Agent or Firm:
REGIMBEAU (20 rue de Chazelles, PARIS CEDEX 17, PARIS CEDEX 17, 75847, FR)
Download PDF:
Claims:
REVENDICATIONS

1. Utilisation d'une peptidase thermostable issue d'une bactérie thermophile, de préférence d'une archée thermophile ou hyperthermophile, dans la prévention et/ou la diminution de la formation d'acrylamide lors de la mise en œuvre d'un procédé de préparation de produit alimentaire comprenant au moins une étape de traitement thermique comprise entre 60 et 130°C, de préférence entre 70° C et 120°C, de préférence encore entre 90 et 110°C, caractérisée en ce que ladite peptidase thermostable issue d'une bactérie thermophile, de préférence d'une archée thermophile ou hyperthermophile, est choisie parmi Pfpl et ses homologues, de préférence Pfpl.

2. Utilisation selon la revendication 1 , caractérisée en ce que ladite peptidase est présente à une concentration comprise entre 0,05 et 2 μΜ, de préférence 1 μΜ. 3. Utilisation selon la revendication 1 ou 2, caractérisée en ce que ledit produit alimentaire est sélectionné parmi les pâtes à pain ou à pâtisserie, cafés solubles, jus de fruits industriels, laits condensés ou en poudre, aliments pour bébés, produits frits à base de pomme de terre, préférentiellement cafés solubles, jus de fruits industriels, laits condensés ou en poudre, aliments pour bébés, plus préférentiellement aliments pour bébés.

4. Procédé de préparation d'un produit alimentaire comprenant les étapes suivantes :

- la mise en contact dudit produit alimentaire avec une peptidase thermostable issue de bactéries thermophiles, de préférence d'archées thermophiles ou hyperthermophiles ;

- porter ledit produit alimentaire à une température comprise entre 60 et 130°C, de préférence entre 70° C et 120°C, préférentiellement 90 et 110° C ; et

- obtenir ledit produit alimentaire dans lequel la formation d'acrylamide est significativement réduite, caractérisé en ce que ladite peptidase thermostable issue de bactéries thermophiles, de préférence d'une archée thermophile ou hyperthermophile, est choisie parmi Pfpl et ses homologues, de préférence Pfpl.

5. Procédé selon la revendication 4, caractérisé en ce que lesdits homologues de Pfpl présentent une similarité de leurs séquences protéiques de 90%, de préférence 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% ou 99%.

6. Procédé selon la revendication 4 ou 5, caractérisé en ce que ladite peptidase est présente à une concentration comprise entre 0,05 et 2 μΜ, de préférence 1 μΜ.

7. Procédé selon l'une quelconque des revendications 4 à 6, caractérisé en ce que ledit produit alimentaire est sélectionné parmi les pâtes à pain ou à pâtisserie, cafés solubles, jus de fruits industriels, laits condensés ou en poudre, aliments pour bébés, produits frits à base de pomme de terre, préférentiellement cafés solubles, jus de fruits industriels, laits condensés ou en poudre, aliments pour bébés, plus préférentiellement aliments pour bébés.

Description:
UTILISATION DES PEPTIDASES DE LA FAMILLE PFPI POUR LIMITER LA PRESENCE

D'ACRYLAMIDE DANS LES PRODUITS ALIMENTAIRES

La présente invention se situe dans le domaine agroalimentaire, et en particulier dans le domaine des méthodes de préparation de produit alimentaire pour la prévention et/ou la diminution de la formation d'acrylamide.

L'acrylamide est un neurotoxique, reprotoxique et cancérigène qui se forme lors de réactions de Maillard (réactions de glycation) survenant lors de la cuisson des aliments (50° C- 250° C) (Mottram, 2002 ; Stadler, 2002 ; Tareke, 2002). Après ingestion, l'acrylamide est distribué dans tous les tissus, où il exerce ses actions néfastes malgré sa faible concentration. Depuis 1994, l'acrylamide est classée comme cancérigène pour l'homme. L'OMS a réglementé très précisément la présence d'acrylamide dans l'eau de consommation, avec 1 microgramme ^g) par litre comme dose maximale autorisée.

Une étude suédoise réalisée en 2002, puis confirmée par l'Agence des Normes Alimentaires britannique (Food Standards Agency) a montré que certains produits industriels contenaient de l'acrylamide en grande quantité, parmi lesquels, les chips de pomme de terre, le pain industriel et les céréales.

La formation d'acrylamide résulte de la condensation de l'asparagine libre (non incorporée dans les protéines) avec les sucres (glucose, fructose) et les glyoxals (méthylglyoxal CH3-CO- CHO, glyoxal CHO-CHO) formés par décomposition des sucres, et, dans le cas du glucose, elle résulte à 75% de la réaction de l'asparagine avec les glyoxals issus de la décomposition du glucose (Yuan et al. 2008). La condensation d'asparagine (par son a-NI-h) avec un aldéhyde/cétone (sucre, glyoxal) forme un « composé de Maillard » qui favorise la décarboxylation et la désamination de sa moitié asparagine NH2-CO-CH2-CH- (NH2)-COOH en acrylamide NH 2 -CO-CH=CH 2 .

Ainsi, l'acrylamide se forme lors de la transformation à haute température (70-250° C) des aliments contenant des sucres (l'amidon en particulier, source de glucose) et des protéines ou acides aminés, sources d'asparagine. Les principaux aliments contenant de l'acrylamide sont les frites, viandes grillées, céréales grillées (pain, biscuits, pain d'épices, corn flakes), café soluble, jus de fruits industriels, laits condensés/en poudre, aliments pour bébés (Erkekoglu et al., 2010, Tessier, 2012). Ces aliments subissent des étapes de chauffage vers 100°C ou plus. Les principaux sucres conduisant à la formation d'acrylamide sont le glucose et le fructose.

D'après Mariotti et al., les méthodes actuellement utilisées pour prévenir et diminuer la formation d'acrylamide dans les produits agroalimentaires consistent, par exemple, à modifier la température ou la concentration en ions divalents tels le Ca 2+ , à incuber par exemple, les chips dans l'eau froide pour qu'elles perdent leurs sucres, ou à acidifier le milieu (acide citrique). Néanmoins, ces techniques sont coûteuses et contraignantes, et entraînent des pertes de valeur nutritive et une modification du goût liée à la modification de la concentration en ions Ca 2+ et à l'acidification.

D'autres approches consistent à diminuer les précurseurs de l'acrylamide, à savoir les sucres réducteurs (glucose et fructose à 95%), et l'asparagine. Afin d'éliminer les sucres et/ou l'asparagine avant le processus de cuisson, des microorganismes pouvant assimiler des sucres libres sont utilisés dans les procédés de fabrication (levures pour les pâtes à pain). De tels microorganismes sont par exemples des levures de la famille Saccharomyces ou des bactéries de la famille Lactobacillus pouvant réduire la formation d'acrylamide, entre 24% pour les chips et 75% pour les céréales (Mariotti et al. 201 1 ).

Afin de diminuer la concentration du précurseur asparagine, des méthodes utilisant l'asparaginase, qui transforme l'asparagine en aspartate et ammonium (NIV), ont été mises au point. Le traitement à l'asparaginase est réalisé de façon à diminuer la concentration d'asparagine avant l'étape de chauffage où se forme l'acrylamide, et permet une réduction de la formation d'acrylamide pouvant atteindre jusqu'à 95%. Actuellement, cette approche apparaît être la plus utilisée, notamment à travers l'utilisation de l'asparaginase de Novozyme, l'Acrylaway®, qui, selon une étude d'Eurofins (2008), permet de réduire la teneur en acrylamide de 50% à 90% selon le produit.

Néanmoins, ces méthodes requièrent la mise en œuvre d'étapes supplémentaires préalablement à l'étape de chauffage et modifient les qualités organoleptiques et les propriétés nutritionnelles des aliments traités. Par exemple, l'utilisation d 'asparaginase peut se révéler difficile pour traiter des aliments contenant une quantité très élevée d'asparagine (produit de pomme de terre brut). De plus, l'utilisation d 'asparaginase diminue l'apport nutritionnel en asparagine, qui est connue pour ses propriétés bénéfiques dans le développement du cerveau (Ruzzo et al. 2013). La diminution de l'apport nutritionel en asparagine modifie l'expression de nombreuses enzymes dont l'asparagine synthétase (synthèse de l'asparagine), l'ornithine decarboxylase (synthèse de la putrescine), et stimule l'expression du régulateur de transcription CHOP impliqué dans le stress du reticulum endoplasmique appelé « unfolded protein response », dû à l'accumulation de protéines mal repliées (Fafournoux et al. 2000 ; Chaveroux et al. 2009).

En conséquence, il existe un réel besoin de développer de nouvelles méthodes pouvant être mises en œuvre facilement, ayant un coût réduit et permettant de prévenir et/ou de diminuer la formation d'acrylamide dans les produits alimentaires, tout en conservant toutes les propriétés organoleptiques et nutritionnelles des aliments.

Ainsi, les inventeurs ont mis en évidence une peptidase thermostable issue d'une bactérie thermophile, la peptidase Pfpl (SEQ ID NO : 1 ;

MKILFLSANEFEDVELIYPYHRLKEEGHEVYIASFEKGVITGKHGYSVKVDLTFDEV NPDEFDALVLPGGRAP ERVRLNEKAVEIARKMFTEGKPVATICHGPQILISAGVLKGRKGTSYIGIRDDMINAGVE WIDREVWDGNW VSSRH PG DLYAWMREFVKLLK) , de l'archée P rococcus furiosus (archée remplaçant l'ancienne dénomination archéobactérie), présentant une activité peptidase faible, mais qui, de manière surprenante, possède une activité qui permet de prévenir ou de diminuer la formation d'acrylamide.

Par « peptidase thermostable », on entend toutes peptidases ou protéases ou enzymes protéolytiques très stables à la chaleur et capables de briser les liaisons peptidiques des peptides ou des protéines, par coupure protéolytique ou protéolyse.

La présente invention a donc pour objet l'utilisation d'une peptidase thermostable issue d'une bactérie thermophile, de préférence d'une archée thermophile ou hyperthermophile, dans la prévention et/ou la diminution de la formation d'acrylamide lors de la mise en œuvre d'un procédé de préparation de produit alimentaire comprenant au moins une étape de traitement thermique comprise entre 60 et 130° C, de préférence entre 70° C et 120° C, de préférence encore entre 90 et 1 10° C.

Par « bactérie thermophile », on entend tout microorganisme unicellulaire procaryote appartenant au règne des bactéries et qui a besoin d'une température élevée pour vivre.

Par « archée thermophile » ou « archéobactéries » ou « archée hyperthermophile », on entend tout microorganisme unicellulaire procaryote appartenant au règne des archées et qui a besoin d'une température élevée pour vivre, 60-80° C pour les thermophiles, et plus de 80° C pour les hyperthermophiles (Frock and Kelly, 2012). Un objet de la présente invention est l'utilisation d'une peptidase thermostable issue d'une bactérie thermophile, de préférence d'une archée thermophile ou hyperthermophile, dans la prévention et/ou la diminution de la formation d'acrylamide lors de la mise en œuvre d'un procédé de préparation de produit alimentaire comprenant au moins une étape de traitement thermique comprise entre 60 et 130°C, de préférence entre 70 et 120°C, de préférence encore entre 90 et 110°C, caractérisé en ce que ledit produit alimentaire issu de ladite étape de traitement thermique présente une concentration en acrylamide significativement réduite par rapport à un produit de référence soumis à ladite étape thermique en l'absence de ladite peptidase.

Par « significativement réduite », on entend une diminution de la concentration en acrylamide d'environ 20 à 80%, de préférence de 40 à 70%, préférentiellement de 50 à 60%, par rapport à un même procédé de préparation de produit alimentaire de référence réalisé en l'absence de ladite peptidase thermostable selon l'invention.

La présente invention à également pour objet un procédé de préparation d'un produit alimentaire comprenant les étapes suivantes :

la mise en contact dudit produit alimentaire avec une peptidase thermostable issue de bactéries thermophiles, de préférence d 'archée thermophile ou hyperthermophile;

porter ledit produit alimentaire à une température comprise entre 60 et 130°C, de préférence entre 70 et 120°C, préférentiellement entre 90 et 110° C ; et

obtenir ledit produit alimentaire dans lequel la formation d'acrylamide est significativement réduite.

Un autre objet de la présente invention est l'utilisation d'une peptidase thermostable issue d'une bactérie thermophile, de préférence d'une archée thermophile ou hyperthermophile, dans la prévention et/ou la diminution de la formation d'acrylamide lors de la mise en œuvre d'un procédé de préparation de produit alimentaire comprenant au moins une étape de traitement thermique comprise entre 60 et 130°C, de préférence entre 70 et 120°C, de préférence encore entre 90 et 110°C.

Avantageusement, l'utilisation d'une peptidase thermostable selon l'invention est caractérisée en ce que ladite peptidase thermostable issue d'une bactérie thermophile, de préférence une archée thermophile ou hyperthermophile, est choisie parmi Pfpl et ses homologues ou orthologues, de préférence ladite peptidase est Pfpl. L'extension de l'activité thermostable de Pfpl à des températures supérieures à 100° C pourra être réalisée par ingénierie protéique, ou plus simplement par immobilisation sur un support, par piégeage dans un réseau ou une microcapsule (Katchaslki-Katzir, 1993 ; Woodley, 2013). Selon un mode de réalisation préféré, la peptidase thermostable selon l'invention est couplée de manière covalente à un matrice de type glyoxyl agarose (Mateo, 2010).

Préférentiellement, l'utilisation d'une peptidase thermostable selon l'invention est caractérisée en ce que ladite peptidase est présente à une concentration comprise entre 0,05 et 2 μΜ, de préférence entre 0,07 et 1 ,5 μΜ, de préférence encore 0,9 et 1 ,2 μΜ, préférentiellement 1 μΜ.

Selon un mode de réalisation préféré, l'utilisation d'une peptidase thermostable selon l'invention est caractérisée en ce que ledit produit alimentaire est sélectionné parmi les pâtes à pain ou à pâtisserie, les cafés solubles, les jus de fruits industriels, les laits condensés ou en poudre, les aliments pour bébés, produits frits à base de pomme de terre, préférentiellement les cafés solubles, les jus de fruits industriels, les laits condensés ou en poudre, les aliments pour bébés, plus préférentiellement les aliments pour bébés.

La présente invention a également pour objet un procédé de préparation d'un produit alimentaire comprenant les étapes suivantes :

- la mise en contact dudit produit alimentaire avec une peptidase thermostable issue de bactéries thermophiles, de préférence archée thermophile ou hyperthermophile; et

- porter ledit produit alimentaire à une température comprise entre 60 et 130° C, de préférence entre 70 et 120° C, préférentiellement 90 et 1 10° C

- obtenir ledit produit alimentaire dans lequel la formation d'acrylamide est significativement réduite.

Avantageusement, le procédé de préparation d'un produit alimentaire selon l'invention est caractérisé en ce que ladite peptidase thermostable issue de bactéries thermophiles, préférentiellement archée thermophile ou hyperthermophile, est choisie parmi Pfpl et ses homologues, de préférence Pfpl. Selon un mode de réalisation préféré, le procédé de préparation d'un produit alimentaire selon l'invention est caractérisé en ce que lesdits homologues de Pfpl en provenance d'archées présentent une similarité de leurs séquences protéiques de 90%, de préférence 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98% ou 99%, de préférence encore de 98 ou 99%, sur l'ensemble de la séquence Pfpl.

Par « similarité » on entend d'une part un nombre d'acide aminés identiques entre les deux séquences et d'autre part un nombre d'acides aminés similaires sur le plan physico-chimique, c'est-à-dire que sont similaire deux acides aminés très proches comme par exemple la Lysine (K) et l'Arginine (R).

Préférentiellement, lesdits homologues de Pfpl en provenance d'archées présentent la séquence ICHGP ou VCHGP, ou une séquence similaire, au niveau de leur site actif. Les Pfpl de bactéries thermophiles, telles Aquifex aeolicus présentent des similarités de l'ordre de 60% avec Pfpl de Pyrococcus furiosus (SEQ ID NO : 2) MRKVLIFLEELVEDVEFIYPYLRFKEEGFEWSAAPKLGEYKGKKGMTFRPDKTIKDVYHQ EFDCVFIPGGYA PDRLRRYPEVLH IVKKHYDSG KLVCAVCHG PWVLI SAKWKG KKVTG FFAI KDDLI NAG AN YTG KPVEVDG NLITATDPKSMLEMMKVIISRLK mais présentent une similarité de séquence supérieure (en l'occurrence 100%) au niveau des acides aminés (séquence VCHGP) autour de la cystéine du site actif.

Selon un mode de réalisation préféré, le procédé de préparation d'un produit alimentaire selon l'invention est caractérisé en ce que lesdits homologues de Pfpl de la bactérie Aquifex aeolicus présentent une similarité de leurs séquences protéiques de 90%, de préférence 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98% ou 99%, de préférence encore de 98 ou 99%, sur l'ensemble de la séquence Pfpl de la bactérie Aquifex aeolicus.

Préférentiellement, le procédé de préparation d'un produit alimentaire selon l'invention est caractérisé en ce que ladite peptidase est présente à une concentration comprise entre 0,05 et 2 μΜ, de préférence entre 0,07 et 1 ,5 μΜ, de préférence encore 0,9 et 1 ,2 μΜ, préférentiellement 1 μΜ.

Préférentiellement, le procédé de préparation d'un produit alimentaire selon l'invention, est caractérisé en ce que ledit produit alimentaire est sélectionné parmi les pâtes à pain ou à pâtisserie, les cafés solubles, les jus de fruits industriels, les laits condensés ou en poudre, les aliments pour bébés, préférentiellement les cafés solubles, les jus de fruits industriels, les laits condensés ou en poudre, les aliments pour bébés, plus préférentiellement les aliments pour bébés.

Selon un mode de réalisation préféré, le procédé de préparation d'un produit alimentaire selon l'invention comprend les étapes suivantes :

- la mise en contact dudit produit alimentaire avec une peptidase thermostable issue de bactéries thermophiles, de préférence d'archées thermophiles ou hyperthermophiles, de préférence avec Pfpl; et

- porter ledit produit alimentaire à une température comprise entre 60 et 130°C, de préférence entre 70° C et 120° C, préférentiellement 90 et 110° C,

caractérisé en ce que ledit produit alimentaire issu de l'étape thermique présente une concentration en acrylamide significativement réduite par rapport à un produit de référence soumis à ladite étape thermique en l'absence de ladite peptidase.

LEGENDE DES FIGURES

Figure 1. A) Purification de Pfpl par autolyse de l'extrait protéique. 7 μΐ d'extrait protéique de P. furiosus prélevés aux temps indiqués après le début de l'incubation à 98° C ont été déposés sur gel de polyacrylamide-SDS et colorés au Bleu de Coomassie. Pour préparer l'extrait protéique, les archées ont été collectées par centrifugation, puis lavées dans du phosphate de sodium 50 mM (pH 7.5). Après centrifugation, les cellules ont été cassées par sonication à 0°C pendant 3 min (6 x 30 sec, à 30 sec d'intervalle), et les lysats cellulaires ont été centrifugés 30 min à 25,000 x g pour éliminer les débris cellulaires. Les variations de migration de Pfpl, en fonction du temps de traitement à 98°C, seraient dues à des différences de conformation (malgré la présence de SDS), des protéolyses partielles des extrémités N ou C-terminales, ou des déamidations d'asparagines ou de glutamines (Blumentals et al., 1990, Halio et al., 1997). B) Dosage de l'activité peptidase de Pfpl. 1 μΐ de Pfpl (400 μg/ml) a été incubé à 85° C dans 100 μΐ de phosphate de sodium 50 mM (pH 7.0) contenant AAF-amc (0.5 mM), puis la fluorescence de l'amc libéré a été mesurée (°ex=380 nm, °em=440 nm) à différents temps après le début de l'incubation.

Figure 2. Formation d'acrylamide dans un mélange asparagine/glucose. L'asparagine et le glucose (25 mM chaque) ont été incubés à 95° C dans 250 μΐ de phosphate de sodium (100 mM, pH 7,5) contenant 1% de NaHCC en absence ou en présence de 5 μΜ de Pfpl, et des prélèvements de 35 μΐ ont été analysés à différents temps par chromatographie sur colonne Hypercarb équilibrée en HCOOH 0,2% à 22° C. A) Chromatogrammes obtenus après 90 min d'incubation. B) Formation d'acrylamide à différents temps, en absence (colonnes grises) ou en présence (colonnes noires) de Pfpl. Figure 3. Formation d'acrylamide dans un mélange asparagine/fructose. L'asparagine et le fructose (25 mM chaque) ont été incubés à 95° C dans 250 μΐ de phosphate de sodium (100 mM, pH 7.5) contenant 1 % de NaHCC en absence ou en présence de 5 μΜ de Pfpl, et des prélèvements ont été analysés à différents temps par chromatographie sur colonne Hypercarb équilibrée en HCOOH 0.2% à 22° C. A) Chromatogramme obtenus après 80 min d'incubation (35 μΐ ont été chargés sur la colonne). B) Chromatogramme obtenus après 130 min d'incubation (7 μΐ ont été chargés sur la colonne). C) Formation d'acrylamide à différents temps, en absence (colonnes grises) ou en présence (colonnes noires) de Pfpl.

Figure 4. L'asparagine et le fructose (25 mM chaque) ont été incubés 130 min à 95° C dans 200 μΐ de phosphate de sodium (100 mM, pH 7,5) contenant 1 % de NaHCÛ3, en absence ou en présence de Pfpl à différentes concentrations, et des prélèvements de 100 μΐ ont été analysés par chromatographie sur colonne Hypercarb équilibrée en HCOOH 0,2% à 22° C. Le rapport de surface des pics d'acrylamide en présence ou absence de Pfpl permet le calcul du pourcentage de diminution d'acrylamide en présence de Pfpl.

Figure 5. Prévention de la glycation des protéines du lait par Pfpl. 10 μΐ de lait écrémé (représentant 40 μg de protéines) contenant 40 mM de phosphate de sodium, avec 5mM de méthylglyoxal, ont été incubés pendant 30 min à 90° C en absence ou en présence de 3 μΜ de Pfpl. Les échantillons ont migré dans un gel de polyacrylamide-SDS, ont été transférés sur membrane de nitrocellulose, et leur glycation a été analysée par immunodetection avec des anticorps anti-AGEs selon le protocole du fabricant (Cell Biolabs lnc-STA817).

EXEMPLES

Exemple 1. Purification de Pfpl de Pyrococcus furiosus

Pfpl a été purifié à partir d'un extrait protéique de l'archée Pyrococcus furiosus, par traitement de l'extrait à 98 ° C pendant 6 heures dans un tampon 50 mM phosphate de sodium pH 7,5, 1 mM dithiothreitol, 1 % SDS. Après 6 h, la plus grande part des protéines de l'extrait était hydrolysée (par autoprotéolyse), et deux bandes majeures (correspondant à des poids moléculaires de 66 et 132 kDa) ont été détectées par coloration au Bleu de Coomassie d'un gel de polyacrylamide-SDS (Fig. 1A). Comme indiqué par Halio et al. , 1997, qui ont analysé l'extrémité N-terminale des protéines correspondant à ces bandes, elles représentent les formes trimériques et hexamériques de Pfpl (dont le poids moléculaire du monomère est de 18,8 kDa).

Pfpl préparé par cette méthode est extrêmement résistant à la thermodénaturation (par rapport à Pfpl préparé par purifications sur colonnes de chromatographie (Halio et al. , 1997)), puisqu'il présente son activité optimale à 105°C (Blumenthals et al., 1990), et reste actif plusieurs dizaines d'heures à 90° C (Halio et al. , 1997). Pfpl a été séparé des composés de petit poids moléculaire par chromatographie sur colonne de Biogel P2 (Biorad) en tampon 50 mM phosphate de sodium pH 7,5, équilibré en atmosphère d'azote. Finalement, la préparation a été traitée par une résine de Biobeads SM2 (Biorad) pendant 2 heures pour éliminer le SDS, la protéine a été concentrée par ultrafiltration sur Centricon 30 (Millipore), et Pfpl a été conservé congelé à - 80° C.

Exemple 2. Activité peptidase de Pfpl

L'activité peptidase Pfpl a été mesurée en suivant la dégradation du peptide AAF-amc (N- succinyl-Ala-Ala-Phe-7-amido-4-méthylcoumarine) qui libère de l'amc fluorescent (Halio et al. , 1997). La préparation de Pfpl dégrade AAF-amc (0.5 mM dans du phosphate de sodium 50 mM pH 7,0 à 85° C) avec un kcat de 0.04 s 1 (Fig. 1 B). Cette valeur n'a pu être comparée aux résultats de Halio et al. , 1997 (donnés sans précision d'activité spécifique) mais cette activité est similaire à celle reportée (0,01 s 1 ) pour Phpl, la protéine homologue de Pyrococcus horikoshii (Phpl présente 90% d'identité de séquence avec Pfpl) avec son meilleur substrat, l'arginine-amc (Zhan, 2014). Pfpl n'a pas d'activité peptidase/protéase significative sur des peptides/ protéines de plus de 24 acides aminés (Chang, 2003).

Exemple 3. Prévention de la formation d'acrylamide par Pfpl dans un mélange asparagine/glucose

La formation d'acrylamide dans la nourriture résulte principalement de la réaction de l'acide aminé libre asparagine, avec le glucose et fructose ainsi que leurs produits de dégradation (Amrein et al. , 2006). Les autres acides aminés ne contribuent pas significativement à la formation d'acrylamide, ni les autres sucres tels le maltose ou le sucrose.

L'asparagine et le glucose (25 mM chacun) ont été incubés en présence de Pfpl (5 μΜ) dans du phosphate de sodium 100 mM pH 7,5 contenant 1 % N H4HCO3 pendant 0-130 min à 95° C, et la formation d 'acrylamide a été mesurée par analyse du mélange réactionnel sur colonne Hypercarb (« hydrophilic interaction liquid chromatography ») de 100 mm x 4.6 mm, 5 μιη de taille des particules (Thermoscientific), équilibrée en HCOOH 0.2% dans l'eau. La formation d 'acrylamide dans les mélanges glucose/asparagine a été réduite de 50-65% par Pfpl (Fig. 2A, 2B).

Exemple 4. Prévention de la formation d'acrylamide par Pfpl dans un mélange aspa ragi n e/f r u ctose L'asparagine et le fructose (25 mM chacun) ont été incubés en présence de Pfpl (5 μΜ) dans du phosphate de sodium 100 mM pH 7,5 contenant 1 % N H4HCO3 pendant 0-130 min à 95° C, et la formation d'acrylamide a été mesurée par analyse du mélange réactionnel sur colonne Hypercarb équilibrée en HCOOH 0,2% dans l'eau. La formation d'acrylamide dans les mélanges fructose/asparagine a été réduite de 55-75% par Pfpl (Fig. 3A-C).

Exemple 5. Concentrations de Pfpl nécessaires pour la prévention de formation d'acrylamide dans un mélange asparagine/fructose.

L'asparagine et le fructose ont été incubés en absence ou en présence de Pfpl à différentes concentrations pendant 130 min à 95° C en phosphate de sodium 100 mM (pH 7,5), 1% NH4HCO3, et la formation d'acrylamide a été mesurée par analyse des mélanges sur une colonne Hypercarb HILIC. Des concentrations de Pfpl comprises entre 0,1 et 1 μΜ préviennent la formation d'acrylamide dans les mélanges asparagine/fructose (Fig. 4)). Exemple 6. Prévention de la glycation des protéines du lait par la déglycase PfPI.

Pour vérifier que Pfpl est actif sur un aliment complexe tel que le lait, du lait écrémé (Régilait™) contenant 40 mM de phosphate de sodium pH 7.0 a été incubé avec 5 mM de méthylglyoxal à 90° C pendant 30 min, en absence ou présence de 3 μΜ de Pfpl. L'analyse de la glycation des protéines du lait par immunodetection avec des anticorps anti-AGEs (anti- advanced glycation endproducts, anticorps Cell Biolabs lnc-STA817) montre que la fraction protéique HMW2 (High Molecular Weigth fraction 2), et une fraction migrant comme la caséine, subissent une glycation que prévient intégralement la déglycase Pfpl (Figure 5). REFERENCES

Amrein TM, Andres L, Manzardo, G.G., Amado R. J. Agric. Food Chem. 54, 10253- 10261 (2006)

Blumenthals, I.I., Robinson, A.S., Kelly, R.M. Appl. Environ. Microbiol.56, 1992- 1998 (1990)

Chang L. Ph.D. thesis North Carolina State University, Raleigh, NC (2003)

Chaveroux et al. Mol. Cell Biol.29, 6515-6526 (2009)

Erkekoglu P., BaydarT. Nutrition Res. Rev.23, 323-333 (2010)

Fafournoux, P., Bruhat, A., Jousse, C. Biochem. J.351, 1-12

Frock, A.D., Kelly, R.M. Curr. Opin. Chem. Eng.12, 363-372 (2012)

Halio, S.B., Bauer, M.W., Mukund, S., Adams, M., Kelly, R.M. Appl. Environ. Micr.63, 289-295 (1997)

Katchalski-Katzir, E. Trends Biotech.11, 471-478 (1993)

Mariotti, S., Pedreschi, F., Carrasco, J.A., Granby, K. Récent Pat. Food Nutr. Agric. 3, 158-171 (2011)

Mateo, C. et al Biomacromolecules 11, 3112-3117 (2010)

Mottram, D.S., Wedzicha, B.L., Dodson, A.T. Nature 419, 448-449 (2002)

Ruzzo E.K. et al. Neuron 80, 429-441 (2013)

Stadler, R.H. et al Nature 419, 449-450 (2002)

Tareke E., Rydberg P., Karlsson P., Eriksson S, Tôrnqvist M. J. Agric. Food Chem.50, 4998-5006 (2002)

Tessier, F.J., Birlouez-Aragon I. Ami no acids 42, 1119-1131 (2012)

Woodley, J.M. Curr. Opin. Chem. Biol. 17, 310-316 (2013)

Yuan, Y., Zhao, G., Chen, F., Liu, J., Wu, J., Hu, X. Food Chem. 108, 885-890

(2008)

Zhan, D., Bai, A., Yu, L, Han, W., Feng, Y. Plos One 9, e103902