Login| Sign Up| Help| Contact|

Patent Searching and Data


Title:
YEAST STRAIN AND MICROBIAL METHOD FOR PRODUCTION OF PENTACYCLIC TRITERPENES AND/OR TRITERPENOIDS
Document Type and Number:
WIPO Patent Application WO/2015/121168
Kind Code:
A1
Abstract:
The invention relates to a yeast strain and to a method for microbial production of pentacyclic triterpenes and/or triterpenoids in yeast. More particularly, the invention relates to a modified yeast strain for production of pentacyclic triterpenoids comprising at least one copy of a gene for encoding an oxidosqualene cyclase, at least one copy of a gene for encoding an NADPH-cytochrome P450 reductase and/or at least one copy of a gene for encoding a cytochrome P450 monooxygenase.

Inventors:
LANG, Christine (Friedbergstr. 22, Berlin, 14057, DE)
LEWANDOWSKI, Anna (Erich-Weinert-Str. 130, Berlin, 10409, DE)
Application Number:
EP2015/052516
Publication Date:
August 20, 2015
Filing Date:
February 06, 2015
Export Citation:
Click for automatic bibliography generation   Help
Assignee:
ORGANOBALANCE GMBH (Gustav-Meyer-Allee 25, Berlin, 13355, DE)
International Classes:
C07H15/256; C12N1/16; C12N15/09
Domestic Patent References:
WO2013167751A12013-11-14
Other References:
ZHANG H ET AL: "Oxidosqualene cyclases from cell suspension cultures of betula platyphylla var. japonica: molecular evolution of oxidosqualene cyclases in higher plants", BIOLOGICAL & PHARMACEUTICAL BULLETIN (OF JAPAN), PHARMACEUTICAL SOCIETY OF JAPAN, TOKYO, JP, vol. 26, no. 5, 1 January 2003 (2003-01-01), pages 642 - 650, XP002980653, ISSN: 0918-6158, DOI: 10.1248/BPB.26.642
SHIBUYA M ET AL: "Two branches of the lupeol synthase gene in the molecular evolution of plant oxidosqualene cyclases", EUROPEAN JOURNAL OF BIOCHEMISTRY, WILEY-BLACKWELL PUBLISHING LTD, GB, vol. 266, no. 1, 1 November 1999 (1999-11-01), pages 302 - 307, XP002191880, ISSN: 0014-2956, DOI: 10.1046/J.1432-1327.1999.00875.X
SEKI H ET AL: "Licorice beta-amyrin 11-oxidase, a cytochrome P450 with a key role in the biosynthesis of the triterpene sweetener glycyrrhizin", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, NATIONAL ACADEMY OF SCIENCES, US, vol. 105, no. 37, 16 September 2008 (2008-09-16), pages 14204 - 14209, XP008131547, ISSN: 0027-8424, [retrieved on 20080908], DOI: 10.1073/PNAS.0803876105
FUKUSHIMA ERY O ET AL: "CYP716A Subfamily Members are Multifunctional Oxidases in Triterpenoid Biosynthesis", PLANT AND CELL PHYSIOLOGY, vol. 52, no. 12, December 2011 (2011-12-01), pages 2050 - 2061, XP002738814
TESSA MOSES ET AL: "Bioengineering of plant (tri)terpenoids: from metabolic engineering of plants to synthetic biology in vivo and in vitro", NEW PHYTOLOGIST, 14 May 2013 (2013-05-14), pages 1 - 17, XP055074828, ISSN: 0028-646X, DOI: 10.1111/nph.12325
Attorney, Agent or Firm:
HERTIN & PARTNER (Kurfürstendamm 54-55, Berlin, 10707, DE)
Download PDF:
Claims:
Patentansprüche

1. Modifizierter Hefestamm zur Produktion von pentazyklischen Triterpenoiden, umfassend i. mindestens eine Kopie eines Gens zur Kodierung einer Oxidosqualenzyklase, wobei das Gen eine Sequenz umfasst, ausgewählt aus der Gruppe umfassend Nukleinsäuren gemäß Accession Number AB05551 1 (SEQ ID No 1 ), AB025343 (SEQ ID No 2), AB663343 (SEQ ID No 3), NMJ 79572 (SEQ ID No 4), AB181245 (SEQ ID No 5), DQ268869 (SEQ ID No 6), AB025345 (SEQ ID No 7), AB1 16228 (SEQ ID No 8), JQ087376 (SEQ ID No 9), HM623871 (SEQ ID No 10), AB289586 (SEQ ID No 1 1 ), AB055512 (SEQ ID No 12) und Nukleinsäuresequenzvarianten mit mindestens 70% Sequenzidentität zu SEQ ID No 1 bis 12,

oder wobei das Gen eine Sequenz umfasst, die für eine Aminosäuresequenz gemäß SEQ ID No 54 bis 65, oder für eine Aminosäuresequenzvariante mit mindestens 85% Sequenzidentität zu SEQ ID No 54 bis 65, kodiert; und/oder ii. mindestens eine Kopie eines Gens zur Kodierung einer NADPH-Cytochrom P450

Reduktase, wobei das Gen eine Sequenz umfasst, ausgewählt aus der Gruppe umfassend Nukleinsäuren gemäß Accession Number AB433810 (SEQ ID No 13), X66016 (SEQ ID No 14), X69791 (SEQ ID No 15), XM_003602850 (SEQ ID No 16), NM_001 179172 (SEQ ID No 17), X66017 (SEQ ID No 18), JN594507 (SEQ ID No 19), DQ984181 (SEQ ID No 20), DQ318192 (SEQ ID No 21 ), AF302496 (SEQ ID No 22), AF302497 (SEQ ID No 23), AF302498 (SEQ ID No 24), L07843 (SEQ ID No 25), AF024635 (SEQ ID No 26), AF024634 (SEQ ID No 27), FJ719368 (SEQ ID No 28), FJ719369 (SEQ ID No 29) und Nukleinsäuresequenzvarianten mit mindestens 70% Sequenzidentität zu SEQ ID No 13 bis 29,

oder wobei das Gen eine Sequenz umfasst, die für eine Aminosäuresequenz gemäß SEQ ID No 66 bis 82, oder für eine Aminosäuresequenzvariante mit mindestens 85% Sequenzidentität zu SEQ ID No 66 bis 82, kodiert; und/oder iii. mindestens eine Kopie eines Gens zur Kodierung einer Cytochrom P450

Monooxygenase, wobei das Gen eine Sequenz umfasst, ausgewählt aus der Gruppe umfassend Nukleinsäuren gemäß Accession Number AB619802 (SEQ ID No 30), AB619803 (SEQ ID No 31 ), DQ335781 (SEQ ID No 32), JN565975 (SEQ ID No 33), XM_002331391 (SEQ ID No 34), XM_003525274 (SEQ ID No 35), JF803813 (SEQ ID No 36), XM_004139039 (SEQ ID No 37), GU997666 (SEQ ID No 38), JX036032 (SEQ ID No 39), XM_002522891 (SEQ ID No 40), AM457725 (SEQ ID No 41 ), XM_002265988 (SEQ ID No 42), XM_002527956 (SEQ ID No 43), BT147421 (SEQ ID No 44),

XM_003530477 (SEQ ID No 45), BT096613 (SEQ ID No 46), XM_002309021 (SEQ ID No 47), BT051785 (SEQ ID No 48), XM_002513137 (SEQ ID No 49), XM_002264607 (SEQ ID No 50), XM_002324633 (SEQ ID No 51 ), XM_003531801 (SEQ ID No 52), XM_002280933 (SEQ ID No 53) und Nukleinsäuresequenzvarianten mit mindestens 70% Sequenzidentität zu SEQ ID No 30 bis 53,

oder wobei das Gen eine Sequenz umfasst, die für eine Aminosäuresequenz gemäß SEQ ID No 83 bis 105, oder für eine Aminosäuresequenzvariante mit mindestens 85% Sequenzidentität zu SEQ ID No 83 bis 105, kodiert.

2. Hefestamm nach Anspruch 1 , wobei der Stamm mindestens eine Kopie eines Gens zur Kodierung einer Oxidosqualenzyklase gemäß i. umfasst, und wobei eine Kopie eines Gens zur Kodierung einer NADPH-Cytochrom P450 Reduktase gemäß ii. oder eine Kopie eines Gens zur Kodierung einer Cytochrom P450 IVIonooxygenase gemäß iii. nicht vorhanden sind.

3. Hefestamm nach Anspruch 1 , wobei der Stamm mindestens eine Kopie eines Gens zur Kodierung einer Oxidosqualenzyklase gemäß i. und mindestens eine Kopie eines Gens zur Kodierung einer Cytochrom P450 IVIonooxygenase gemäß iii. umfasst, und wobei eine Kopie eines Gens zur Kodierung einer NADPH-Cytochrom P450 Reduktase gemäß ii nicht vorhanden ist;

4. Hefestamm nach Anspruch 1 , wobei der Stamm eine Kombination aus mindestens eine

Kopie eines Gens zur Kodierung einer Oxidosqualenzyklase gemäß i., mindestens eine Kopie eines Gens zur Kodierung einer NADPH-Cytochrom P450 Reduktase gemäß ii. und mindestens eine Kopie eines Gens zur Kodierung einer Cytochrom P450 IVIonooxygenase gemäß iii umfasst.

5. Hefestamm nach mindestens einem der vorhergehenden Ansprüche, wobei der Stamm

mindestens eine intrazelluläre Konzentration eines pentazyklischen Triterpenoids von 1 mg pro Gramm Biotrockensubstanz aufweist.

6. Hefestamm nach mindestens einem der vorhergehenden Ansprüche, wobei der Stamm

mindestens eine intrazelluläre Konzentration eines pentazyklischen Triterpenoids von 2 mg pro Gramm Biotrockensubstanz aufweist.

7. Hefestamm nach mindestens einem der vorhergehenden Ansprüche, wobei der Stamm eine intrazelluläre Konzentration an Lupeol von bevorzugt mehr als 5 mg pro Gramm

Biotrockensubstanz aufweist.

8. Hefestamm nach Anspruch 3, wobei der Stamm eine Genkombination gemäß einer der Tabellen 1 1 bis 14 umfasst.

9. Hefestamm nach mindestens einem der vorhergehenden Ansprüche, wobei der Stamm folgende Kombination umfasst: AB025343 (OEW), XM_003602850 (MTR) und AB619802 (CYP716A15).

10. Hefestamm nach mindestens einem der vorhergehenden Ansprüche, wobei der Stamm folgende Kombination umfasst: AB025343 (OEW), XM_003602850 (MTR) und AB619803 (CYP716A17).

1 1. Hefestamm nach mindestens einem der vorhergehenden Ansprüche, wobei der Stamm folgende Kombination umfasst: AB025343 (OEW), XM_003602850 (MTR) und

XM_002331391 (CYP716A9).

12. Hefestamm nach mindestens einem der vorhergehenden Ansprüche, wobei der Stamm folgende Kombination umfasst: AB025343 (OEW), X69791 (CrCPR) und AB619802 (CYP716A15).

13. Hefestamm nach mindestens einem der vorhergehenden Ansprüche, wobei der Stamm folgende Kombination umfasst: AB025343 (OEW), X69791 (CrCPR) und XM_003525274 (Cytochrome P450 716B2-like).

14. Hefestamm nach mindestens einem der vorhergehenden Ansprüche, wobei der Stamm folgende Kombination umfasst: AB025343 (OEW), X69791 (CrCPR) und XM_002331391 (CYP716A9).

15. Hefestamm nach mindestens einem der vorhergehenden Ansprüche, wobei der Stamm folgende Kombination umfasst: AB025343 (OEW), X69791 (CrCPR) und AB619803 (CYP716A17).

16. Hefestamm nach mindestens einem der vorhergehenden Ansprüche, wobei der Stamm folgende Kombination umfasst: AB025343 (OEW), AB433810 (LjCPRI ) und AB619802 (CYP716A15).

17. Hefestamm nach mindestens einem der vorhergehenden Ansprüche, wobei der Stamm folgende Kombination umfasst: AB025343 (OEW), AB433810 (LjCPRI ) und XM_004139039 (cytochrome P450 716B1-like).

18. Hefestamm nach mindestens einem der vorhergehenden Ansprüche, wobei der Stamm folgende Kombination umfasst: AB025343 (OEW), X66016 (ATR1 ) und JN565975

(CYP716AL1 ).

19. Hefestamm nach mindestens einem der vorhergehenden Ansprüche, wobei der Stamm eine der folgenden Kombinationen nicht umfasst:

- AB663343 (GuLUPI ), AB433810 (LjCPRI ) und DQ335781 (CYP716A12);

- AB663343 (GuLUPI ), AB433810 (LjCPRI ) und AB619802 (CYP716A15);

- NM_179572 (AtLUPI ), X66016 (ATR1 ) und JN565975 (CYP716AL1 ).

20. Hefestamm nach mindestens einem der vorhergehenden Ansprüche, wobei dieser Lupeol produziert.

21. Hefestamm nach mindestens einem der vorhergehenden Ansprüche, wobei dieser Betulin produziert.

22. Hefestamm nach mindestens einem der vorhergehenden Ansprüche, wobei dieser

Betulinaldehyd produziert.

23. Hefestamm nach mindestens einem der vorhergehenden Ansprüche, wobei dieser

Betuli nsäure produziert.

24. Hefestamm nach mindestens einem der vorhergehenden Ansprüche, wobei der Hefestamm eine tHMG1 Expressionskassette umfasst.

25. Hefestamm nach mindestens einem der vorhergehenden Ansprüche, wobei es sich um Saccharomyces cerevisiae handelt.

26. Hefestamm nach mindestens einem der vorhergehenden Ansprüche, wobei der Stamm ein Saccharomyces cerevisiae CEN.PK ist.

27. Hefestamm nach mindestens einem der vorhergehenden Ansprüche, wobei der Stamm ein CEN.PK1 1 1-61A Stamm ist.

28. Hefestamm nach mindestens einem der vorhergehenden Ansprüche, wobei der Stamm ein AH22tH3ura8 Stamm ist.

29. Verfahren zur Herstellung eines modifizierten Hefestamms gemäß mindestens einem der vorhergehenden Ansprüche umfassend die folgenden Schritte: a) Bereitstellung eines Saccharomyces cerevisiae Stamms, b) Transformation mit einem Vektor umfassend ein Gen zur Kodierung einer

Oxidosqualenzyklase, wobei das Gen eine Sequenz umfasst, ausgewählt aus der Gruppe umfassend Nukleinsäuren gemäß Accession Number AB05551 1 , AB025343, AB663343, NMJ 79572, AB181245, DQ268869, AB025345, AB1 16228, JQ087376, HM623871 , AB289586, AB055512, c) Transformation eines Vektors umfassend ein Gen zur Kodierung einer NADPH- Cytochrom P450 Reduktase wobei das Gen eine Sequenz umfasst, ausgewählt aus der Gruppe umfassend Nukleinsäuren gemäß Accession Number AB433810, X66016, X69791 , XM_003602850, NM_001 179172, X66017, JN594507, DQ984181 , DQ318192, AF302496, AF302497, AF302498, L07843, AF024635, AF024634, FJ719368, FJ719369, und/oder d) Transformation eines Vektors umfassend ein Gen zur Kodierung einer Cytochrom P450 Monooxygenase, wobei das Gen eine Sequenz umfasst, ausgewählt aus der Gruppe umfassend Nukleinsäuren gemäß Accession Number AB619802, AB619803, DQ335781 , JN565975, XM_002331391 , XM_003525274, J F803813, XM_004139039, GU997666, JX036032, XM_002522891 , AM457725, XM_002265988, XM_002527956, BT147421 , XM_003530477, BT096613, XM_002309021 , BT051785, XM_002513137,

XM_002264607. XM_002324633, XM_003531801 , XM_002280933.

30. Verfahren nach dem vorhergehenden Anspruch, zusätzlich umfassend den Schritt der

Transformation mit einem Vektor umfassend das tHMG1-Gen.

31. Verfahren zur Herstellung von Triterpenen und/oder Triterpenoiden, wobei ein modifizierter Hefestamm gemäß mindestens einem der Ansprüche 1 bis 28 für die Produktion verwendet werden.

Description:
HEFE-STAMM UND MIKROBIELLES VERFAHREN ZUR PRODUKTION VON PENT AZYKLISCHEN TRITERPENEN UND/ODER TRITERPENOIDEN

Beschreibung

Die Erfindung betrifft einen Hefe-Stamm und ein Verfahren zur mikrobiellen Produktion von pentazyklischen Triterpenen und/oder Triterpenoiden in Hefe. Insbesondere betrifft die Erfindung einen modifizierten Hefestamm zur Produktion von pentazyklischen Triterpenoiden umfassend mindestens eine Kopie eines Gens zur Kodierung einer Oxidosqualenzyklase, mindestens eine Kopie eines Gens zur Kodierung einer NADPH-Cytochrom P450 Reduktase und/oder mindestens eine Kopie eines Gens zur Kodierung einer Cytochrom P450 Monooxygenase.

Hintergrund zur Erfindung

Terpenoide sind eine Stoffgruppe an Naturstoffen oder verwandten Verbindungen, die sich strukturell vom Isopren ableiten. Von den ähnlichen Terpenen unterscheiden sie sich darin, dass sie funktionelle Gruppen enthalten, während es sich bei Terpenen um reine Kohlenwasserstoffe handelt.

Bei den zyklischen Triterpenen handelt es sich um eine diverse Gruppe von

Sekundärmetaboliten, welche aus dem Stoffwechselweg des Squalen hervorgehen. Sie kommen hauptsächlich in Pflanzen vor und sind aufgrund ihrer biologischen (unter anderem antifungalen, antibakteriellen, antiinflammatorischen, antioxidativen, antiviralen und anti-tumorallen) Aktivitäten von hohem Interesse für die Pharma- und Lebensmittelindustrie. Eine besonders relevante Untergruppe der zyklischen Triterpene stellen die pentazyklischen Triterpene dar. Die

Grundstrukturen der pentazyklischen Triterpene bestehen aus 5-Ring-Systemen mit

unterschiedlichen Substitutionsmustern der Methyl-Gruppen; die Ringe A bis D sind hierbei 6- gliedrig und Ring E ist fünf- oder sechsgliedrig.

Triterpenoide werden heutzutage meist durch aufwendige Extraktionsverfahren aus höheren

Pflanzen gewonnen (WO 2011/074766 A2, WO 201 1/074766 A3R4, Muffler et al., 2011 ). Jedoch kommen sie in dieser Ressource nur in sehr geringen Mengen vor, so dass eine

Kommerzialisierung und Industrialisierung dieser Substanzklasse bisher kaum möglich ist (Madsen et al., 201 1 ; Fukushima et al., 201 1 ).

Des Weiteren ist die chemische Synthese von biologisch aktiven Triterpenen aufgrund der komplexen Strukturen ebenso nicht wirtschaftlich und nachhaltig.

Die mikrobielle Produktion von Triterpenen oder Triterpenoiden ist noch nicht etabliert. Dass die Synthese von pentazyklischen Triterpenoiden in Saccharomyces cerevisiae (S. cerevisiae) nach heterologer Expression entsprechender Gene prinzipiell möglich ist, wurde bereits gezeigt (Moses et al., 2013).

Einige Gene, welche die Synthese von Triterpenen katalysieren, sind bereits bekannt (Fukushima et al. , 201 1 , Philips et al., 2006, Wang et al., 201 1 ). Diese Gene kodieren für Enzyme, welche die Synthese von z.B. Cycloartenol oder Lanosterol (nicht-pentazyklische Triterpene) oder Lupeol oder ß-Amyrin (pentazyklische Triterpen) katalysieren, aber auch entsprechende Folgeprodukte (Huang et al., 2012, Kirby et al., 2008).

Lupeol beziehungsweise α/β-Amyrin stellen die wichtigsten Ausgangssubstanzen für die

Biosynthese einer Vielzahl von pentazyklischen Triterpenen dar. Zu diesen Verbindungen zählen z.B. Betulin-, Ursol-, und Oleanolsäure, welche aufgrund ihrer unter anderem antibakteriellen, antiviralen, antiinflammatorischen und anti-tumoralen Aktivitäten von hohem Interesse für die pharmazeutische sowie Nahrungsmittel-Industrie sind (Fukushima et al., 201 1 ; Saleem et al., 2009; Siddique et al., 201 1 ; Holanda et al., 2008; Melo et al. , 201 1 ; Chintharlapalli et al., 201 1 ; Shanmugam et al., 201 1 , Suzuki et al., 2002).

Aus der CN102433347 ist die Produktion von dem Triterpenoid Lupeol und Betulinsäure in Hefe beschrieben. Aus Fukushima et al., 201 1 sind S. cerevisiae Stämme bekannt, die Oleanolsäure, Ursolsäure beziehungsweise Betulinsäure produzieren. Aus Huang et al., 2012 sind S. cerevisiae Stämme bekannt, die zwischen 0,045 und 0,1 mg/L Oleanolsäure, Ursolsäure beziehungsweise Betulinsäure produzieren. Aus Dai et al., 2013 ist die Synthese des Triterpenoids Protopanaxadiol mit der Überexpression des tHMG1 Gens sowie einer NADPH-Cytochrom P450 Reduktase in S. cerevisiae beschrieben. Um Squalen und 2,3-Oxidosqualen zu erhöhen, wurden folgende Gene überexprimiert: tHGMGI , ERG20, ERG9 und ERG1. In Fukushima et al., 2013 ist die Synthese der pentazyklischen Triterpenoide Soyasapogenol B, Gypsogeninsäure und 4-epi-Hederagenin in S. cerevisiae beschrieben. In Kunii et al., 2012 ist die Oxidation von beta-Amyrin zum 12,13-Epoxid in S. cerevisiae beschrieben. In Seki et al., 2008 ist die Oxidation von beta-Amyrin zum 1 1 -oxo- beta-Amyrin in S. cerevisiae mit einer Ausbeute von 1 ,6 mg/L beschrieben.

Aus Wang et al. 201 1 ist bekannt, dass etwa 50 Oxidosqualenzyklasen aus Pflanze, welche die Zyklisierung von 2,3-Oxidosqualen in unterschiedliche Triterpenalkohole katalysieren, mittels heterologer Genexpression in Hefe kloniert und charakterisiert wurden. Aus Kirby et al., 2008 ist ein S. cerevisiae Stamm bekannt, der eine beta-Amyrin Synthase der Pflanze Artemisia annua exprimiert und 6 mg/L des Triterpenoids beta-Amyrin produziert sowie das tHMG1 Gen exprimiert.

Es ist bekannt, dass die Überexpression der HMG-CoA-Reduktase in Hefe zur Anreicherung des Triterpens Squalen führt (Polakowski et al., 1998). Des Weiteren führen überexprimierte Gene der Ergosterol-Biosynthese zur Akkumulierung von Sterolen in der Hefe Saccharomyces cerevisiae (Veen et al., 2003).

Li et al. 2013 konstruierten S. cerew ' s/ae-Stämme, welche das pentazyklische Triterpenoid Betulinsäure in unterschiedlichen Mengen (0,01-1 ,92 mg L "1 OD -1 ) produzieren. Die erzielten Mengen sind jedoch in keiner Weise ausreichend für eine Produktion im industriellen Maßstab.

Phytochemikalien wie Terpene und Sterole machen derzeit einen hohen Anteil an pflanzlich gewonnenen Wirkstoffen aus. Der jährliche Umsatz beläuft sich auf ca. 12.4 Mrd USD (Raskin et al., 2002). Besonderes großes Interesse gilt dabei der Betulinsäure, welche sich als Inhibitor von Melanom- und anderer Krebszellen erwiesen hat (Pisha et al., 1995; Sunder et al., 2000). Eine ebenso große Rolle spielen einige Derivate der Betulinsäure, welche zurzeit im Mittelpunkt verschiedener klinischer Studien zur Behandlung des HI-Virus stehen. Das große Interesse an der Betulinsäure wird vor allem durch die therapeutische Anwendung von Betulinsäure und Betulinsäure-Derivaten gegen Krebs oder HIV begründet (DE69908397T2, DE19713768B4, DE19713768A1 , DE69634951T2, DE69633398T2). Neben der veralteten und ineffizienten synthetischen Produktion (Ruzicka et al., 1938), erfolgt die Gewinnung der Betulinsaure heutzutage durch Extraktion aus höheren Pflanzen, z.B. aus der Baumrinde von Picramnia pentandra (Ruzicka et al., 1938), Arbutus menziesii (Robinson et al., 1970) oder Ziziphus mauritiana (Pisha et al., 1995) und insbesondere Platanus occidentalis. Dabei werden trotz kontinuierlicher Verbesserung der Extraktionsverfahren große Mengen an organischen Lösungsmitteln verbraucht. In der US2007/0149490A1 ist dazu eines der neuesten Verfahren beschrieben, bei dem die Betulinsaure aus der Rinde der Platane mittels chemischer Extraktion gewonnen wird. Der Druckschrift ist zu entnehmen, dass für die Gewinnung von Betulinsaure hohe Mengen an organischen Lösungsmitteln sowie große Mengen an Energie verbraucht werden.

Weiterhin kommen die pentazyklischen Triterpene und/oder Triterpenoide in pflanzlichen Ressourcen nur in Form von Gemischen vor, so dass die Aufreinigung einzelner Komponenten sehr aufwendig ist.

Zur Abschätzung des zukünftigen We Itj a hres bedarf s an Betulinsaure kann ein Vergleich mit Taxol, welches in der Krebstherapie eingesetzt wird, herangezogen werden. Auch Betulinsaure birgt, neben anderen Anwendungen (antiinflammantorisch, antibakteriell, antivirale), das Potential zur Nutzung in der Krebstherapie. Der Weltjahresbedarf an Taxol liegt derzeit bei ca. 1000 kg (Cameron et al., 2002). Allerdings muss beachtet werden, dass Taxol im Vergleich zur

Betulinsaure in weitaus geringeren Dosen zur Therapie angewendet wird.

Die Nachteile des Standes der Technik liegen somit vor allem darin, dass durch die bisher verfügbaren industriellen Verfahren zur Herstellung von Triterpenen und Triterpenoiden, insbesondere Betulinsaure hohe Mengen an Lösungsmittel und Energie notwendig sind. Es handelt sich außerdem um besonders zeitintensive und teure Herstellungsverfahren. Die beschriebenen Verfahren zur mikrobiellen Produktion erreichen derzeit keine Ausbeute, die einen industriellen Maßstab erlaubt.

Es war daher Aufgabe der Erfindung, einen Stamm und ein Verfahren zur mikrobiellen

Produktion von pentazyklischen Triterpenoiden bereitzustellen.

Beschreibung der Erfindung

Die Aufgabe wird durch die unabhängigen Ansprüche gelöst. Besonders vorteilhafte

Ausführungsformen finden sich in den abhängigen Ansprüchen.

In einer ersten bevorzugten Ausführungsform der Erfindung betrifft diese einen modifizierten Hefestamm zur Produktion von pentazyklischen Triterpenoiden, umfassend

i. mindestens eine Kopie eines Gens zur Kodierung einer Oxidosqualenzyklase, wobei das Gen eine Sequenz umfasst, ausgewählt aus der Gruppe umfassend Nukleinsäuren gemäß Accession Number AB05551 1 (SEQ ID No 1 ), AB025343 (SEQ ID No 2),

AB663343 (SEQ ID No 3), NMJ 79572 (SEQ ID No 4), AB181245 (SEQ ID No 5), DQ268869 (SEQ ID No 6), AB025345 (SEQ ID No 7), AB1 16228 (SEQ ID No 8), JQ087376 (SEQ ID No 9), HM623871 (SEQ ID No 10), AB289586 (SEQ ID No 1 1 ), AB055512 (SEQ ID No 12) und Nukleinsäuresequenzvarianten mit mindestens 70% Sequenzidentität zu SEQ ID No 1 bis 12, oder wobei das Gen eine Sequenz umfasst, die für eine Aminosäuresequenz gemäß SEQ ID No 54 bis 65, oder für eine Aminosäuresequenzvariante mit mindestens 85% Sequenzidentität zu SEQ ID No 54 bis 65, kodiert;

und/oder

ii. mindestens eine Kopie eines Gens zur Kodierung einer NADPH-Cytochrom P450

Reduktase, wobei das Gen eine Sequenz umfasst, ausgewählt aus der Gruppe umfassend Nukleinsäuren gemäß Accession Number AB433810 (SEQ ID No 13), X66016 (SEQ ID No 14), X69791 (SEQ ID No 15), XM_003602850 (SEQ ID No 16), NM_001 179172 (SEQ ID No 17), X66017 (SEQ ID No 18), JN594507 (SEQ ID No 19), DQ984181 (SEQ ID No 20), DQ318192 (SEQ ID No 21 ), AF302496 (SEQ ID No 22), AF302497 (SEQ ID No 23), AF302498 (SEQ ID No 24), L07843 (SEQ ID No 25), AF024635 (SEQ ID No 26), AF024634 (SEQ ID No 27), FJ719368 (SEQ ID No 28), FJ719369 (SEQ ID No 29) und Nukleinsäuresequenzvarianten mit mindestens 70% Sequenzidentität zu SEQ ID No 13 bis 29,

oder wobei das Gen eine Sequenz umfasst, die für eine Aminosäuresequenz gemäß SEQ ID No 66 bis 82, oder für eine Aminosäuresequenzvariante mit mindestens 85% Sequenzidentität zu SEQ ID No 66 bis 82, kodiert;

und/oder

iii. mindestens eine Kopie eines Gens zur Kodierung einer Cytochrom P450

Monooxygenase, wobei das Gen eine Sequenz umfasst, ausgewählt aus der Gruppe umfassend Nukleinsäuren gemäß Accession Number AB619802 (SEQ ID No 30), AB619803 (SEQ ID No 31 ), DQ335781 (SEQ ID No 32), JN565975 (SEQ ID No 33), XM_002331391 (SEQ ID No 34), XM_003525274 (SEQ ID No 35), JF803813 (SEQ ID No 36), XM_004139039 (SEQ ID No 37), GU997666 (SEQ ID No 38), JX036032 (SEQ ID No 39), XM_002522891 (SEQ ID No 40), AM457725 (SEQ ID No 41 ), XM_002265988 (SEQ ID No 42), XM_002527956 (SEQ ID No 43), BT147421 (SEQ ID No 44),

XM_003530477 (SEQ ID No 45), BT096613 (SEQ ID No 46), XM_002309021 (SEQ ID No 47), BT051785 (SEQ ID No 48), XM_002513137 (SEQ ID No 49), XM_002264607 (SEQ ID No 50), XM_002324633 (SEQ ID No 51 ), XM_003531801 (SEQ ID No 52), XM_002280933 (SEQ ID No 53) und Nukleinsäuresequenzvarianten mit mindestens 70% Sequenzidentität zu SEQ ID No 30 bis 53,

oder wobei das Gen eine Sequenz umfasst, die für eine Aminosäuresequenz gemäß SEQ ID No 83 bis 105, oder für eine Aminosäuresequenzvariante mit mindestens 85% Sequenzidentität zu SEQ ID No 83 bis 105, kodiert.

Bevorzugt umfasst den erfindungsgemäßen modifizierten Hefestamm zur Produktion von pentazyklischen Triterpenoiden:

- mindestens eine Kopie eines Gens zur Kodierung einer Oxidosqualenzyklase gemäß i., wobei eine Kopie eines Gens zur Kodierung einer NADPH-Cytochrom P450 Reduktase gemäß ii. oder eine Kopie eines Gens zur Kodierung einer Cytochrom P450 Monooxygenase gemäß iii. nicht vorhanden sind (z. B. für die Produktion von Lupeol); - mindestens eine Kopie eines Gens zur Kodierung einer Oxidosqualenzyklase gemäß i. und mindestens eine Kopie eines Gens zur Kodierung einer Cytochrom P450 Monooxygenase gemäß iii., wobei eine Kopie eines Gens zur Kodierung einer NADPH-Cytochrom P450 Reduktase gemäß ii nicht vorhanden ist;

- eine Kombination aus mindestens eine Kopie eines Gens zur Kodierung einer

Oxidosqualenzyklase gemäß i., mindestens eine Kopie eines Gens zur Kodierung einer NADPH-Cytochrom P450 Reduktase gemäß ii. und mindestens eine Kopie eines Gens zur Kodierung einer Cytochrom P450 Monooxygenase gemäß iii.

Insbesondere umfasst die Erfindung Hefestämme, welche eine der folgenden Kombinationen von Genen umfasst:

AB025343 (OEW) XM_003602850 (MTR), AB619802 (CYP716A15)

AB025343 (OEW) XM_003602850 (MTR), AB619803 (CYP716A17)

AB025343 (OEW) XM_003602850 (MTR), XM_002331391 (CYP716A9)

AB025343 (OEW) X69791 (CrCPR), AB619802 (CYP716A15)

AB025343 (OEW) X69791 (CrCPR), XM_003525274 (Cytochrome P450 716B2-like) AB025343 (OEW) X69791 (CrCPR), XM_002331391 (CYP716A9)

AB025343 (OEW) X69791 (CrCPR), AB619803 (CYP716A17)

AB025343 (OEW) AB433810 (LjCPRI ), AB619802 (CYP716A15)

AB025343 (OEW) AB433810 (LjCPRI ), XM_004139039 (cytochrome P450 716B1-like) AB025343 (OEW) X66016 (ATR1 ) und JN565975 (CYP716AL1 )

Es ist dabei bevorzugt, dass die folgenden Kombinationen nicht gewählt werden:

- AB663343 (GuLUPI ), AB433810 (LjCPRI ) und DQ335781 (CYP716A12);

- AB663343 (GuLUPI ), AB433810 (LjCPRI ) und AB619802 (CYP716A15);

- NM_179572 (AtLUPI ), X66016 (ATR1 ) und JN565975 (CYP716AL1 ).

Die übrigen Kombinationen zeigten eine deutlich höhere Ausbeute an pentazyklischen

Triterpenoiden, sodass diese zu bevorzugen sind.

Insbesondere umfasst die Erfindung Hefestämme, welche eine intrazelluläre Konzentration an pentazyklischen Triterpenoiden von mehr als 1 mg pro Gramm Biotrockensubstanz, bevorzugt mehr als 2 mg pro Gramm Biotrockensubstanz, , CH20Y

555555555555555555555555555555555555555555555555555555555 55555555555555555555 55555555555555555555555555555555555555555 aufweisen.

Insbesondere umfasst die Erfindung Hefestämme, die eine intrazelluläre Konzentration an Lupeol von bevorzugt mehr als 5 mg pro Gramm Biotrockensubstanz, oder weiter bevorzugt mehr als 7 mg pro Gramm Biotrockensubstanz, aufweisen. Die Hefestämme der vorliegenden Erfindung sind in einigen Ausführungsformen daher dadurch gekennzeichnet, dass sie eine intrazelluläre Konzentration an pentazyklischen Triterpenoiden von mehr als 1 , 2, 3, 4, 5, 6 oder 7 mg pro Gramm Biotrockensubstanz aufweisen.

Das technische Problem deutlich mehr pentazyklische Triterpenoide in Hefe zu produzieren, wurde gelöst indem zum einen unterschiedliche Genkombinationen gewählt wurden und zum anderen durch den Einsatz neuer Gene. Im Lichte des Standes der Technik war es völlig überraschend, dass relativ große Mengen an pentazyklischen Triterpenoiden in Hefe durch die erfindungsgemäßen Gene produziert werden können.

Eine Messung der intrazellulären Konzentration der pentazyklischen Triterpenoiden ist für einen Fachmann auf dem Gebiet der Mikrobiologie ohne Schwierigkeiten möglich. Folgende Methoden können dafür verwendet werden: Die meisten pentazyklischen Triterpenoide sind hydrophob und können in Zellen akkumulieren. In einem ersten Schritt können die Zellen mittels verschiedener Verfahren wie z. B. Zentrifugation, Filtration, Crossflow-Filtration, Chromatographie (z.B.

Affinitätschromatographie, lonenaustauschchromatographie, Größenausschlusschromatographie) oder durch Abkratzen von festen Oberflächen oder Kulturplatten geernet werden. Das Zellpellet kann auf irgendeine Weise bevorzugt mittels Zentrifugation, Filtration oder Crossflow-Filtration erzielt werde. Alternativ können die Zellen mit der Zeit absinken. Optional können die Zellen auf irgendeine bekannte Weise aus dem Stand der Technik wie z.B. Zentrifugation, Filtration oder Crossflow-Filtration gewaschen werden. Das Zellpellet kann getrocknet oder nicht getrocknet werden. Die Zellen können auf irgendeine bekannte Weise aus dem Stand der Technik lysiert werden. Die Zellen können über mechanische Einwirkung wie z.B. Homogenisierung (z.B. mithilfe eines Potter oder eines Downs Homogenisators) oder mittels Druckbehandlung (z.B. mithilfe einer French-Press) oder mittels Ultraschall oder mittels Detergentien oder mittels lytischer Phagen lysiert werden. Optional können pentazyklische Triterpenoide über Extraktion mit Lösemitteln, z.B. mit organischen Lösemitteln extrahiert werden. Optional könnte das organische Lösemittel im Anschluss verdampft werden. Alternativ oder zusätzlich können pentazyklische Triterpenoide in Abhängigkeit von ihrer chemischen Natur mittels Chromatographie-Methoden (z.B. Phasen-Chromatographie, lonenaustauschchromatographie, Umkehrphasen- Chromatographie, Größenausschlusschromatographie,

Hochleistungsflüssigkeitschromatographie (HPLC), Ultra-

Hochleistungsflüssigkeitschromatographie (UHPLC), Schnelle-Protein-Flüssigkeits- Chromatographie (FPLC)) oder mittels Elektrophorese oder mittels Kapillarelektrophorese (CE) oder mittels Destillation isoliert bzw. vermessen werden.

Die oben genannten Methoden können ebenfalls für die Produktion und Isolierung der pentazyklischen Triterpenoiden verwendet werden, z. B im erfindungsgemäßen Verharen zur Herstellung von pentazyklischen Triterpenoiden.

In den Tabellen 7 bis 14 sind einige bevorzugte Genkombinationen offenbart, die, unabhängig vom Hefestamm oder Art der genetischen Modifikation des Stammes, zu vorteilhaften Ausbeuten führen.

Insbesondere umfasst die Erfindung Hefestämme, die folgende Genkombinationen aufweisen: In weiteren Ausführungsformen der Erfindung können folgende Gene oder Genkombinationen zu einer intrazellulären Konzentration an Lupeol von mehr als 10 mg pro Gramm

Biotrockensubstanz führen:

In weiteren Ausführungsformen der Erfindung können folgende Gene oder Genkombinationen zu einer intrazellulären Konzentration an Lupeol von mehr als 7,5 mg pro Gramm

Biotrockensubstanz führen:

In weiteren Ausführungsformen der Erfindung können folgende Gene oder Genkombinationen zu einer intrazellulären Konzentration an Lupeol von mehr als 5 mg pro Gramm Biotrockensubstanz führen:

OEW ATR1 B2 XM 003525274

OEW LjCPRI - A17 AB619803

OEW LjCPRI - A9 XM 002331391

OEW NCP1 B2 XM 003525274

OEW LjCPRI - A12 DQ335781

OEW CrCPR A15 AB619802

OEW NCP1 A9 XM 002331391

OEW MTR A9 XM_002331391

OEW NCP1 A17 AB619803

OEW NCP1 A15 AB619802

OEW MTR A12 DQ335781

OEW ATR1 A15 AB619802

OEW ATR1 A17 AB619803

OEW LjCPRI - A41 JF803813

In weiteren Ausführungsformen der Erfindung können folgende Gene oder Genkombinationen zu einer intrazellulären Konzentration an Betulin von mehr als 10 mg pro Gramm

Biotrockensubstanz führen:

In weiteren Ausführungsformen der Erfindung können folgende Gene oder Genkombinationen zu einer intrazellulären Konzentration an Betulin von mehr als 3 mg pro Gramm Biotrockensubstanz führen:

In weiteren Ausführungsformen der Erfindung können folgende Gene oder Genkombinationen zu einer intrazellulären Konzentration an Betulin von mehr als 1 mg pro Gramm Biotrockensubstanz führen:

In weiteren Ausführungsformen der Erfindung können folgende Gene oder Genkombinationen zu einer intrazellulären Konzentration an Betulinaldehyd von mehr als 3 mg pro Gramm

Biotrockensubstanz führen: CYP-Gen

OSC-Gen CPR-Gen CYP-Gen

Accession

OEW MTR A15 AB619802

OEW MTR A17 AB619803

OEW LjCPRI - A17 AB619803

In weiteren Ausführungsformen der Erfindung können folgende Gene oder Genkombinationen zu einer intrazellulären Konzentration an Betulinaldehyd von mehr als 2 mg pro Gramm

Biotrockensubstanz führen:

In weiteren Ausführungsformen der Erfindung können folgende Gene oder Genkombinationen zu einer intrazellulären Konzentration an Betulinaldehyd von mehr als 1 mg pro Gramm

Biotrockensubstanz führen:

In weiteren Ausführungsformen der Erfindung können folgende Gene oder Genkombinationen zu einer intrazellulären Konzentration an Betuli nsäure von mehr als 5 mg pro Gramm

Biotrockensubstanz führen:

In weiteren Ausführungsformen der Erfindung können folgende Gene oder Genkombinationen zu einer intrazellulären Konzentration an Betuli nsäure von mehr als 2 mg pro Gramm

Biotrockensubstanz führen:

In weiteren Ausführungsformen der Erfindung können folgende Gene oder Genkombinationen zu einer intrazellulären Konzentration an Betulinsäure von mehr als 1 mg pro Gramm

Biotrockensubstanz führen:

Die Ausbeute der pentazyklischen Triterpenoide kann - alternativ zur intrazellulären

Konzentration im mg pro g Biotrockensubstanz - als mg pro Liter Kulturmedium ausgedruckt werden. Es kann sein, dass einige Genkombinationen zwar zur geringen intrazellulären

Konzentration von pentazyklischen Triterpenoiden pro Gramm Biotrockensubstanz aufgrund eines sub-optimalen Wachstumsrates führen. Nichtsdestotrotz können sich solche

Genkombinationen doch als vorteilhaft erwiesen, wenn sie zu einer relativ hohen Ausbeute des pentazyklischen Triterpenoids pro Liter von Kulturmedium führen.

In weiteren Ausführungsformen der Erfindung können folgende Gene oder Genkombinationen zu einer Konzentration an Lupeol von mehr als 100 mg pro Liter Kulturmedium führen:

In weiteren Ausführungsformen der Erfindung können folgende Gene oder Genkombinationen zu einer Konzentration an Betulin von mehr als 50 mg pro Liter Kulturmedium führen: OEW CrCPR A15 AB619802

OEW LjCPRI - A15 AB619802

OEW LjCPRI - B2 XM 003525274

In weiteren Ausführungsformen der Erfindung können folgende Gene oder Genkombinationen zu einer Konzentration an Betuli naldehyd von mehr als 25 mg pro Liter Kulturmedium führen:

In weiteren Ausführungsformen der Erfindung können folgende Gene oder Genkombinationen zu einer Konzentration an Betuli nsäure von mehr als 25 mg pro Liter Kulturmedium führen:

Eine Messung der Konzentration der pentazyklischen Triterpenoiden pro Liter Kulturmedium ist für einen Fachmann auf dem Gebiet der Mikrobiologie ohne Schwierigkeiten möglich. Die oben genannten Methoden können dafür verwenet werden.

Im Sinne der Erfindung unterscheiden sich pentazyklische Triterpenoide von Triterpenen durch mindestens eine funktionelle Gruppe. Im Stand der Technik wird oft nicht sauber zwischen den beiden Begriffen unterschieden, so dass auch Verbindungen mit funktionellen Gruppen als Triterpene bezeichnet werden. Auch solche Verbindungen stellen Triterpenoide im Sinne der Erfindung dar.

Die pentazyklischen Triterpene und die sich daraus ableitenden Terpenoide sind in Gruppen bzw. Typen oder Reihen eingeteilt und dem zugrunde liegenden C3o-Terpan zugeordnet.

Namensgeber dieser terpanoiden Typen sind unter anderem folgende C3oHs2-Grundgerüste: Baueran-Typ, Friedelan-Typ, Gammaceran-Typ, Glutinan-Typ, Hopan-Typ, Lupan-Typ,

Multifloran-Typ, Oleanan-Typ, 18a-Oleanan-Typ, Taraxeran-Typ und der Ursan-Typ.

Die pentazyklischen Triterpene und/oder Triterpenoide sind vorzugsweise durch eine Struktur gemäß einer der Formeln I, II oder II I definiert, nämlich: C H C H .

C H .

C H

C H .

C H

C H .

C H

R L C H ,

C H . II

R1 : Me, CH 2 OH, CH2OY 1 , CH2O-X-OH, CH2O-X-OY 1 , CH2O-X-Y 2 , CH2O-X-Y 3 , CH2NHY 1 ,

CH 2 NY 1 2 , CH2Y 3 , CH2NH-X-OH, CH2NH-X-Y 2 , CH2NH-X-Y 3 , CH2NH-X-OY 1 , CH 2 OC(0)-OY 1 , CH2O-X-OY 1 , CO2Y 1 , COY 3 , COY 2 , CHO,

CH=N(CH2)m(0(CH 2 )m)nR4, oder CH=N(CH2)m(0(CH 2 )m)nY 2 ;

R2, R3: H, OH, OY 1 , O-X-OH, O-X-OY 1 , O-X-Y 2 , Y 3 , NHY 1 , NY 1 2 , Y 3 , NH-X-OH, NH-X-Y 2 , NH- X-Y 3 , NH-X-OY 1 , NY 1 -X-OH, NY 1 -X-Y 2 , NY 1 -X-Y 3 oder NY 1 -X-OY 1 ; vorausgesetzt, dass eines von R2 oder R3 H ist, oder dass R2 und R3 zusammen

Carbonylsauerstoff darstellen;

R4: H, OH, OY 1 oder Y 3 ;

Y 1 : H, Alkyl mit 1-30 C-Atomen, geradkettig oder verzweigt, Cycloalkyl mit 3-30 C- Atomen, Alkanyl von 3-30 C-Atomen, Oxyalkyl von 4-30 C-Atomen, Phenylalkyl mit 7- 30 C-Atomen oder Phenoxyalkyl von 7-30 C-Atomen;

Y 2 : NH 2 , NHY 1 oder NY 1 2 ;

Y 3 : -(0(CH 2 )m)nR4 oder -(0(CH 2 )m)nY 2 , wobei m = 2-4 und n = 1-230;

X: -OC(CH 2 )pCO-, wobei p

Es war nicht zu erwarten, dass die Produktion von pentazyklischen Triterpenoiden in Hefe in einem industriellen Maßstab erfolgen kann. Bisherige Forschungsergebnisse zu diesem Thema legten eine solche Möglichkeit in keiner Weise nahe. Die Produktion von pentazyklischen Triterpenoiden in Hefe ist besonders vorteilhaft, da diese keine oder nur eine sehr geringe Bildung weiterer zyklischer Triterpene (abgesehen von Sterolen) zeigen. Da es sich hierbei nicht um native Metabolite der Hefe handelt, entstehen somit weniger Formen von Gemischen, sodass die Aufreinigung der Zielprodukte um ein Vielfaches erleichtert wird.

Das Gen zur Kodierung einer Oxidosqualenzyklase wird bevorzugt ausgewählt aus Tabelle 1. Das Gen zur Kodierung einer NADPH-Cytochrom P450 Reduktase wird bevorzugt ausgewählt aus Tabelle 2. Das Gen zur Kodierung einer Cytochrom P450 Monooxygenase wird bevorzugt ausgewählt aus Tabelle 3. Vor allem in der Zusammenstellung dieser Tabellen liegt ein Großteil der erfinderischen Leistung auf der diese Anmeldung basiert. Im Stand der Technik gab es keinerlei Anregungen für die Kombination dieser Gene.

Die Gene werden dabei bevorzugt in den Hefestamm transformiert, wobei die Gene funktional mit Promotersequenzen verbunden sind, welche die Expression dieser Gene in Hefen erlauben.

Tabellel : Oxidosqualenzyklasen (OSCs)

Das Gen OSCBPW AB055511 aus Betula platyphylla (var. Japonica) (Birke) wurde von Zhang et al., 2003 beschrieben. Birkenrinde enthält große Mengen an Betulin. Das Gen gehört zu der Lupeolsynthase-Familie.

Das Gen OEW AB025343 aus Olea europaea (Olivenbaum) wurde von Shibuya et al., 1999 beschrieben. OEW-Transformanten häufen Lupeol als ausschließliches Produkt an. Auch dieses Gen gehört zu der Lupeolsynthase-Familie.

GuLUPI AB663343 aus Glycyrrhiza uralensis (Süßholz) wurde von Fukushima et al., 201 1 beschrieben. Fukushima beschreibt eine Co-Expression mit LjCPRI und CYP716A12 /

CYP716A15. AtLUPI NM_179572 aus Arabidopsis thaliana (Acker-Schmalwand oder auch Schotenkresse) wurde von Huang et al., 2012, Husselstein-Muller et al., 2001 und Herrera et al., 1998 beschrieben. Huang et al. beschreibt dabei eine Co-Expressed mit ATR1 und CYP716AL1.

Das Gen OSC3 AB181245 aus Lotus japonicus (Hornklee) wurde 2006 von Sawai et al.

beschrieben.

Das Gen RcLUSI DQ268869 aus Ricinus communis (Wunderbaum) wurde von Guhling et al., 2006 und Gallo et al., 2009 beschrieben. Dieses Gen ist nicht als Teil der Lupeolsynthese- Familie bekannt und stellt eine hoch spezifische LUS dar, welches für die Produktion von Lupeol in Ricinus Stamm zuständig ist. Das Gen TRW AB025345 aus Taraxacum officinale wurde 1999 von Shibuya et al. beschrieben.

Das Gen GgLUSI AB116228 aus Glycyrrhiza glabra wurde 2004 von Hayashi et al. beschrieben.

Das Gen EtLUS JQ087376 aus Eleutherococcus trifoliatus wurde 2012 von Ma et al.

beschrieben.

KdLUS HM623871 aus Kalanchoe daigremontiana wurde beschrieben von Wang et al., 2010. Das Gen BgLUS AB289586 aus Bruguiera gymnorhiza wurde von Basyuni et al., 2007 beschrieben.

OSCBPY AB055512 aus Betula platyphylla (var. Japonica) Birke wurde von Zhang et al., 2003 und Phillips et al., 2006 beschrieben.

Gossypium hirsutum GhCPRI FJ719368 2082 (cultivar CRH 2) GhCPR2 FJ719369 2133

Das Gen LjCPRI AB433810 aus Lotus japonicus (Hornklee) wurde von Seki et al., 2008 beschrieben. In Fukushima et al., 201 1 wird eine Co-Expression mit GuLUPI und CYP716A12 / CYP716A15 offenbart.

Die Gene ATR1 X66016 und ATR2 X66017 aus Arabidopsis thaliana (Acker-Schmalwand) wurden von Pompon et al., 1996, Urban et al., 1997 und Urbank, 2012 beschrieben. Huang et al., 2012 beschreibt eine Co-Expression von ATR1 mit AtLUPI und CYP716AL1. Außerdem ist über ATR2 eine niedrige FMN Affinität bekannt (Louerat-Oriou et al., 1998).

CrCPR X69791 aus Catharanthus roseus (Hundsgiftgewächse) wurde von Meijer et al., 1993 und Jensen et al., 2010 beschrieben. Das korrespondierende CYP Protein ist bekannt und wurde getestet.

Auch das korrespondierende CYP Protein von MTR_3g100160 XM_003602850 aus Medicago truncatula (Schneckenklee) ist bekannt und wurde getestet.

Das Gen NCP1 (CPR1 ) NM_001 179172 aus Saccharomyces cerevisiae ist bekannt aus

Murakami et al., 1990 und Pompon et al., 1996.

Die Gene CPR JN594507, DQ984181 und DQ318192 aus Artemisia annua wurden von Misra et al., 2012, beziehungsweise Yang et al., 2008 beziehungsweise Ro et al., 2006 beschrieben.

Die CPR Isoformen 1 (AF302496), 2 (AF302497) und 3 (AF302498) aus Hybrid poplar (Pappeln (Populus trichocarpa x Populus deltoides)) wurden von Ro et al., 2002 beschrieben.

Das Gen VrCPR L07843 aus Vigna radiata (M ungbohne) wurde von Shet et al., 1993 und Urban et al. , 1997 beschrieben.

Die Gene PcCPRI AF024635 und PcCPR2 AF024634 aus Petroselinum crispum (Petersilie) wurden 1997 von Koopmann et al. beschrieben.

Die Gene GhCPRI FJ719368 und GhCPR2 FJ719369 aus Gossypium hirsutum ((cultivar CRH 2) Baumwolle) wurden von Yang et al., 2010 beschrieben.

Tab.3: Cytochrom P450 Monooxygenasen (CYPs)

Bupleurum chinense CYP716A41 JF803813 1449

Cucumis sativus Gurke Predicted: cytochrome XM_004139039 1452

P450 716B1-like

Panax notoginseng cytochrome P450 GU997666 1446

Panax ginseng CYP716A52v2 JX036032 1446

Ricinus communis cytochrome P450, XM_002522891 1443

putative

Vitis vinifera VITISV_041935 AM457725 1443

Vitis vinifera Predicted: cytochrome XM_002265988 1443

P450 716B2

Ricinus communis cytochrome P450, XM_002527956 1416

putative

Medicago truncatula unknown BT 147421 1440

Glycine max Predicted: Glycine max XM_003530477 1449

cytochrome P450 716B2- like (LOCI 00813159)

Glycine max unknown BT096613 1335

Vitis vinifera Predicted: cytochrome XM_002280933 1449

P450 716B2

(LOCI 00242305)

Populus trichocarpa CYP716A8 XM_002309021 1455

(POPTR_0006s08560g)

Medicago truncatula unknown BT051785 1440

Ricinus communis cytochrome P450, XM_002513137 1434

putative

Vitis vinifera cytochrome P450 716B2- XM_002264607 1458

like (LOCI 00265713)

Populus trichocarpa POPTR_0018s 13390g XM_002324633 1455

Glycine max cytochrome P450 716B2- XM_003531801 1449

like (LOCI 00815640),

transcript variant X1

Das Gen CYP716A15 AB619802 aus Vitis vinifera (Weinrebe) wurde von Fukushima et al., 201 1 beschrieben. Fukushima beschreibt eine Co-Expression mit GuLUPI und LjCPRI .

Das Gen CYP716A17 AB619803 aus Vitis vinifera (Weinrebe) produziert Oleanolsäure mit ß- Amyrin als Substrat und wurde von Fukushima et al., 201 1 beschrieben.

Das Gen CYP716A12 DQ335781 aus Medicago truncatula (Schneckenklee) wurde von

Fukushima et al., 201 1 beschrieben. Fukushima beschreibt eine Co-Expression mit GuLUPI und LjCPRI .

Das Gen CYP716AL1 JN565975 aus Catharanthus roseus (Hundsgiftgewächse) wurde von Huang et al., 2012 beschrieben. Huang beschreibt eine Co-Expression mit AtLUPI und ATRI .

Das Gen CYP716A9 XM_002331391 stammt aus Populus trichocarpa (Pappel)

Das Gen Cytochrome P450 716B2-like (LOCI 00801007) XM_003525274 stammt aus Glycine max (Sojabohne), welche Soyasaponine des Oleanantyps enthält.

CYP716A41 JF803813 aus Bupleurum chinense (Chin. Hasenohr) wurde von Pistelli et al., 2005 beschrieben und enthält Saikosaponine vom Oleanantyp. Bupleurum flavum ist außerdem bekannt dafür, dass er Betulin und Betuli nsäure enthält.

Das Gen cytochrome P450 716B1 -like XM_004139039 aus Cucumis sativus (Gurke) wurde von Zhou et al., 2012 beschrieben. Ursolsäure wurde in Cucumis sativus Wurzeln identifiziert.

CYP716A52v2 JX036032 aus Panax ginseng mit den Produkten Erythrodiol und Oleanolsäure wurde von Han et al., 2013. CYP716A52v2 ist eine ß-Amyrin 28-Oxidase.

Die Gene cytochrome P450 GU997666 aus Panax notoginseng, cytochrome P450

XM_002522891 aus Ricinus communis, VITISV_041935 AM457725 aus Vitis vinifera, cytochrome P450 716B2 XM_002265988 aus Vitis vinifera, cytochrome P450, XM_002527956 aus Ricinus communis, BT147421 aus Medicago truncatula, Glycine max cytochrome P450 716B2-like (LOCI 00813159) XM_003530477 aus Glycine max, BT096613 aus Glycine max, cytochrome P450 716B2 (LOCI 00242305) aus Vitis vinifera, CYP716A8 (POPTR_0006s08560g) XM_002309021 aus Populus trichocarpa, BT051785 aus Medicago truncatula, cytochrome P450, XM_002513137 aus Ricinus communis, cytochrome P450 716B2-like (LOCI 00265713)

XM_002264607 aus Vitis vinifera, POPTR_0018s13390g XM_002324633 aus Populus trichocarpa und cytochrome P450 716B2-like (LOCI 00815640), Transkriptvariante X1

XM_003531801 aus Glycine max wurden ebenfalls in die Tabelle 3 aufgenommen.

Die folgenden Gene wurden im Stand der Technik noch nicht in Hefe transformiert: X69791 , XM_003602850, L07843, FJ719368, FJ719369, AB619803, XM_002331391 , XM_003525274, JF803813, XM_004139039, GU997666, XM_002522891 , AM457725, XM_002265988,

XM_002527956, BT147421 , XM_003530477, BT096613, XM_002280933, XM_002309021 , BT051785, XM_002513137, XM_002264607, XM_002324633, XM_003531801. Es war daher für einen Fachmann nicht abzusehen, dass gerade diese Gene und deren Kombinationen untereinander und mit Genen für die Kodierung einer Oxidosqualenzyklase dazu führen, dass die Ausbeute der Produktion von Triterpenoiden in Hefen um ein Vielfaches gesteigert werden konnte.

Es ist bevorzugt, dass der Hefestamm mindestens eine Kopie eines Gens zur Kodierung einer NADPH-Cytochrom P450 Reduktase umfasst, wobei das Gen eine Sequenz umfasst, ausgewählt aus der Gruppe umfassend Nukleinsäuren gemäß Accession Number X69791 , XM_003602850, L07843, FJ719368, FJ719369, oder Sequenzvarianten mit analogen Funktionen. Da diese Sequenzen für die Produktion von beispielsweise Lupeol nicht erforderlich sind, war es völlig überraschend, dass diese Gensequenzen zu einer besonders hohen und stabilen Ausbeute führen.

Es ist außerdem bevorzugt, dass der Hefestamm mindestens eine Kopie eines Gens zur Kodierung einer Cytochrom P450 Monooxygenase umfasst, wobei das Gen eine Sequenz umfasst, ausgewählt aus der Gruppe umfassend Nukleinsäuren gemäß Accession Number AB619802, AB619803, DQ335781 , JN565975, XM_002331391 , XM_003525274, JF803813, , XM_004139039, GU997666, JX036032, XM_002522891 , AM457725, XM_002265988,

XM_002527956, BT147421 , XM_003530477, BT096613, XM_002280933, XM_002309021 , BT051785, XM_002513137, XM_002264607, XM_002324633, XM_003531801.

Überraschenderweise lieferte der Einsatz dieser Gene in Kombination mit einem beliebigen Gen aus Tabelle 1 und Tabelle 2, bevorzugt jedoch X69791 , XM_003602850, L07843, FJ719368, FJ719369, besonders gute Ergebnisse in Hinblick auf die Ausbeute und die Wachstums rate der Hefen.

Weiterhin bevorzugt ist, dass der Stamm Betulin produziert. Für Betulin sind zahlreiche pharmakologische Wirkungen beschrieben. Betulin wirkt unter anderem antientzündlich, antibakteriell, antiviral, hepatoprotektiv, antitumoral und außerdem cholesterinsenkend. Durch dieses breite Wirkspektrum ist Betulin für die Wissenschaft und die Pharmaindustrie von besonderem Interesse. Die gesteigerte Produktion durch die Hefe-Stämme der Erfindung ist daher besonders bedeutsam.

Es kann auch bevorzugt sein, dass eine vermehrte Anreicherung der Vorstufe Lupeol erzielt wird. Dies kann durch eine entsprechende Wahl der zu transformierenden Gene erreicht werden. Lupeol zeigt neben seiner antiprotozoischen und antimikrobiellen Wirkung auch

entzündungshemmende Eigenschaften sowie eine Wachstumshemmung von Tumorzellen.

Außerdem kann Lupeol als adjuvantes Therapeutikum eingesetzt werden. Lupeol stellt damit ebenfalls einen interessanten Stoff dar, der bisher nur mit großem Aufwand synthetisiert werden konnte. Die industrielle Herstellung in Hefe stellt daher einen großen Vorteil im Vergleich zum Stand der Technik dar. Von Lupeol aus lassen sich dann eine Vielzahl pharmazeutisch relevanter Triterpene/Triterpenoide herstellen. Es ist besonders bevorzugt Lupeol überproduzierende Hefestämme für die Herstellung von Betulin, Betuli naldehyd und/oder Betuli nsäure zu verwenden. Das Zwischenprodukt Lupeol oder auch das Nebenprodukt ß- Amyrin sind selber Moleküle, die, wenn einfach zugänglich, kommerziell hoch interessant sind.

Die Erfindung betrifft bevorzugt eine„Toolbox" mit deren Hilfe eine erhöhte mikrobielle Produktion von pentazyklischen Triterpenoiden, bevorzugt Betulin, Betulinaldehyd und/oder Betulinsäure, möglich ist. Ein„Werkzeug" ist dabei die Stammkonstruktion. Hierbei wurde zunächst ein Hefestamm konstruiert, welcher aufgrund eines optimierten Lipidstoffwechsels große Mengen an Acetyl-CoA und/oder 2, 3-Oxidosqualen anreichert. Ein Acetyl-CoA und/oder 2, 3-Oxidosqualen überproduzierender Stamm stellt eine hervorragende Plattform für die Produktion einer Vielzahl biologisch hochaktiver Triterpene/Triterpenoide dar. Als ein aus ökologischer und ökonomischer Sicht besonders relevantes pentazyklisches Triterpenoid wurde Betulinsäure als Zielsubstanz ausgewählt. Ausgehend von einem Acetyl-CoA- und/oder 2, 3-Oxidosqualen-produzierenden Plattformstamm wurden daher mit dem zweiten„Werkzeug", dem Einsatz der ausgewählten Gene aus den Tabellen 1 , 2 und 3 und vor allem deren Kombination, weitere biosynthetische Stoffwechselenzyme zwecks der Überproduktion von Betulinsäure exprimiert.

Es ist besonders bevorzugt, dass der Hefestamm Betulinaldehyd produziert.

Außerdem bevorzugt ist, dass der Hefestamm Betulinsäure produziert.

Betulinsäure erwies sich im Gegensatz zu herkömmlichen Wirkstoffen als nicht-toxisch für eukaryotische Zellen und Versuchstiere. Die gute Verträglichkeit von Betulinsäure wurde in Pisha et al. (1995) gegenüber anderen Naturstoffen wie Taxol hervorgehoben. In späteren Arbeiten konnte die sehr gute Verträglichkeit von Betulinsäure in Studien an Mäusen gezeigt werden, wo Medikationen von bis zu 500 mg/kg keine toxischen Effekte hatte (Udeani et al., 1999). Die pharmakologische in vivo Wirkung (Mausmodelle) inklusive der guten Verträglichkeit von Betuli nsäure ist in einem Übersichtsartikel von Mullauer et al. (2010) auf Seite 8 („Betuli nie acid in vivo") beschrieben.

Betulinsäure ist unter anderem ein Inhibitor von Melanom- und anderer Krebszellen. Außerdem stehen einige Derivate der Betulinsäure zurzeit im Mittelpunkt verschiedener klinischer Studien zur Behandlung von HIV und AIDS. Es ist daher ein großer Fortschritt für die Wissenschaft und Forschung, dass durch die Erfindung Betulinsäure nun in großen Mengen kostengünstiger und einfacher bereitgestellt werden kann.

Durch die ausgewählten Genkombinationen durch jeweils ein Gen aus Tabelle 1 , 2 und 3, welche teilweise neue Gene enthalten, die zuvor noch nicht in Hefen eingesetzt wurden, konnten überraschenderweise deutlich höhere Konzentrationen an pentazyklischen Triterpenoiden produziert werden.

Überraschenderweise ist die produzierte Menge stammabhängig. Dies wurde unter anderem am Beispiel von Lupeol gezeigt. So zeigten die beanspruchten Stämme besonders gute Ergebnisse in Bezug auf Ausbeute und Reinheit der Produkte.

Mit der gleichen Genkombination verhielten sich CEN.PK-Stämme zum Beispiel anders als AH22-Stämme.

Durch gezielte genetische Modifikationen konnten S. cerevisiae Stämme erstellt werden, die durch die Erweiterung des Postsqualenbiosynthesewegs in der Hefe S. cerevisiae die Synthese und Anreicherung von pentazyklischen Triterpenoiden in hohen Mengen ermöglichen.

Die Hefe kann ausgewählt sein aus der Gruppe bestehend aus Saccharomyces cerevisiae, Saccharomyces delbrückii, Saccharomyces italicus, Saccharomyces ellipsoideus,

Saccharomyces fermentati, Saccharomyces kluyveri, Saccharomyces krusei, Saccharomyces lactis, Saccharomyces marxianus, Saccharomyces microellipsoides, Saccharomyces montanus, Saccharomyces norbensis, Saccharomyces oleaceus, Saccharomyces paradoxus,

Saccharomyces pastorianus, Saccharomyces pretoriensis, Saccharomyces rosei,

Saccharomyces rouxii, Saccharomyces uvarum und Saccharomycodes ludwigii, sowie Hefen der Gattung Kluyveromyces wie K. lactis K. marxianus var. marxianus, K. thermotolerans, sowie Hefen der Gattung Candida wie Candida utilis, Candida tropicalis, Candida albicans, Candida lipolytica und Candida versatilis, sowie Hefen der Gattung Pichia wie Pichia stipidis, Piachia pastoris und Pichia sorbitophila, sowie Hefen der Gattungen Cryptococcus, Debaromyces, Hansenula, Saccharomycecopsis, Saccharomycodes, Schizosaccharomyces, Wickerhamia, Debayomyces, Hanseniaspora, Kloeckera, Zygosaccharomyces, Ogataea, Kuraishia,

Komagataella, Metschnikowia, Williopsis, Nakazawaea, Cryptococcus, Torulaspora, Bullera, Rhodotorula, Yarrowia, Willopsis und Sporobolomyces.

Außerdem handelt es sich bei dem Hefestamm besonders bevorzugt um Saccharomyces cerevisiae.

Es hat sich als besonders vorteilhaft erwiesen, dass der Hefestamm eine tHMG1

Expressionskassette umfasst. Es hat sich gezeigt, dass durch die Modifikation von Genen des Prä- und

Postsqualenbiosynthesewegs eine weitere Verbesserung der Ausbeute erzielt werden kann. Dabei wurden Gene des Prä- und Postsqualenbiosynthesewegs entweder überexprimiert, herunterreguliert, inhibiert beziehungsweise deletiert, um letztlich die Produktion von

pentazyklischen Triterpenoiden zu erhöhen.

Im Sinne der Erfindung kann der Basisstamm, bevorzugt S. cerevisiae, auf unterschiedliche Weisen modifiziert sein, um zusätzlich zu einer erhöhten Produktion von Triterpenoiden zu führen. Eine vorteilhafte Ansatzstelle zur Modifikation ist die Menge von Acetyl-CoA. Acetyl-CoA wird zu Squalen umgesetzt, was wiederum eine Vorstufe in der Triterpenoidsynthese darstellt. Es ist daher wünschenswert eine hohe Menge an Acetyl-CoA zur Verfügung zu stellen. Eine

Möglichkeit der Modifikation ist es, unerwünschte Nebenreaktionen zu verringern. Dies kann zum Beispiel über die Reduktion der Alcoholdehydrogenase-Aktivität zur Verringerung der Synthese von Ethanol aus Acetaldehyde, z.B. durch Deletion eines oder mehrerer der Isoenzyme Adh1 , Adh3, Adh4, Adh5, geschehen. Eine weitere Möglichkeit ist die Inaktivierung oder Repression von ACC1 (Acetyl-CoA Carboxylase) zur Verringerung der Synthese von Fettsäuren aus Acetyl- CoA.

Vorteilhaft ist außerdem die Reduktion der Fettsäure Biosynthese durch Verringerung der Expression von FAS1 und/oder FAS2 oder die Reduktion des Glyoxylatzyklus durch Modifikation mindestens eines der Gene CIT2, ICL1 , MLS1 , MDH3, HAP2, HAP3, HAP4 und HAP5. Der Fachmann weiß, wie diese Gene modifiziert werden können, um zu dem gewünschten Ergebnis zu gelangen ohne selbst erfinderisch tätig zu werden.

Im Sinne der Erfindung kann die außerdem eine Reduktion der Pyruvat-Dehydrogenase Aktivität durch Modifikation der Untereinheiten des PDH-Komplexes PDA1 , PDB1 , LAT1 , LPD1 und PDX1 erfolgen.

Außerdem hat sich die Reduktion des Transportes von Pyruvat in die Mitochondrien um den Verlust von Pyruvat in den Citratzyklus zu verhindern/verringern, durch Deletion/Modifikation von MPC1 , YIA6 oder YEA6 als vorteilhaft erwiesen. Es ist weiterhin möglich eine Reduktion des Transportes von Acetyl-CoA in die Mitochondrien durch die Verringerung der Aktivität des Carnithin-Shuttles durch genetische Modifikation der Gene YAT1 , YAT2 oder CRC1 zu erzielen.

Durch die genannten Modifikationen werden unerwünschte Nebenreaktionen unterdrückt, sodass die Produktion von pentazyklischen Triterpenoiden unter optimierten Bedingungen ablaufen kann und somit eine höhere Ausbeute erzielt wird. Neben der Unterdrückung von Nebenreaktionen ist es außerdem möglich, eine Erhöhung der cytosolischen Acetyl-CoA Konzentration zu bewirken. Acetyl-CoA stellt den Baustein für die Synthese von Lipiden i.A. dar, sodass eine große Menge von Acetyl-CoA wünschenswert ist. Eine Möglichkeit stellt die heterologe Expression einer acetylierenden Acetyl-CoA Synthase (EC 1.2.1.10), welche cytosolisches Acetaldehyd in Acetyl-CoA umwandelt, dar. Dabei ist es zusätzlich bevorzugt, wenn es zu einer gleichzeitigen Anreicherung von Acetaldehyd kommt, beispielsweise durch Verringerung der Alcoholdehydrogenase-Aktivität oder durch Verringerung der Acetaldehyd-Dehydrogenase Aktivität (ALD6). Auch eine Überexpression der hefeeigenen Gene Pyruvat-Decarboxylase (PDC1 , PDC5, und/oder PDC6) und Acetaldehyd-Dehydrogenase (ALD6) und Acetyl-CoA Synthetase (ACS1 und/oder ACS2) hat gute Ergebnisse geliefert. Alternativ können auch heterologe Gene verwendet werden.

Eine dritte Möglichkeit den Basisstamm zu optimieren, stellt die Erhöhung der Genaktivitäten im oberen Stero Istoffwechselweg dar. Dies kann zum Beispiel durch eine Überexpression der hefeeigenen Gene ERG9, ERG20, ERG1 , ERG8 erfolgen.

Auch möglich ist die Verringerung der Genaktivitäten im unteren Stero Istoffwechselweg. Hier hat sich die Reduktion und/oder Eliminierung der Aktivität von ERG7 als besonders vorteilhaft erwiesen.

Es ist außerdem bevorzugt, alle heterologen Gensequenzen in codon-optimierter Form zu verwenden, um eine hohe Expression zu erreichen. Ein Fachmann ist in der Lage dies umzusetzen, ohne dabei selbst erfinderisch tätig zu werden.

In Sinne der Erfindung können die oben aufgezählten Modifikationsmöglichkeiten auch miteinander kombiniert werden, um zu weiteren bevorzugten Stämmen zu gelangen.

Es ist weiterhin bevorzugt, dass der Stamm ein Saccharomyces cerevisiae CEN.PK ist.

Es ist außerdem bevorzugt, dass der Hefestamm ein CEN.PK1 1 1 -61 A Stamm ist.

Es ist außerdem bevorzugt, dass der Hefestamm ein AH22tH3ura8 Stamm ist.

Die Erfindung macht es möglich, große Mengen an Betulinsäure in Hefe zu produzieren. Dadurch können sowohl die hohen Mengen an Lösungsmitteln sowie die aufgrund der mehrfachen

Destillationsschritte große Mengen an Energie, die im Stand der Technik zur Produktion benötigt werden, eingespart werden. Neben diesen ökologisch relevanten Fakten ist die Gewinnung aus Baumrinden nicht wirtschaftlich und nachhaltig, da diese Bäume nicht für die Kultivierung in Plantagen geeignet sind. Des Weiteren wirft ein 20 Jahre alter Baum mit einer Höhe von 10 m nur einige Kilogramm der Rinde pro Jahr ab. Für die Gewinnung von 1 kg Betulinsäure müsste die Jahresproduktion an Borke von ca. 30 Platanen-Bäumen aufgearbeitet werden. Sofern eine Kultivierung in Plantagen möglich wäre, würde man eine Nutzfläche von mindestens 300 Quadratmetern für die Produktion von 1 kg Betulinsäure benötigen. Die tatsächliche Fläche ist aber weitaus höher, da eine Plantagenkultivierung der Platanen nicht möglich ist. Durch die Erfindung konnte eine Produktkonzentration von beispielsweise 10 % und mehr bezogen auf die Biotrockensubstanz erreicht werden. Man würde daher eine Nutzfläche von nur ca. 20

Quadratmetern pro kg Betulinsäure (für Zucker) mit dem neuen biotechnologischen Verfahren benötigen. Mit dem herkömmlichen Verfahren aus Weidenrinde wird ein Vielfaches der Fläche von 300 Quadratmetern pro kg Betulinsäure benötigt.

Ein weiter entscheidender Vorteil ist, dass pentazyklische Triterpene/Triterpenoide in pflanzlichen Ressourcen nur in Form von Gemischen vorkommen, so dass die Aufreinigung einzelner Komponenten sehr aufwendig ist. Im Gegensatz dazu kommt es in Hefe nur zu einer sehr geringen bis keiner Bildung weiterer zyklischer Triterpene/Triterpenoide (abgesehen von Sterolen), da diese keine nativen Metabolite in Hefe darstellen. Dadurch wird in Hefe bei der Synthese eine hohe Reinheit der pentazyklischen Triterpene erreicht, was die Aufreinigungs kosten für das Produkt deutlich verringert. Ein weiterer wesentlicher Nachteil der pflanzlichen Produktion sind die besonders bei Freiluftkultivierungen auftretenden Schwankungen in Qualität und Quantität der Pflanzen beziehungsweise Bäume aufgrund von unvorhersehbaren Umwelteinflüssen. Gerade für die pharmazeutische Industrie stellt dies häufig ein Problem dar, weil eine konstante Rohstoffqualität eine entscheidende Bedeutung für die spätere Qualität des Produktes hat. Zudem können Ernteausfälle zu massiven Engpässen des Produktes führen. Ein bemerkenswertes Beispiel dazu, ist die im Jahre 2005 infolge von Ernteausfällen und fehlenden alternativen Ressourcen aufgetretene Knappheit des Antimalaria Wirkstoffes Artemisinin, was zu einer dramatischen Unterversorgungen in der dritten Welt geführt hat (McNeil et al. , 2004). All diese Probleme werden durch die Stämme der Erfindung gelöst.

Durch den Einsatz eines mikrobiellen Herstellungsverfahrens können in hohem Maße

Ressourcen gespart werden. Einerseits werden natürliche Pflanzenressourcen geschützt und Limitierungen durch begrenztes Vorkommen der Ressourcen werden aufgehoben. Weiter werden Aufarbeitungshilfsmittel gespart, da in Hefe höhere Konzentrationen und höhere Reinheiten zu erwarten sind. Hinzu kommt, das umweltbelastende und teure Aufreinigungsverfahren ersetzt werden können.

In einer weiteren bevorzugten Ausführungsform betrifft die Erfindung ein Verfahren zur

Herstellung eines zuvor beschriebenen modifizierten Hefestamms umfassend die folgenden Schritte:

a) Bereitstellung eines Saccharomyces cerevisiae Stamms,

b) Transformation mit einem Vektor umfassend ein Gen zur Kodierung einer

Oxidosqualenzyklase, (wobei das Gen eine Sequenz umfasst, ausgewählt aus der Gruppe umfassend Nukleinsäuren gemäß Accession Number AB05551 1 , AB025343, AB663343, NMJ 79572, AB181245, DQ268869,

AB025345, AB1 16228, JQ087376, H M 623871 , AB289586, AB055512) und/oder, c) Transformation eines Vektors umfassend ein Gen zur Kodierung einer

NADPH-Cytochrom P450 Reduktase (wobei das Gen eine Sequenz umfasst, ausgewählt aus der Gruppe umfassend Nukleinsäuren gemäß Accession

Number AB433810, X66016, X69791 , XM_003602850, NM_001 179172, X66017, JN594507, DQ984181 , DQ318192, AF302496, AF302497, AF302498, L07843, AF024635, AF024634, FJ719368, FJ719369),

und/oder

d) Transformation eines Vektors umfassend ein Gen zur Kodierung einer

Cytochrom P450 Monooxygenase(, wobei das Gen eine Sequenz umfasst, ausgewählt aus der Gruppe umfassend Nukleinsäuren gemäß Accession

Number AB619802, AB619803, DQ335781 , JN565975, XM_002331391 ,

XM_003525274, JF803813, XM_004139039, GU997666, JX036032, XM_002522891 , AM457725, XM_002265988, XM_002527956, BT147421 , XM_003530477, BT096613, XM_002309021 , BT051785, XM_002513137, XM_002264607. XM_002324633, XM_003531801 , XM_002280933.) Besonders bevorzugt sind Verfahren zur Herstellung eines zuvor beschriebenen modifizierten Hefestamms umfassend die Schritte nur b), b) und c), b) und d) oder b), c) und d). Die daraus resultierenden Hefestämme sind weiterhin als Gegenstand der Erfindung zu betrachten.

Es ist bevorzugt, dass das Verfahren zusätzlich den Schritt der Transformation mit einem Vektor umfassend das tHMG1-Gen umfasst.

Als Vektor kann jeder bekannte Vektor mit jedem möglichen Transformationsverfahren erfindungsgemäß eingesetzt werden, wie z. B. einem linearen Vektor, einem zirkulären Vektor, einem viralen Vektor oder einem bakteriellen Vektor. Vorzugsweise umfasst der Vektor lineare DNA oder zirkuläre DNA, bevorzugte zirkuläre DNA, insbesondere ein Plasmid. Der Vektor kann durch ein beliebiges Verfahren in die Zelle eingebracht und kann bevorzugt in Kombination mit Transfektionsreagenzien transformiert werden (z. B. Lithiumacetat, Polyethylenimin (PEI), Fugene, LT-1 , jetPEI, transfectamine, Lipofectamin, UptiFectin, PromoFectin, Geneporter, Hilymax, Kohlenstoff-Nanofasem, Kohlenstoff-Nanoröhren zellpenetrierenden Peptide (CPP), Proteintransduktionsdomänen (PTDs ), Liposomen, DEAE-Dextran, Dendrimere). Die

Transformation kann optional mit Elektroporation, einer Genkanone, optische Transfektion, Elektrotransfer, impalefection, Magnetofektion und/oder Magnet-unterstützte Transfektion durchgeführt werden.

Vorzugsweise ist der Vektor ein zirkulärer DNA-Vektor, besonders bevorzugt ist der Vektor ein Plasmid. Das Plasmid kann jedes bekanntes Plasmid sein, wie zB YEpH2, pUC19, pMA oder pMK. Der Vektor kann auch eine lineare Expressionskassette sein, die möglicherweise nicht in das Genom der Zielzelle integriert werden kann.

Es war außerdem die Aufgabe der Erfindung ein Verfahren zu entwickeln, welches die mikrobielle Produktion von deutlich mehr pentazyklischen Triterpenoiden in Hefe ermöglicht. Das

erfindungsgemäße Verfahren ist daher in einigen Ausführungsformen dadurch gekennzeichnet, dass die durch das Verfahren produzierten pentazyklischen Triterpenoiden n ter anderem antientzündlich,

232323232323232323232323232323232323232323232323232323232323 2323232323232323 232323232323232323232323232323232323232323232323232323232323 2323232323232323 2323232323232323232323232323232323232323 eine intrazelluläre Konzentration von mehr als 1 , 2, 3, 4, oder 5 mg pro Gramm Biotrockensubstanz aufweisen.

In einer anderen bevorzugten Ausführungsform der Erfindung betrifft diese ein Verfahren zur Herstellung von pentazyklischen Triterpenoiden, wobei ein zuvor beschriebener modifizierter Hefestamm für die Produktion verwendet wird.

Für die heterologe Genexpression in Hefe und somit die Synthese von pentazyklischen

Triterpenoiden über ein zyklisches Zwischenprodukt wurden die Pflanzen-Gene aus den Gruppen (Tab. 1 - 3) in verschiedenen Kombinationen gewählt und in einen geeigneten Hefestamm eingebracht.

Ein wichtiger Vorteil der Erfindung liegt darin, dass ein besonders umweltschonender

Produktionsprozess zur mikrobiellen Produktion von pentazyklischen Triterpenoiden bereitgestellt wurde. Durch die Erfindung konnte somit neben der Konstruktion eines pentazyklischen

Triterpenoid (bevorzugt Betulin, Betulinaldehyd und/oder Betulinsäure) produzierenden und anreichernden Hefestammes, auch die Etablierung eines umweltschonenden und nachhaltigen Fermentations- und Aufreinigungsprozesses zur Verfügung gestellt werden. Es ist somit nun möglich z.B. 20 g Betuli nsäure mittels des neu etablierten Produktionsprozesses zu produzieren.

Durch den Triterpen/Triterpenoid-Herstellungsprozess der Erfindung werden bevorzugt ressourcenschonende Abfallstoffe und Nebenprodukte der Zuckerindustrie (z.B. Melasse) oder Biodieselproduktion (z.B. Glycerin) als Substrate genutzt. Zur Isolation der Betuli nsäure wurde ein bereits etabliertes und umweltschonendes Autolyseverfahren an den Prozess adaptiert.

Anstelle von organischen Lösungsmitteln wird im neuen Verfahren zum Großteil mit Wasser gearbeitet, was den Prinzipien der Grünen Chemie entspricht. Es werden für die Produktion von 1 kg Betulinsäure ca. 2000 Liter Wasser eingesetzt. Wasser ist aus ökologischer,

ökotoxikologischer und gesundheitlicher Sicht verträglicher als organische Lösungsmittel.

Organische Lösungsmittel können lediglich bei der Extraktion benötigt werden. Aufgrund der höheren Produktkonzentration ist der Bedarf an organischen Lösungsmitteln um 70 bis 90% geringer als beim Platanen-Vergleichsprozess.

Ungeachtet der ökologischen Vorteile, kann außerdem festgehalten werden, dass das neue Verfahren einen höheren Massenindex (Einsatzmassen in kg/kg Produkt) aufweist als die Referenzverfahren aus dem Stand der Technik.

Die Erfindung zeigt vor allem die folgenden Vorteile:

Vermeidung von direktem Eingriff in die Natur durch Gewinnung der Rinde

- Verringerung von Transportwegen durch zentrale Produktion ohne aufwändige

Bio massebeschaff ung

Verwendung von Abfall- oder Nebenprodukte als Substrat (Nebenprodukte der

Zuckerindustrie oder der Biodiesel-Produktion)

Hohe Raum-Zeit-Ausbeute und dadurch geringe Umweltbelastung (durch geringen Energieverbrauch da kleine Reaktorvolumina)

Hohe und einstellbare Produktkonzentration erlaubt geringen organischen

Lösungsmittelverbrauch

Hohe und konstante Qualität des Produktes durch Unabhängigkeit von Umwelteinflüssen

Einfache Produktion und Genehmigung des Verfahrens durch Wahl des industriell etablierten Wirtes Saccharomyces cerevisiae

Einfache Möglichkeit auf schwankende oder steigende Nachfrage zu reagieren

Die folgenden Gensequenzen werden besonders bevorzugt für die Kodierung von

Oxidosqualenzyklasen (OSCs) eingesetzt:

SEQ ID No 1. Betula platyphylla OSCBPW mRNA für Lupeolsynthase, complete cds, AB05551 1 ATGTGGAAGTTGAAGATAGCGGAAGGAGGGCCAGGGCTGGTGAGCGGAAATGATTTCATC GGG CGGCAACACTGGGAATTCGACCCGGATGCCGGCACTCCCCAAGAGCGTGCTGAAGTTGAA AAG GTCCGGGAGGAGTTCACCAAAAATCGGTTTCAGATGAAACAAAGCGCTGATCTTTTGATG AGGAT GCAGCTTAGGAAGGAGAACCCATGCCAACCAATTCCACCACCAGTGAAAGTGAAAGAAAC AGAG GTGATAACAGAGGAAGCAGTGATTACTACACTGAGAAGATCACTAAGCTTTTATTCCTCC ATTCAA GCTCATGATGGCCACTGGCCTGGTGAATCTGCTGGCCCCTTGTTTTTCCTTCAACCCTTT GTAAT GGCATTATACATCACTGGAGATCTCAATACTATTTTTTCCCCAGCACACCAGAAGGAAAT TATTCG ATACTTGTATAATCATCAGAACGAAGATGGAGGCTGGGGGTTCCATATAGAGGGTCACAG CACAA TGTTTGGGTCAGCTTTGAGCTACATTGCCTTGAGAATACTTGGAGAGGGACTTGAAGATG GTGAA GATGGG GCTATG GCTAAAAGCCG G AAATGG ATTCTTGACCATG GTGGTTTAGTGGCTATTCCTTC ATGGGGAAAGTTTTGGGTCACGGTACTGGGACTGTATGAGTGGTCAGGCTGCAATCCACT GCCC CCAGAGTTCTGGTTTCTTCCTGATATCTTTCCCATACATCCAGGTAAAATGTTATGCTAC TGTCGC TTGGTTTACATGCCAATGTCTTATTTATATGGGAAGAGGTTTGTTGGTCCAATCACTGGA TTGATT CAATCACTTAGACAAGAGTTATATAACGAGCCTTACCATCAAATTAACTGGAATAAAGCC CGGAGT ACAGTTGCAAAGGAGGATCTCTACTATCCGCATCCCCTCATACAAGATCTGCTATGGGGA TTTCTT CACCATGTAGCCGAGCCTGTCCTGACGCGTTGGCCCTTTTCAATGCTGAGAGAGAAGGCA CTCA AAGCTGCAATTGGTCATGTACATTATGAGGACGAGAACAGCAAATACCTTTGCATTGGAA GCGTT GAAAAGGTATTATGTTTGATTGCCTGTTGGGCTGAAGATCCAAATGGGGAGGCATACAAG CTTCA TCTAGGAAGGATTCCAGACAACTATTGGGTTGCTGAAGATGGCTTAAAAATTCAGAGTTT CGGCT GTCAGATGTGGGATGCGGGTTTTGCTATTCAAGCAATTCTCTCTTGCAATTTAAACGAAG AGTATT GGCCAACACTTCGTAAAGCACATGAGTTTGTAAAGGCTTCACAGGTCCCAGAAAACCCTT CTGGG GACTTCAAAGCCATGTACCGCCACATAAACAAAGGAGCATGGACATTCTCGATGCAGGAC CATGG ATGGCAGGTCTCTGACTGCACCGCTGAAGGGCTGAAGGTTGCAATCTTGTTCTCGCAAAT GCCTC CGGACCTTGTTGGGGAAAAAATTGAGAAAGAGCGGTTATATGATGCTGTGAATGTCATTC TTTCTC TACAAAGTAGCAATGGTGGTTTCCCAGCATGGGAGCCTCAAAGAGCATATGGTTGGTTGG AGAA GTTCAACCCCACGGAATTCTTTGAAGATACCCTTATTGAGCGAGAGTACGTAGAGTGCAC TTCAC CTGCAGTTCATGGTCTGGCACTCTTTAGGAAGTTCTATCCCCGGCACCGGGGGACGGAGA TAGA TAGTAGCATTTACAGGGGAATTCAATACATTGAAGACGTGCAAGAACCTGATGGATCATG GTATG GTCATTGGGGGATTTGCTACACCTACGGTACATGGTTTGCTGTAGGGGCACTGGCAGCTT GTGG AAGAAACTACAAAAATTGTCCTGCATTGCGCAAATCTTGTGAATTTTTGCTATCAAAGCA GCTACC TAATGGTGGATGGGGAGAAAGTTACCTATCAAGCCAAAACAAGGTGTGGACGAATATAGA AGGCA ACCGTGCAAATTTGGTCCAAACAGCATGGGCCTTGTTATCCCTCATTGATGCTAGGCAGG CCGAG ATAGATCCAACACCAATTCATCGTGGAGTAAGAGTATTGATCAATTCACAGATGGAAGAT GGTGA CTTTCCTCAACAGGAAATCACTGGAGTATTTATGCGAAACTGCACACTAAACTACTCATC ATATAG AAACATTTTTCCGATATGGGCTCTTGGAGAATATCGGAGGCGAGTTCTATTTGCATGA

SEQ ID No 2. Olea europaea OEW mRNA for lupeol synthase, complete cds, AB025343

ATGTGGAAGTTGAAGATTGCTGATGGAACAGGGCCGTGGCTTACAACAACCAATAAT CATATTGG AAGACAGCATTGGGAATTCGATCCTGAGGCTGGAACTCCAGATGAACGAGTCGAGGTTGA AAGA CTGCGTGAAGAGTTCAAGAAGAACAGATTTCGAACTAAACAAAGTGCTGATTTGCTGATG CGTAT GCAGCTTGTGAAGGAGAACCAACGTGTTCAAATCCCACCAGCGATCAAAATCAAAGAAAC AGAAG GTATAACAGAGGAAGCAGTGATAACTACTCTAAGAAGAGCCATAAGTTTCTATTCCACAA TTCAAG CTCACGATGGCCACTGGCCAGCTGAATCCGCCGGCCCTTTGTTTTTCCTCCCTCCTTTGG TCTTA GCCTTGTATGTGACTGGAGCAATCAATGTTGTTCTATCGCGAGAACATCAGAAAGAGATT ACACG ATACATATACAATCATCAGAATGAAGATGGAGGTTGGGGGATACATATAGAGGGTCATAG CACCA TGTTTGGTTCTGTGCTTAGCTACATTACGCTTAGGTTGCTAGGAGAAGGACAAGAAGATG GTGAA GACAAGGCCGTAGCTAGAGGTCGAAAATGGATACTTGACCATGGTGGCGCCGTGGGGATA CCAT CGTGGGGTAAGTTTTGGCTTACGGTGCTCGGAGTATACGAGTGGGATGGCTGCAACCCAA TGCC CCCAGAATTCTGGCTGCTTCCCAATTTTTCCCCAATTCATCCAGGAAAGATGTTGTGTTA TTGTCG GTTGGTATACATGCCCATGTCATATTTGTATGGCAAGAGGTTTGTTGGACCAATTACTGG ATTGGT GCTATC ACTAAG GC AAG AG ATTTATACTG AACCTTATC ATGG AATAAATTG GAATAGG GC AAGG AA CACCTGTGCAAAGGAGGATCTTTACTACCCACACCCTCTGGCACAAGATATGCTTTGGGG ATTCC TCCATCATTTTGCCGAGCCAGTTCTAACTCGATGGCCGTTTTCTAAACTAAGAGAGAAGG CTTTAA AAGTTGCAATGGAGCATGTTCATTATGAGGACATGAACAGCAGATACCTTTGCATTGGAT GTGTA GAGAAGGTGTTATGTCTTATTGCTTGTTGGGTAGAAGATCCTAATTCTGAAGCATACAAA AGACAT ATAGCACGTATACCTGATTACTTCTGGGTCGCCGAAGATGGCCTGAAAATGCAGAGTTTT GGGTG TCAAATGTGGGATGCAGCTTTTGCTATTCAAGCCATATTATCATCCAATCTAGCTGAAGA GTACGG GCCGACCCTCATGAAAGCACACAACTTTGTGAAAGCCTCACAGGTCCAAGAAAATCCATC TGGAG ATTTTAATGAAATGTATCGTCACACTTCTAAAGGCGCCTGGACATTTTCTATGCAAGATC ATGGTT GGCAAGTCTCAGATTGTACAGCTGAAGGACTTAAGGCCGCACTCTTATTCTCGCAAATGC CTATA GAACTAGTTGGAGCAGAAATCGAAACAGGACATTTATATGATGCTGTAAATGTCATTTTG ACCCTT CAGAGTGCTAGTGGCGGTTTTCCAGCATGGGAGCCTCAGAAAGCATATCGATGGTTGGAG AAGC TCAACCCTACAGAGTTTTTTGAAGATGTTCTTATAGAGCGAGATTATGTAGAGTGCACAT CATCAG CAGTCC AAGCCTTAAAG CTCTTTAAG CAGTTGC ATCC AGG AC AC AG AAG AAAG GAAATAGC AAGC TGCATCTCAAAAGCAATACAATACATCGAAGCTACTCAAAATCCTGATGGTTCATGGGAT GGTAGT TGGGGAATATGCTTTACGTATGGCACGTGGTTTGCAGTAGAGGGCTTGGTCGCTTGTGGG AAAA ATTATCATAACTCTCCCACACTACGGAGAGCATGTGAATTTTTGTTGTCGAAACAATTAC CGGATG GTGGATGGAGTGAAAGCTACCTTTCGAGCTCGAACAAGGTATATACTAATCTTGAAGGTA ATCGG TCAAATTTGGTGCAAACCTCATGGGCTCTGTTGTCTCTCATCAAAGCTGGGCAGGTCGAG ATTGA TCCTGGGCCTATACATCGTGGAATAAAACTGCTAGTAAATTCACAAATGGAAGATGGTGA CTTTCC TCAAGAGGAAATTACAGGAGCATTCATGAAGAATTGTACTCTGAACTATTCATCGTACCG GAATAT CTTTCCAATATGGGCTCTCGGTGAGTATCGTCGTCGGATTCTTCATGCACAAACATAG SEQ ID No 3. Glycyrrhiza uralensis GuLUPI mRNA for lupeol synthase, complete cds, AB663343

ATGTGGAAGCTGAAGATAGGAGAAGGAGGAGCGGGGTTGATTTCCGTGAACAACTTC ATCGGAC GGCAACACTGGGAGTTCGATCCAAATGCAGGAACTCCACAGGAACACGCTGAGATTGAAA GGCT ACGCCGGGAATTCACCAAAAACCGTTTTTCCATCAAACAAAGCGCTGACCTCTTGATGAG AATGC AGCTCAGAAAGGAGAACCATTACGGCACCAATAATAATATTCCAGCAGCAGTGAAATTGA GTGAC GCAG AG AACATAACGGTGG AAGCATTGGTTACAACAATTAG AAGGGCTATCAGTTTCTATTCCTC AATTCAAGCCCATGATGGACACTGGCCTGCAGAATCTGCTGGCCCTCTCTTTTTCCTTCA ACCATT GGTAATGGCCCTATATATTACAGGATCCCTTGATGACGTTTTAGGACCTGAACATAAGAA GGAAAT TGTTCGCTATTTGTATAATCATCAGAATGAAGATGGTGGGTGGGGATTCCATATAGAGGG TCATA GCACAATGTTTGGATCTGCATTGAGCTACGTTGCATTAAGGATACTTGGAGAAGGGCCTG AAGAC AAGGCAATGGCCAAAGGCAGAAAATGGATCCTCGACCACGGTGGTTTAGTTGCTATTCCA TCATG GGGAAAGTTCTGGGTCACGGTACTTGGAGCTTATGAGTGGTCAGGCTGCAATCCACTTCC ACCA GAGTTATGGCTTCTGCCCAAATTCACCCCTTTTCATCCAGGAAAAATGTTGTGCTACTGT CGCTTG GTTTACATGCCCATGTCATATTTATATGGGAAGAAGTTCGTGGGCCCTATCACTGCCTTA ATCAGA TCACTACGAGAAGAATTGTACAATGAGCCTTATAATCAAATTAACTGGAATACAGCTCGA AACACT GTTGCTAAGGAGGATCTCTACTACCCACATCCTCTGATCCAAGATATGTTATGGGGATTT CTTTAT CACGTGGGAGAGCGTTTTCTGAATTGCTGGCCCTTTTCCATGCTTAGACGGAAGGCATTA GAAAT CGCAATTAATCATGTACATTACGAGGACGAGAACAGTAGATACCTTTGCATTGGCAGTGT AGAGA AGGTGTTATGTTTGATTGCGCGTTGGGTTGAAGATCCCAACTCAGAGGCATACAAACTTC ATTTAG CCCGAATCCCTGATTACTTCTGGCTCGCTGAAGATGGCTTGAAAATCCAGAGCTTTGGGT GCCAG ATGTGGGATGCAGCATTCGCTATACAAGCAATACTTGCCTGTAATGTGAGTGAGGAGTAT GGACC TACGCTCCGGAAAGCACACCACTTCGTGAAGGCTTCGCAGGTTCGCGAAAACCCATCCGG TGAC TTCAACGCAATGTACAGACACATTTCGAAAGGAGCATGGACATTCTCAATGCATGATCAC GGTTG GCAAGTCTCTGACTGCACCGCAGAAGGACTAAAGGCTGCACTGCTATTGTCAGAAATGCC AAGT GAACTAGTTGGGGGGAAAATGGAAACAGAGCGCTTCTACGACGCTGTTAATGTCATCCTC TCTCT ACAAAGCAGTAATGGCGGGTTCCCTGCTTGGGAGCCTCAGAAAGCGTACCGTTGGTTAGA GAAA TTCAATCCAACTGAATTCTTTGAAGACACTATGATTGAGAGGGAGTATGTTGAGTGCACT GGATCC GCAATGCAAGGGTTGGCTCTCTTCAGAAAGCAATACCCACAGCACAGAAGCAAGGAAATA GATC GCTGCATTGCCAAAGCAATCCGTTACATAGAAAACATGCAAAATCCTGATGGCTCTTGGT ATGGG TGTTGGGGAATTTGCTATACATACGGTACATGGTTTGCCGTGGAGGGACTAACGGCCTGT GGGA AGAACTGCCACAACAGTCTTTCCTTGCGAAAAGCTTGTCAATTCTTGTTGTCAAAGCAGC TTCCTA ATGCGGGGTGGGGAGAAAGTTACTTGTCAAGCCAAAACAAGGTGTATACAAACCTAGAAG GAAA CCGTGCAAATTTAGTTCAAAGTTCGTGGGCTTTGTTGTCCCTTACTCATGCAGGGCAGGC CGAGA TAGATCCTACACCCATACACCGTGGAATGAAGTTACTCATCAATTCACAAATGGAAGATG GAGACT TCCCACAGCAGGAGATTACAGGAGTATTTATGAGGAACTGTACCCTGAACTACTCATCGT ATCGA AACATCTTTCCCATATGGGCTATGGGAGAGTATCGTCGCCAAGTCTTGTGTGCTCACAGT TATTG A

SEQ ID No 4. Arabidopsis thaliana lupeol synthase 1 (LUP1 ) mRNA, complete cds, NM_179572

ATGTGGAAGTTGAAGATAGGAAAGGGAAATGGAGAAGATCCGCATTTATTCAGCAGC AATAACTT CGTCGGACGTCAAACATGGAAGTTTGATCACAAAGCCGGCTCACCGGAGGAACGAGCTGC CGTC GAAGAAGCTCGCCGGGGTTTCTTGGATAACCGTTTTCGTGTTAAAGGTTGCAGTGATCTA TTGTG GCGAATGCAATTTCTAAGAGAGAAGAAATTCGAACAAGGCATACCACAACTAAAAGCTAC TAACAT AGAAGAAATAACGTATGAAACAACGACAAATGCATTACGAAGAGGCGTTCGTTACTTCAC GGCTT TGCAAGCCTCCGACGGCCATTGGCCGGGAGAAATCACCGGTCCGCTTTTCTTCCTTCCTC CTCTC ATATTTTGTTTGTACATTACCGGACATCTGGAGGAAGTATTCGATGCTGAACATCGCAAA GAGATG CTAAGACATATCTATTGTCACCAGAACGAAGATGGTGGATGGGGATTACACATCGAAAGC AAGAG TGTTATGTTCTGCACCGTGTTGAATTACATATGTTTACGTATGCTTGGAGAAAATCCTGA ACAAGA CGCATGCAAACGAGCTAGACAATGGATTCTTGACCGCGGTGGAGTGATCTTTATTCCTTC TTGGG GGAAATTTTGGCTCTCGATACTTGGAGTCTATGATTGGTCTGGAACTAATCCGACGCCAC CAGAA CTCTTGATGCTGCCTTCTTTTCTTCCAATACATCCAGGGAAAATTTTGTGTTATAGCCGG ATGGTT AGTATACCTATGTCGTATCTATATGGGAAGAGGTTTGTTGGTCCAATTACACCTCTTATT TTACTCT TGCGCGAAGAACTTTACTTGGAACCTTATGAAGAAATCAATTGGAAAAAAAGTCGACGTC TATATG CAAAAGAAGACATGTATTATGCTCATCCTTTGGTTCAAGATTTGTTATCTGACACTCTTC AAAACTT TGTGGAGCCTTTACTTACACGTTGGCCATTGAACAAGCTTGTGAGGGAAAAAGCTCTTCA GCTTA CTATGAAACACATACACTATGAAGACGAAAATAGCCATTACATAACCATTGGATGTGTTG AAAAGG TACTGTGCATGCTAGCTTGTTGGGTTGAAAATCCGAATGGAGATTATTTCAAGAAGCATC TGGCTA GAATTCCAGATTATATGTGGGTCGCTGAAGATGGAATGAAAATGCAGAGCTTTGGATGTC AACTG TGGGATACTGGATTTGCTATTCAAGCTTTGCTTGCAAGTAATCTCCCTGATGAAACTGAT GATGCA CTAAAGAGAGGACATAATTACATAAAGGCATCTCAGGTTAGAGAAAACCCTTCAGGTGAT TTTAGG AGCATGTACCGCCACATTTCGAAAGGAGCATGGACATTTTCTGATCGAGATCATGGATGG CAAGT TTCAGATTGTACAGCTGAAGCTTTAAAGTGTTGCCTGCTGCTTTCCATGATGTCAGCTGA TATCGT CGGCCAGAAAATAGATGATGAACAATTATATGACTCTGTTAACCTCTTGCTGTCTTTACA GAGCGG AAATGGAGGTGTCAATGCGTGGGAGCCATCCCGTGCATATAAATGGTTGGAACTGCTCAA TCCTA CAGAATTCATGGCTAATACCATGGTCGAGCGGGAGTTTGTGGAATGCACCTCATCTGTTA TACAA GCACTTGATCTATTTAGAAAATTGTATCCAGATCACAGGAAGAAAGAGATCAACAGGTCC ATCGAA AAAGCTGTGCAATTTATACAAGACAATCAAACACCAGACGGTTCATGGTACGGAAATTGG GGTGT TTGCTTC ATTTACG CTACTTGGTTTG CTCTTGG AG GCCTAG CAGC AGCTGGTG AAACTTAC AACG ATTGTTTAGCTATGCGCAATGGTGTCCACTTTTTGCTCACGACACAAAGAGATGATGGAG GTTGG GGTGAAAGCTATTTATCATGCTCCGAACAGAGATATATACCATCAGAAGGAGAAAGATCA AACCTT GTGC AAAC ATC ATG GGCTATGATG GCTCTAATTC ATACGG G ACAGGCTG AG AG AG ATTTGATTCC TCTTCATCGTGCTGCCAAACTTATCATCAATTCACAACTTGAAAACGGCGATTTTCCTCA ACAGGA AATAGTAGGAGCGTTCATGAATACATGCATGCTACACTATGCTACATACAGAAACACCTT CCCATT ATGGGCACTCGCAGAATACCGAAAAGTTGTGTTTATCGTTAATTAA SEQ ID No 5. Lotus japonicus OSC3 mRNA for lupeol synthase, complete cds, AB181245

ATGTGGAAGTTGAAGGTAGCAGAAGGAGGAAAAGGGTTGGTTTCTGTGAGCAATTTCATC GGAA GGCAACACTGGGTGTTCGACCCAAATGCAGGGACACCACAAGAACATGAGGAGATTGAAA GGAT GCGCCAAGAATTCACCAAAAATCGATTCTCCATCAAACAAAGTGCAGACCTCTTGATGAG AATGC AGCTGAGAAAGGAGAACCCTTGTGGGCCCATCCCACCAGCAGTTAAATTGAGAGATGTGG AAAA GGTAACTGCAGAAGCATTGATCACTACAATTAGAAGGTCCATCACCTTTTATTCTTCAAT TCAAGC CCATGATGGCCACTGGCCTGCTGAATCTGCAGGCCCATTATTCTTCGTTCAACCTTTGGT AATGG CACTGTACATTACAGGATCCCTTGATGATGTATTAGGACCTCAACACAAGAAGGAAATTA TTCGAT ATTTGTATAATCATCAGAACGAAGATGGGGGTTGGGGATTCCACATAGAGGGTCATAGTA CCATG TTTGGATCTGCATTGAGCTACATTGCATTGAGGGTACTTGGACAAAGCCTTGAAGATGGT GAGGA CATGGCAGTGGCCAGAGGCAGAAAATGGATCCTCGATCATGGCGGTTTAGTAGCTATTCC ATCAT GGGGAAAGTTCTGGGTCACGGTGCTAGGGGTTTATGAGTGGTCAGGGTGCAATCCCCTTC CACC AGAGTTCTGGCTTCTACCCAAAATTTTCCCTATTCATCCAGGGAAAATGTTATGTTACTG TCGCTT AGTTTACATGCCCATGTCATATTTATATGGAAAGAAGTTTGTAGGCCCAATCACTGCCTT AGTCAG ATCACTAAGAAAAGAATTGTACAATGAGCCTTATGATCGAGTTGACTGGAATAAGGCCCG CAACA CTGTTGCTAAGGAGGATCTATACTATCCCCATCCTCTAATCCAAGACATGTTATGGGGAT TTCTTC ATCATGTGGGAGAGCGTGTTCTGAACACTTGGCCATTTTCAATGCTAAGACAGAAGGCAA TAGAA GTTGCTATTAATCATGTACGTTACGAGGATGAGACCACTAGGTACCTTTGCATTGGAAGT GTAGA GAAGGTGTTATATTTGATTGCGCGTTGGGTTGAAGACCCCAACTCAGAGGCTTACAAACT TCATTT AGCCCGAATCCCTGATTACTTCTGGCTTGCAGAAGATGGCTTGAAAATCCAGAGTTTTGG CTGCC AAATGTGGGATGCAGCATTTGCTATTCAAGCAATACTGAGTGGTAATGTGAGTGAAGAGT ATGGA CCAACATTAAAGAAAGCACACCACTTTGTGAAGGCTTCGCAGGTACGTGAAAACCCATCC GGTGA CTTCAAAGCAATGTACAGACACATTTCCAAAGGGGCATGGACATTCTCAATGCATGATCA TGGAT GGCAAGTCTCTGATTGCACAGCAGAAGGACTAAAGGTTGCACTCCTACTGTCAGAAATGT CAGAT GATCTAGTTGGGGCAAAAATGGAAACAGAGCAATTCTATGATGCTGTTAATGTCATCCTC TCTCTA CAAAGCAGCAATGGTGGTTTCCCTGCTTGGGAGCCTCAAAGAGCCTACCAATGGTTAGAG AAATT CAATCCAACTGAATTCTTTGAAGAAACTCTGATTGAGAGGGAGTATGTAGAGTGCACTGG TTCAG CAATGCAAGCCCTGGCTCTTTTCAGAAAGCTATACCCGAAGCATAGGCGAAAGGAAATAG ATCGC TGCATTTCCAAAGCAATCCGATACATTGAAAACACACAAAATCCTGATGGGTCTTGGTAT GGTTGC TGGGGAATTTGCTACACTTATGGTACCTGGTTTGCAGTGGAAGGACTAACAGCTTGTGGG AAGAA CTTCCAAAATAGTGTTACCTTGCGTAGAGCATGTAAATTTTTGTTGTCAAAGCAGCTTCC TAATGG AGGGTGGGGAGAAAGTTACTTGTCAAGCCAAGACAAGGTGTACACAAACATTGAAGGAAA ACGT GCAAATTTGGTTCAAAGTTCATGGGCTTTGTTGTCACTTATGCGTGCTGGGCAGGCTGAG ATAGA TCCGACACCAATTCACCGTGGAATAAGGTTACTCATTAATTCACAAATGGATGATGGAGA CTTCCC ACAACAGGAGATTACAGGAGTATTTATGAGGAACTGTACCCTAAACTACTCATCATATCG AAACAT CTTTCCTATATGGGCTCTTGGAGAGTACCGTCGCAGAGTCTTATGTGCATGA SEQ ID No 6. Ricinus communis lupeol synthase mRNA, complete cds, DQ268869

ATGTGGCGAATTAAAATAGCTGAGGGAGGAAATAACCCTTATATTTATAGCACAAACAAT TTTCAG GGAAG GC AAATTTGGGTATTTG ATCCTAATGCTG GTACTCCTG AAG AAC AAGCCG AG GTTG AAG A AGCTCGTCAAAACTTCTGGAAAAATCGATTTCAGGTCAAGCCTAACTCTGATCTCCTTTG GCAACT CCAGTTTCTAAGGGAGAAAAATTTTAAGCAAAAAATTCCAAAAGTAAAGGTTGAAGATGG CGAGG AGATCACAAGTGAAATAGCTGCAGCCGCTTTGAGGAGAAGCGTCCACTTGTTTTCGGCCT TGCAG GCAAGCGATGGCCATTGGTGTGCAGAAAATGGAGGCCTGCTGTTCTTTTTGCCTCCCTTG GTTTT TGCTGTCTACATTACAGGACACCTTAATACTGTATTTTCTCCAGAGCATCGCAAAGAAAT CCTCCG TTACATATACTGTCATCAGAATGAAGATGGTGGATGGGGAATACACATTGAAGGTCACAG CACTA TGTTTTGCACAGTTCTTAATTATATATGTATGCGTATACTTGGTGAAGCACGTGATGGTG GAATAG AAAATGCTTGTGAAAGAGGGCGAAAATGGATACTCGATCATGGTGGTGCAACTGGTATAT CTTCT TGGGGAAAGACATGGCTTTCGATACTTGGTGTGTACGAGTGGGATGGGACCAATCCCATG CCCC CAGAGTTTTGGGCCTTTCCATCTTCTTTTCCCTTACACCCAGCAAAAATGTTTTGTTACT GTCGGA TCACTTACATGCCAATGTCGTACTTGTACGGGAAGAGGTTTGTTGGTCCAATCACACCAC TCATTC TACAAATAAGAGAAGAAATCTATAATGAACCTTACAACAAAATCAAGTGGAATAGTGTGC GTCATT TATGTGCAAAGGAAGACAACTATTTTCCACATCCAACGATACAGAAACTGTTATGGGATG CTCTGT ATACATTTAGCGAGCCTCTATTCTCTCGTTGGCCCTTCAACAAATTGAGAGAGAAGGCTC TCAAGA TAACAATGGATCACATTCATTATGAAGATCACAACAGTCGGTACATCACTATTGGATGCG TTGAGA AGCCGTTATGCATGCTTGCCTGTTGGATTGAAGATCCTCATGGGGAAGCGTTTAAGAAGC ACCTT GCCAGAATTGCAGATTACATATGGGTTGGAGAAGATGGAATAAAGATGCAGAGTTTCGGA AGTCA AACATGGGACACAAGTCTAGCTCTTCAGGCCCTGATAGCTAGCGACCTCTCTCATGAAAT AGGAC CTACACTAAAACAAGGACACGTCTTCACGAAGAATTCTCAGGCAACTGAGAACCCTTCGG GCGAC TTCAGAAAAATGTTTCGTCATATCTCCAAAGGAGCTTGGACATTCTCTGATAAAGATCAA GGATGG CAAGTTTCTGATTGTACAGCAGAAAGCTTGAAGTGCTGCCTACTTTTCTCAATGATGCCT CCCGAA ATTGTTGGTGAGAAAATGGAACCTGAAAAGGTCTATGATTCAGTCAATGTCATACTTTCT CTTCAG AGCCAAAATGGTGGTTTCACAGCTTGGGAGCCAGCAAGAGCAGGATCATGGATGGAGTGG CTCA ACCCTGTAGAGTTCATGGAGGATCTTGTCGTTGAGCACGAGTATGTGGAGTGCACTTCAT CAGCA ATCCAAGCACTAGTTCTTTTTAAAAAATTATATCCCCGACACAGGAACAAAGAGATTGAA AATTGTA TCATAAATGCTGCGCAGTTCATTGAAAATATACAAGAACCTGATGGTTCATGGTATGGAA ATTGGG GGATATGCTTCTCTTATGGTACCTGGTTTGCACTGAAAGGATTAGCTGCTGCTGGAAGGA CATAT GAAAATTGTTCTGCTATTCGTAAAGGTGTTGATTTTCTACTAAAATCACAAAGAGATGAT GGTGGA TGGGCAGAGAGTTATCTTTCATGTCCAAAGAAGGTGTATGTTCCTTTTGAGGGTAATCGA TCAAAT CTAGTTCAAACTGCTTGGGCAATGATGGGTTTGATTTATGGAGGACAGGCCAAAAGAGAC CCTAT GCCTCTTCATCGCGCTGCAAAGTTATTAATTAATTCTCAAACAGATCTTGGTGATTTTCC TCAACA GGAACTTACAGGAGCATTCATGAGGAATTGCATGCTGCACTATGCACTATTTAGGAATAC TTTTCC CATTTG GGCTTTGGCAGAATATCGGCGACATGTCTTATTCCCTTCTG CTG GATTTGGTTTTG GATT CACCAATAATTTATGA

SEQ ID No 7. Taraxacum officinale TRW mRNA for lupeol synthase, complete cds, AB025345

ATGTGGAAGCTGAAAATAGCAGAAGGTGGTGATGATGAGTGGCTGACCACCACCAAC AACCACG TCGGCCGTCAGCACTGGCAGTTTGATCCGGATGCTGGAACCGAAGAGGAACGTGCTGAGA TTGA AAAGATTCGTCTCAACTTCAAACTTAATCGTTTTCAATTCAAACAAAGTGCCGACTTGTT AATGCGT ACTCAACTAAGAAAAGAGAACCCAATCAATAAAATACCGGATGCAATAAAATTGAATGAA ACAGAA GAAGTGACAAATGACGCAGTGACAACTACACTCAAAAGAGCCATTAGCTTTTACTCCACC ATTCAA GCCCATGATGGGCACTGGCCAGCTGAGTCTGCTGGCCCTTTGTTCTTCCTTCCTCCATTG GTAAT AGCACTATATGTGACTGGAGCAATGAATGATATTCTAACACCCGCACATCAGCTAGAAAT AAAACG TTACATATACAATCATCAGAATGAAGATGGAGGTTGGGGATTACATATAGAGGGTCATAG CACAAT ATTTGGATCAGTACTTAGTTACATAACTTTAAGATTACTTGGGGAAGAAGCTGATAGTGT TGCAGA GGACATGGCTTTGGTTAAGGGGCGTAAATGGATCCTTGACCATGGTGGTGCAGTTGGGAT TCCTT CATGGGGAAAGTTTTGGCTTACGATACTTGGAGTATACGAATGGGGAGGCTGTAATCCTA TGCCA CCCGAATTTTGGCTCATGCCTAAGTTTTTCCCAATTCATCCAGGCAAAATGTTGTGTTAT TGTCGC TTAGTTTACATGCCCATGTCGTACTTATACGGCAAAAGATTTGTGGGAAAAATAACCGAG TTGGTT CGAGACCTAAGGCAAGAGCTTTATACGGACCCTTATGATGAGATTAATTGGAATAAAGCA CGAAA CACGTGTGCAAAGGAAGATCTCTACTATCCACACCCTTTTGTTCAAGATATGGTATGGGG TGTACT TCATAATGTTGTTGAACCTGTATTAACAAGTCGTCCGATTTCCACACTAAGAGAAAAGGC TTTGAA AGTCGCAATGGATCATGTTCACTATGAAGATAAGAGCAGTAGATATCTTTGCATTGGATG TGTGGA AAAGGTGTTATGCTTGATTGCAACGTGGGTGGAAGATCCAAATGGTGATGCATATAAACG TCATC TTGCTAGAATTCCTGACTACTTTTGGGTTGCTGAGGATGGGATGAAAATGCAGAGTTTTG GATGT CAAATGTGGGATGCAGCATTTGCTATTCAAGCTATTTTTTCAAGTAATCTAACAGAAGAA TACGGC CCGACTCTTAAAAAAGCACACGAGTTTGTAAAAGCATCACAGGTTCGTGATAATCCTCCT GGAGA TTTCAGTAAAATGTACCGACATACTTCTAAGGGTGCATGGACATTTTCCATACAAGACCA CGGTTG GCAAGTCTCTGATTGTACCGCAGAAGGCTTGAAGGTTTCACTTTTGTACTCCCAAATGAA CCCAAA ACTAGTGGGCGAAAAAGTTGAAACGGAGCATCTCTACGACGCTGTCAATGTCATTCTTTC ATTACA AAGTGAAAATGGTGGCTTTCCTGCTTGGGAACCACAAAGGGCGTACGCTTGGCTGGAGAA ATTC AACCCCACTGAATTCTTTGAAGATGTGTTGATTGAGCGAGAGTATGTTGAATGCACTTCA TCTGCA ATCCAAGGTTTGACACTCTTCAAGAAGTTGCACCCAGGGCACAGAACCAAGGAGATCGAG CATTG TATATCAAGAGCTGTAAAGTACGTTGAAGACACACAAGAAAGTGATGGTTCATGGTATGG TTGTTG GGGAATTTGCTACACCTATGGTACATGGTTTGCGGTAGATGCGCTAGTAGCTTGTGGGAA GAACT ATCATAACTGTCCCGCTCTTCAAAAAGCTTGCAAATTTCTGTTATCCAAACAACTTCCGG ATGGTG GATGGGGAGAGAGTTATCTTTCGAGCTCAAATAAGGTGTATACGAATTTGGAGGGAAATC GTTCG AATTTAGTGCATACATCATGGGCTTTAATATCCCTTATTAAAGCTGGACAGGCTGAAATT GATCCT ACACCAATATCTAATGGCGTACGGCTTCTCATCAATTCACAAATGGAAGAAGGGGACTTT CCTCAA CAGGAAATCACAGGAGTGTTCATGAAGAACTGTAACCTCAATTACTCATCATTTCGAAAT ATTTTTC CCATATGGGCACTTGGTGAATATCGTCGTATTGTTCAAAATATATGA SEQ ID No 8. Glycyrrhiza glabra GgLUSI mRNA for lupeol synthase, complete cds, AB1 16228

ATGTGGAAGCTGAAGATAGGAGAAGGAGGAGCGGGGTTGATTTCCGTGAACAACTTC ATCGGAC GGCAACACTGGGAGTTCGATCCAAATGCAGGAACTCCACAGGAACACGCTGAGATTGAAA GGCT ACGCCGGGAATTCACCAAAAACCGTTTTTCCATCAAACAAAGCGCTGACCTCTTGATGAG AATGC AGCTCAGAAAGGAGAACCATTACGGCACCAATAATAATATTCCAGCAGCAGTGAAATTGA GTGAC GCAGAGAACATAACGGTGGAAGCATTGGTTACAACAATTACAAGGGCTATCAGTTTCTAT TCCTCA ATTCAAGCCCATGATGGACACTGGCCTGCAGAATCTGCTGGGCCTCTCTTTTTCCTTCAA CCATT GGTAATGGCCCTATATATTACAGGATCCCTTGATGACGTTTTAGGACCTGAACATAAGAA GGAAAT TGTTCGCTATTTGTATAATCATCAGAATGAAGATGGTGGGTGGGGATTCCATATAGAGGG TCATA GCACAATGTTTGGATCTGCATTGAGCTACGTTGCATTAAGGATACTTGGAGAAGGGCCTC AAGAC AAGGCAATGGCCAAAGGCAGAAAATGGATCCTCGACCACGGTGGTTTAGTTGCTATTCCA TCATG GGGAAAGTTCTGGGTCACGGTACTTGGAGCTTATGAGTGGTCAGGCTGCAATCCACTTCC ACCA GAGTTATGGCTTCTGCCCAAATTCGCCCCTTTTCATCCAGGAAAAATGTTGTGCTACTGT CGCTTG GTTTACATGCCCATGTCATATTTATATGGGAAGAAGTTCGTGGGCCCTATCACTGCCTTA ATCAGA TCACTACGAGAAGAATTGTACAATGAGCCTTATAATCAAATTAACTGGAATACAGCTCGA AACACT GTTGCTAAGGAGGATCTCTACTACCCACATCCTCTGATCCAAGATATGTTATGGGGATTT CTTTAT CACGTGGGAGAGCGTTTTCTGAATTGCTGGCCCTTTTCCATGCTTAGACGGAAGGCATTA GAAAT CGCAATTAATCATGTACATTACGAGGACGAGAACAGTAGATACCTTTGCATTGGCAGTGT AGAGA AGGTGTTATGTTTGATTGCGCGTTGGGTTGAAGATCCCAACTCAGAGGCATACAAACTTC ATTTAG CCCGAATCCCTGATTACTTCTGGCTCGCTGAAGATGGCTTGAAAATCCAGAGCTTTGGGT GCCAG ATGTGGGATGCAGCATTCGCTATACAAGCAATACTTGCCTGTAATGTGAGTGAGGAGTAT GGACC TACGCTCCGGAAAGCACACCACTTCGTGAAGGCTTCGCAGGTTCGCGAAAACCCATCCGG TGAC TTCAACGCAATGTACAGACACATTTCGAAAGGAGCATGGACATTCTCAATGCATGATCAC GGTTG GCAAGTCTCTGACTGCACCGCAGAAGGACTAAAGGCTGCACTGCTATTGTCAGAAATGCC AAGT GAACTAGTTGGGGGGAAAATGGAAACAGAGCGCTTCTACGACGCTGTTAATGTCATCCTC TCTCT ACAAAGCAGTAATGGCGGGTTCCCTGCTTGGGAGCCTCAGAAAGCGTACCGTTGGTTAGA GAAA TTCAATCCAACTGAATTCTTTGAAGACACTATGATTGAGAGGGAGTATGTTGAGTGCACT GGATCC GCAATGCAAGGGTTGGCTCTCTTCAGAAAGCAATTCCCACAGCACAGAAGCAAGGAAATA GATCG CTGCATTGCCAAAGCAATCCGTTACATAGAAAACATGCAAAATCCTGATGGCTCTTGGTA TGGGT GTTGGGGAATTTGCTATACATACGGTACATGGTTTGCCGTGGAGGGACTAACGGCCTGTG GGAA GAACTGCCACAACAGTCTTTCCTTGCGAAAAGCTTGTCAATTCTTGTTGTCAAAGCAGCT TCCTAA TGCGGGGTGGGGAGAAAGTTACTTGTCAAGCCAAAACAAGGTGTATACAAACCTAGAAGG AAAC CGTGCAAATTTAGTTCAAAGTTCGTGGGCTTTGTTGTCCCTTACTCATGCAGGGCAGGCC GAGAT AGATCCTACACCCATACACCGTGGAATGAAGTTACTCATCAATTCACAAATGGAAGATGG AGACTT CCCACAGCAGGAGATTACAGGAGTATTTATGAGGAACTGTACCCTGAACTACTCATCGTA TCGAA ACATCTTTCCCATATGGGCTATGGGAGAGTATCGTCGCCAAGTCTTGTGTGCTCACAGTT ATTGA

SEQ ID No 9. Eleutherococcus trifoliatus lupeol synthase mRNA, complete cds, JQ087376

ATGTGGAAGCTGAAGATAGCCGAAGGAGATAAAAATGACCCGTATTTGTACAGCACCAAT AATTTT GTCGGCCGGCAAACATGGGAGTTCGACCCGGATTATGTGGGTAGCCCCGGAGAGCTAGAG GAG GTGGAAGAGGCTCGGCGTCAGTTTTGGGAGAACAGGTACAAGGTCAAGCCTTGTGGCGAT CTCC TCTGGCGTATGCAGTTCCTAAGAGAGAAGAATTTCAAACAAACAATCCCCCAAGTGAAGG TAGGA GATGACGAGGCAGTTACTTATGACGCCGCCACTACGACACTCCGAAGGGCCGTCCACTTC TTTTC AGCTTTGCAGGCCAGCGACGGTCATTGGCCTGCCGAGATCGCCGGACCTCTCTTTTTCCT TCCG CCCTTGGTGATGTGTGTATATATCACAGGGCATCTTGATACAGTGTTCCCAGCAAAACAT CGAAAA GAAATTCTTCGCTACATATATTGTCATCAAAATGAAAATGGCGGGGGGGGATTACATATT GAGGG GCATAGCACCATGTTCGGCACAACTTTTAGCTACATTTGTATGCGTATACTTGGAAAAGG ACCCG ATGGTGGTGTAAACAATGCATGTGCCAAAGGCCGAAAATGGATCCTTGACCACGGCAGTG CAAC CGCTATACCTTCATGGGGCAAGACTTGGCTTTCGATACTTGGTGTATATGAATGGACGGG AAGCA ACCCAATGCCCCCGGAATTCTGGCTTCTCCCTTCTTCCCTTTCTGTGCACCCAGCTAAAA TGTTGT GTTATTGCCGGATGGTTTACTTGCCAATGTCATATTTATATGGGAAGAGGTTTGTTGGGC CAATCA CTCCTCTCATTTTACAATTAAAAGAAGAACTTTATGCTCAACCCTACAATGAAATCAGGT GGGGAA AAGTACGTCATGTGTGTGCCAAGGAGGACATCTACTATCCTCACCCTTTAATACAAGACC TGCTAT GGGATAGTCTCCATGTATTAGCTGAACCTCTTTTAACTCGTTGGCCATTTAACAAGTTGA GAGAGA AAGCTTTGCAGACTACCATGAAACACATTCACTATGAAGATGAGAACAGTCGATATATTA CCATTG GATGTGTGGAAAAGATTTTGTGTATGCTTGCTTGTTGGGTTGAGGATCCAAATGGAGATT ATTTCA AGAAACACCTTGCAAGGATTCCAGATTATTTATGGGTTGCTGAAGATGGAATGAAGATGC AGAGT TTTG GTAGTC AG GAATGG G ATATAGGTTTTG GC ATTC AAGC ATTGTTG GCTAGTG ATCTC ACTC AT GAACTTGGACCTACTCTTATGAAAGGACACGACTTCATCAAAAAGTCCCAGGTCAAGGAT AATCC TTCCGGTGACTTCAAAAGCATGTATCGCCACATTTCTAAAGGATCGTGGACCTTCTCAGA TCAAGA TCACGGATGGCAAGTTTCTGATTGTACTGCAGAAGGATTAAAGTGTTGCCTTATTTTCTC AACAAT GCCAGAGGAAATCGTTGGCAAGAAAATGGAACCAGAACTACTGTATAATTCTGTTAATGT ATTGCT TTCCCTACAGAGCAAAAATGGTGGGGTAGCAGCATGGGAGCCTGCAACAGCACAGGACTG GTTA GAGTTGTTCAATCCTACGGAATTCTTTGCAGACACCATCATTGAGCACGAGTATGTAGAG TGCAC TTCATCGGCAATCCAAGCCCTGACTCTGTTTAAAAAGTTATATCCTGGGCACCGAAAGAA GGAGA TAGATAATTTTATTACGAATGCCATTCGTTTCATTGAAGACATACAAATACCTGATGGTT CATGGTA TGGAAACTGGGGTGTGTGTTTTACTTACGGTACCTGGTTTGCTCTTGGGGGGCTAGCGGC AGGT GGAAAGACATACAACAATTGTGCAGCTGTTCGTAAAGCTGTTAATTTTCTACTCGAATCA CAATTG GATGATGGCGGTTGGGGAGAAAGCCATCTTTCTTGCCCCAGAAAGGTATATGTACCATT AGAAGG AAACCGCTCAAATTTGGTGCATACTGGATGGGCCTTAATGGGACTGATTCATTCTGGGCA GGCCG AGAGAGACCCAACACCTCTTCACCGTGCAGCCAAGTTATTGATCAATTCCCAGATGGAAG ATGGT GATTTTCCCCAACAGGAAATAACCGGAGCTTTTATGAAGAATTGCATGTTGCACTATGCA GTTTAT CGAAATATATACCCATTGTGGGCTTTAGCAGAGTATCGGAGGCGGGTACCATTACCGACC CTAGG TGCCTAA SEQ ID No 10. Kalanchoe daigremontiana lupeol synthase mRNA, complete cds, HM623871

ATGTGGAAGTTAAAGATAGCGGACGGAGGGAGTAACCCTTACATCTTCACCACCAAC AATTTTGT GGGAAGGCAGATATGGGAATTTGACCCCCAAGCCACCGACCCTCAGCAACTAGCTAAAGT CGAA GCTGCTCGTCTCGATTTCTACCATAACCGCTATAAACTCAAACCCAATTCCGATCTCCTC TGGCGC ATGCAGTTTCTTGAGGAGAAAGCTTTCACACAAACTATACCACAAGTTAAAGTTGAGGAT GGTGAA GAGGTTAGTTACGAGGCAGTAACTGCAGCACTGAGAAGAGGAGTCCATCTCTATTCAGCT CTCCA AGCTAGTGATGGCCACTGGCCAGCTGAAAATGCTGGCCCTATGTTTTTCATGCCCCCTAT GGTTA TGTGTCTATACATCACTGGACATCTTAATGCCATATTCACGGAAGAACATCGAAGTGAAA CTCTTC GTTAC ATATATTATC ATCAG AATG AAG ATG GTG GCTGGGGGTTTC ATATTG AGGG CCACAGC ACC ATGTTTGGTACAGTTCTAAACTATATATGTATGCGGTTGCTTGGAGAGGGGCCTGAAGGA GGTCA AGACAATGCTGTTTCCAGAGGAAGGAAGTGGATCCTCGACCATGGTGGTGCCACCTCCAT TCCAT CATGGGGAAAGACTTGGCTTTCGATTATGGGCTTGTGTGACTGGTCTGGATGCAATCCCA TGCCC CCCGAGTTTTGGCTTCTTCCTTCCTATCTTCCTATGCATCCAGGCAAAATGTGGTGCTAC TGCCGA ATGGTCTACATGCCGATGTCATATTTATATGGTAAAAGATTCACAGCTCGTATCACACCA CTCATT CTTCAGTTGAGAGAAGAAATTCACATTCAACCATACGACCAAATCGACTGGAAAAAAGTG CGACA TGTGTGTTGTAAGGAGGATATGTACTATCCACATCCACTACTTCAAGACTTGTTATGGGA CACTCT CTATCTCACTACTGAGCCTCTCCTTACTCGCTGGCCACTGAACAAACTGATCAGGAAAAG AGCTC TGCAGACGACAATGAAACATATACACTATGAAGATGAGAATAGCAGATACATCACGATTG GCTGT GTCG AG AAG GTTTTGTGC ATG CTTGCTTGCTGGGTTG AAG ATCC AAATG GAG ATTATTTTAAAAAA CATTTAGCTAGAATTCCAGACTATTTATGGATTGCTGAAGATGGCATGAAGATGCAGAGT TTCGGA AGTCAGCACTGGGATACAGCCTTTTCTATCCAAGCACTACTGGCTAGTAACATGGCTGAA GAAAT CGGAATAAC ACTTG CAAAAG GCC ACG ATTTTATTAAG AAATCTC AG GTGAAAG AC AACCCTTCTG GTGACTTCAAAGGCATGTACCGTCACATTTCAAAGGGGGCATGGACATTTTCAGATCAAG ATCAT GGATGGCAAGTTTCAGATTGCACGGCAGAGGGCCTGAAGTGTTGTCTGCTTTTCTCAATG ATGCA ACCTGAGGTTGTGGGTGAGAGCATGGCACCAGAGAGCCTGTACAACTCAGTAAATGTTCT CCTCT CTTTGCAGAGCCAGAACGGTGGATTACCAGCCTGGGAGCCAGCAGGTGCACCCGAGTGGT TGG AGCTTCTAAACCCGACCGAGTTTTTTGAGAACATTGTAATTGAGCACGAGTACGTCGAGT GCACT AGCTCGGCAGTTCAGGCTTTAGTCCTTTTCAAAAAGCTATACCCCCTACATCGTAGAAAA GAAGT GGAAAGATTTATCACAAACGGTGCGAAATACCTTGAAGATATACAGATGCCTGATGGGTC ATGGT ATGGGAACTGGGGAGTTTGCTTCACCTATGGTGCATGGTTTGCTCTTGAAGGATTGTCAG CTGCT GGAAAGACATACAACAATTGTGCAGCAGTCCGCAAAGGCGTTGACTTTCTACTAAACATT CAACTT GAAGACGGTGGGTGGGGAGAGAGTTACCAATCATGTCCAGACAAGAAATATGTTCCTCTA GAAG ATAATAGATCAAATCTGGTTCAAACTTCATGGGCGTTAATGGGTCTAATTTACGCCGGAC AGGCT GATAGGGATCCAACTCCTCTTCACCGGGCTGCACAATTACTGATTAACTCGCAGTTGGAA GATGG AGATTTTCCGCAACAAGAAATAACTGGAGTGTTTCAGAGGAACTGCATGTTGCATTATGC AGCATA CAGAAACATATTCCCTCTCTGGGCCCTTGCTGAGTATAGAAGACAGATTCAGTTACATTC AGAGG CTACC AAAATG GTCTAA

SEQ ID No 1 1. Bruguiera gymnorhiza BgLUS mRNA for lupeol synthase, complete cds, AB289586

ATGTGGAGGCTTAAGATTGCAGAGGGTGGCAACAACCCTTACATATACAGCACAAAC AATTTCGT GGGAAGGCAAACATGGGAGTTTGACCCTGAAGCTGGGACCCCTGAGGAGCGAGCCCAGGT TGA AGAGGCTCGTGAAAATTTCTGGAGGGACCGCTTTCTCATCAAGCCCAGCTCCGACCTCCT TTGGC GATTCCAGTTTCTGAGTGAGAAAAAGTTTAAACAAAGGATTCCACAAGTGAAGGTTCAGG ATGGT GAGGAAATCACACGTGAAATTGCCACAACCGCATTGAGGAGGAGCGTCCATTTGGTTTCT GCCTT GCAGGCCAGCGATGGGCATTGGTGCGCAGAAAATTCTGGCCCCATGTTCTTTGTTCCTCC TATG GTTTTTTCTCTGTATATCACAGGACATCTTAATGCTGTATTCTCTGCAGAGCACTGCAAA GAGATT CTGAGATACATATACTGTCATCCGAATGAGGATGGTGGGTGGGGATTACACATAGAGGGT CACA GCGCCATGTTCTCCACAGTTCTGAATTACAATTGGCTGGGGAAACTTGGCGAGGGACGAG ATGG TGGGAAAGACAATGCTTGCGAAAGAGCGCGAAGGAGGATTCTTGATCACGGTAGTGCAAC TGCA ATCAGCTCCTGGGGAAAGACATGGCTGGCGATACTTGGTGTGTATGAATGGGATGGTTGC AACC CAATGCCTCCAGAATTTTGGGCCTTCCCCACTTTTTTCCCAATACATCCAGCAAGAATGT TATGCT ACTGTCGGCTCACTTACATGGCCATGTCATACCTGTATGGGAAGAAATTTGTCGGTCCAA TCACA CCTCTAATTTTACAACTGAGGGAGGAAATCTACAATGAACCATATGACCAAATCAATTGG AGCAGA ATGCGCCATTTGTGTGCAAAAGAGGATAACTACTATGCCCACACTCTAACACAAATCATT TTGTGG GATGCAATTTACATGTTGGGCGAACCTCTTCTCAAGCGCTGGCCATTCAACAAATTGAGA GAGAA GGCTCTCAAAATAACAATGGATCACATTCATTATGAAGATGAAAACAGTCAATACATTAC AATTGG GAGTGTTGAAAAGCCATTACTCATGCTTGCTTGCTGGCATGAAGATCCCAATGGTGATGC TTTTAA GAAGCACCTCGCCAGAATACCAGATTATGTTTGGCTTGGTGAAGATGGAATAAAGATTCA GAGTT TTGGCAGCCAAGTGTGGGATACAAGTTTTGTTCTCCAAGCTTTGATTGCTAGCAATCTTC CCAGTG AAACAGGACCTACACTTGAGAAAGGGCACAATTTCATAAAGAACTCTCAGGTCACCCAGA ACCCT TCTGGTGACTTCAGAAGAATGTTTCGTCATATCTCTAAAGGGTCATGGACATTCTCTGAC AAAGAT CACGGATGGCAAGTTTCTGATTGCACTGCAGAAAGCCTGAAGTGTTGTCTACTTTTCTCG ATGAT GCCCCCTGAACTTGTGGGTGAGAAGATGGGACCTCAGCGGATGTACGATGCCGTCAATGT GATA ATTTCTCTTCAGAGTAAAAATGGTGGCTGTTCAGCCTGGGAGCCAGCAGGAGCTGGGTCG TGGA TGGAGTGGCTTAACCCTGTGGAATTTCTAGCGGACCTTGTTATCGAACATGAGTATGTTG AGTGC ACTTCATCATCGTTGCAAGCATTAGTTCTATTCAAGAAGTTATATCCTGAGCACAGGAGG AAAGAG ATTGAAATTTTTATACTAAATGCTGTAAGATTCACTGAAGAAATTCAACAGCCTGATGGA TCATGGT ATGGAAATTGGGGAATATGCTTCCTTTCTGGTACATGGTTTGGACTTAAAGGGCTGGCTG CTGCT GGCAAGACTTACTACAATTGCACTGCTGTGCGTAAAGGGGTCGAATTTCTACTCCAAACA CAACG AGACGATGGTGGATGGGGAGAGAGTTACCTTTCATGCCCAAAGAAGATCTACGTACCTCT TGAG GGAAACCGATCAAATTTGGTACAAACTGCACTGGCCATGATGGGCTTAATTCTTGGTGGG CAGGG TGAGAGAGACCCTACACCCCTTCATCGAGCTGCAAAGTTGTTGATCAATTCTCAAACAGA ACTTG GTGATTTTCCTCAGCAGGAACTCTCAGGTTGTTTCATGAGGAATTGCATGTTGCACTATT CAGAAT ATAGGGACATCTTTCCAACGTGGGCTCTAGCAGAATACTGCAAGCTTTTTCCATTGCCTT CCAAAA ATGATTGA

SEQ ID No 12. Betula platyphylla OSCBPY mRNA for beta-amyrin synthase, complete cds,

AB055512

ATGTGGAGGCTTAAGATCGCAGACGGTGGGAGTGACCCTTATATCTACTCTACAAACAAC TTTGT TGGGAGGCAGACATGGGAGTTTGACCCTCAGGCTGGTTCCCCACAAGAGCGGGCTGAGGT TGA AGAGGCTCGTCGGAATTTCTACGACAACCGGTATCAGGTCAAACCTAGTGGTGATCTCCT ATGGC GAATGCAGTTTCTTAAGGAGAAAAACTTCAAACAAACAATTCCTCCAGTAAAGGTTGAGG ATGGA GAGGAAATCACATATGAAAAGTCCACAGCTGCATTGAGAAGGGCCGTCCATTTCTATTCG GCCTT GCAAGCTAGTGATGGCCATTGGCCTGCTGAAAATGCCGGTCCATTATTTTTCCTTCCCCC CTTGG TTATGTGTATGTACATTACAGGACATCTTAATACTGTGTTCCCTGCTGAGCATCAAAAGG AAATCC TTCGATACATATACTATCATCAGAATGAAGATGGTGGGTGGGGATTACACATAGAGGGTC ACAGC ACCATGTTTTGCACTGCTCTCAGCTACATCTGTATGCGCATACTCGGGGAAGGGCCTGAT GGTGG TCAGGACAATGCTTGTGCAAGAGCGCGAAAGTGGATCCTTGATCATGGTGGTGTAACACA CATGC CTTCTTGGGGAAAGACCTGGCTTTCGATACTTGGTATATTCGAGTGGATTGGAAGCAACC CAATG CCTCCAGAATTTTGGATCCTTCCTTCATTTCTTCCCATGCATCCAGCCAAAATGTGGTGC TACTGC CGCATGGTGTACATGCCTATGTCATACCTCTATGGGAAAAGGTTTGTAGGCCCAATCACA CCTCT CATTCTTCAATTGAGGGAGGAACTCTACACTCAACCTTACCACCAAGTTAACTGGAAGAA AGTGC GTCATCTATGTGCAAAGGAGGATATCTACTATCCCCACCCTTTGATACAAGATCTATTGT GGGATA GTCTATACATATTCACTGAGCCTCTTCTAACTCGTTGGCCCTTTAACAAGCTGGTCAGAG AGAAG GCTCTTCAAGTAACAATGAAGCACATTCATTATGAAGATGAGAACAGTCGATACATCACC ATTGGA TGCGTGGAAAAGGTCCTCTGTATGCTTGCTTGTTGGGTTGAAGATCCAAATGGGGATTAT TTCAA GAAACATATTGCTAGGATACCAGATTACATATGGGTTGCTGAAGATGGAATCAAGATGCA GAGTTT TGGAAGTCAAGAGTGGGATACCGGTTTTGCTATTCAAGCTTTGCTTGCTAGTAATCTAAC TGATGA AATTG G ACCTAC ACTTGCG AG AG GGC ACG ACTTCATAAAG AAATCTC AG GTC AAG G AC AACCCTT CTGGAGACTTTGAAAGCATGCACCGTCACATTTCTAAAGGATCATGGACTTTCTCTGATC AAGATC ATGGATGGCAAGTTTCTGATTGCACTGCCGAAGGTTTGAAGTGTTGCTTGCTTTTCTCCA TTATGC CACCAGAAATTGTTGGTGAGAAAATGGAACCTGAGCAATTGTATGATTCTGTAAATGTCC TACTTT CTCTACAGAGTAAAAATGGTGGTTTAGCTGCCTGGGAACCAGCAGGAGCCCAAGAATGGT TGGA ATTGCTTAATTCCACAGAATTCTTTGCGGACATTGTCATTGAGCATGAGTACATTGAGTG CACTGC ATCAGCAATGCAAACTTTAGTTTTGTTTAAGAAGTTATACCCCGGGCACCGNAAGAAAGA GATCG AAAATTTCATAAAAAATGCTGCTCAGTTCCTTCAAGTCATACAAATGCCTG ATGGTTCATGGTATG GAAATTGGGGAGTTTGCTTCACATATGGTACATGGTTTGCACTTGGAGGATTGGCTGCAG TTGGC AAGACTTACAACAATTGTCTAGCCGTGCGCAGAGCTGTTGATTTTCTACTCAGAGCACAA AGAGA TAATGGTGGTTGGGGAGAGAGCTATCTCTCATGTCCAAAGAAGGAGTATGTACCTCTTGA AGGAA ACAAATCAAATTTGGTACATACTGCATGGGCAATGATGGGTCTCATTCATGCTGGACAGG CTGAA AGAGACCCAACACCTCTTCACCGCGCAGCAAAGTTGATAATTAATTCTCAACTCGAAGAT GGAGA TTTTCCTCAACAGGAAATCACTGGAGTCTTTATGAAGAACTGTATGTTACACTATGCAGC ATACAA AAATATTTACCCACTGTGGGCTCTGGCAGAATACCGCAAGCATGTCCCATTGCCATTAGG AAAAA ATTTAAATCAAGTAGTGAACTGTATAGGTCAATCACTATATAAGAAGTATAAATAA

Die folgenden Gensequenzen werden besonders bevorzugt für die Kodierung von NADPH- cytochrome P450 Reduktase (CPRs) eingesetzt:

SEQ ID No 13. Lotus japonicus LjCPRI mRNA for cytochrome P450 reductase, complete cds, AB433810

ATGGAAGAATCAAGCTCCATGAAGATTTCGCCTCTGGATCTGATGTCCGCCATGATCAAG GGCAC ACTCGACCCTTCCAACGTCTCCTCCACCTCCGGCGCCGGCTCCGTCTTCCTCGAGAATCG TGAG TTCGTCATGGTGCTTACCACCTCCATCGCCGTCCTCATCGGATGCGTCGTCGTTTTCATT TGGCG CAGATCCACCGGTAACAAGGCTAAGTCCATCGAGCCTCCCAAGCGCGTCGTCGAGAAGCT TAGC GACGAGGCTGAGGTTGACGACGGTACCAGAAAGGTCACCATCTTCTTCGGTACTCAGACT GGTA CTGCTGAAGGATTCGCCAAGGCGATTGCGGAAGAGGCAAAAGTGCGATACGAAAAAGCCA AGTT CAAAATTGTTGATATGGATGATTATGCCCAGGACGATGATGAGTATGAGGAAAAGCTCAA GAAAG AGACACTGGCACTTTTCTTCTTAGCTACATATGGTGATGGTGAGCCAACTGATAATGCGG CGAGA TTTTACAAATGGTTTCTGGAGGGAGATGAGAAAGAAGAAGGATGGCTTCGAAATCTTGAG TATGC TGTTTTTGGTCTGGGGAACAGGCAGTATGAGCATTTTAATAAGGTCGCCATTGAAGTGGA TGATA AGCTTGCTGATTTTGGTGGGAAGCGTCTTGTCAAAGTAGGTCTAGGAGATGATGATCAAT GCATA GAAGATGACTTTACTGCATGGAAAGAAGAATTGTGGCCAGCATTGGATGAATTGCTTAGA GGTGA TGATGATACAACTGTGTCTACACCCTATACGGCTGCTGTGTTGGAGTATCGTGTTGTTAT TCATGA TCCATTAGATGCATCTGTCGATGAAAAGAAGTGGCATAATGTTAATGGCCATGCTATTGT GGATGC TCAACATCCAGTCAGGTCAAATGTGGCTGTGCGAAAGGAGCTTCATACTCCTGTGTCAGA TCGTT CTTGCACACATTTAGAATTTGACATTTCAGGCACTGGAGTTGCATATGAAACAGGGGACC ATGTT GGTGTTTACTGTGAGAATTTATCTGAAACTGTGGAAGAAGCAGTAAGGTTACTAGGTTTG TCACCA GATACCTATTTCTCCGTCCATACTGATGATGAAGATGGGAAACCACTTAGTGGAAGCTCC TTGCC ACCTACTTTCCCACCATGTACTTTAAGAACAGCAATTGCCCGATATGCAGATGTCTTGAG TTCACC CAAAAAGTCTGTTTTGCTTGCCTTAGCTGCTCATGCATCTAATCCATCTGAAGCCGACCG CCTAC GACATCTTGCTTCACCTGCTGGAAAGGATGAATATTCAGAGTGGGTGATTGCCAGTCAAA GAAGT CTCCTTGAGGTCATGGCTGAATTTCCATCAGCCAAACCTCCAATTGGTGTCTTTTTCGCA GCAATT GCTCCTCGCCTGCAGCCAAGATTTTATTCGATCTCATCATCTCCTAGGATGGCTCCATCC AGAATT CACGTTACCTGTGCATTAGTGAATGATAAAATGCCCACTGGTAGGATTCATAGGGGAGTG TGTTC AACATGGATGAAGAATTCTGTGCCATTGGAGAAAAGTCAGGACTGCAGTTGGGCTCCAAT ATTTG TTAGACAGTCCAATTTTAAACTCCCTGCTGATAATAAAGTGCCTATAATCATGATAGGTC CTGGCA CAGGATTGGCTCCTTTCAGGGGTTTCTTGCAGGAAAGATTAGCTCTGAAAGAGGATGGAG CTGAA CTTGGCCCCTCCGTTTTATTCTTCGGATGCAGGAATCGTCAAATGGACTACATCTATGAA GATGA GTTGAACCACTTTGTCAACAGTGGTGCGCTTTCTGAGCTCATTGTTGCCTTCTCACGGGA GGGAC CTACCAAGGAATATGTGCAACATAAAATGATGGAGAAGGCTTCGGATATTTGGAACATGA TATCTC AGGGAGCTTACATTTATGTGTGTGGGGATGCCAAGGGCATGGCTAGGGATGTGCACCGTA CTCT GCACACAATTTTGCAAGAGCAGGGTTCTCTCGATAGTTCCAAGGCTGAGGGTATGGTTAA GAACC TACAATTGAATGGTAGGTATTTGCGTGATGTATGGTGA

SEQ ID No 14. A.thaliana ATR1 mRNA for NADPH-cytochrome P450 reductase, X66016

ATGACTTCTGCTTTGTATGCTTCCGATTTGTTTAAGCAGCTCAAGTCAATTATGGGGACA GATTCG TTATCCGACGATGTTGTACTTGTGATTGCAACGACGTCTTTGGCACTAGTAGCTGGATTT GTGGT GTTGTTATGGAAGAAAACGACGGCGGATCGGAGCGGGGAGCTGAAGCCTTTGATGATCCC TAAG TCTCTTATGGCTAAGGACGAGGATGATGATTTGGATTTGGGATCCGGGAAGACTAGAGTC TCTAT CTTCTTCGGTACGCAGACTGGAACAGCTGAGGGATTTGCTAAGGCATTATCCGAAGAAAT CAAAG CGAGATATGAAAAAGCAGCAGTCAAAGTCATTGACTTGGATGACTATGCTGCCGATGATG ACCAG TATGAAGAGAAATTGAAGAAGGAAACTTTGGCATTTTTCTGTGTTGCTACTTATGGAGAT GGAGAG CCTACTGACAATGCTGCCAGATTTTCAAAATGGTTTACGGAGGAAAATGAACGGGATATA AAGCTT CAACAACTAGCATATGGTGTGTTTGCTCTTGGTAATCGCCAATATGAACATTTTAATAAG ATCGGG ATAGTTCTTGATGAAGAGTTATGTAAGAAAGGTGCAAAGCGTCTTATTGAAGTCGGTCTA GGAGAT GATGATCAGAGCATTGAGGATGATTTTAATGCCTGGAAAGAATCACTATGGTCTGAGCTA GACAA GCTCCTCAAAGACGAGGATGATAAAAGTGTGGCAACTCCTTATACAGCTGTTATTCCTGA ATACC GGGTGGTGACTCATGATCCTCGGTTTACAACTCAAAAATCAATGGAATCAAATGTGGCCA ATGGA AATACTACTATTGACATTCATCATCCCTGCAGAGTTGATGTTGCTGTGCAGAAGGAGCTT CACACA CATGAATCTGATCGGTCTTGCATTCATCTCGAGTTCGACATATCCAGGACGGGTATTACA TATGAA ACAGGTGACCATGTAGGTGTATATGCTGAAAATCATGTTGAGATAGTTGAAGAAGCTGGA AAATT GCTTGGCCACTCTTTAGATTTAGTATTTTCCATACATGCTGACAAGGAAGATGGCTCCCC ATTGGA AAGCGCAGTGCCGCCTCCTTTCCCTGGTCCATGCACACTTGGGACTGGTTTGGCAAGATA CGCA GACCTTTTGAACCCTCCTCGAAAGTCTGCGTTAGTTGCCTTGGCGGCCTATGCCACTGAA CCAAG TGAAGCCGAGAAACTTAAGCACCTGACATCACCTGATGGAAAGGATGAGTACTCACAATG GATTG TTGCAAGTCAGAGAAGTCTTTTAGAGGTGATGGCTGCTTTTCCATCTGCAAAACCCCCAC TAGGT GTATTTTTTGCTGCAATAGCTCCTCGTCTACAACCTCGTTACTACTCCATCTCATCCTGC CAAGAT TGGGCGCCAAGTAGAGTTCATGTTACATCCGCACTAGTATATGGTCCAACTCCTACTGGT AGAAT CCACAAGGGTGTGTGTTCTACGTGGATGAAGAATGCAGTTCCTGCGGAGAAAAGTCATGA ATGTA GTGGAGCCCCAATCTTTATTCGAGCATCTAATTTCAAGTTACCATCCAACCCTTCAACTC CAATCG TTATGGTGGGACCTGGGACTGGGCTGGCACCTTTTAGAGGTTTTCTGCAGGAAAGGATGG CACT AAAAGAAGATGGAGAAGAACTAGGTTCATCTTTGCTCTTCTTTGGGTGTAGAAATCGACA GATGG ACTTTATATACGAGGATGAGCTCAATAATTTTGTTGATCAAGGCGTAATATCTGAGCTCA TCATGG CATTCTCCCGTGAAGGAGCTCAGAAGGAGTATGTTCAACATAAGATGATGGAGAAGGCAG CACAA GTTTGGGATCTAATAAAGGAAGAAGGATATCTCTATGTATGCGGTGATGCTAAGGGCATG GCGAG GGACGTCCACCGAACTCTACACACCATTGTTCAGGAGCAGGAAGGTGTGAGTTCGTCAGA GGCA GAGGCTATAGTTAAGAAACTTCAAACCGAAGGAAGATACCTCAGAGATGTCTGGTGA SEQ ID No 15. Catharanthus roseus cpr mRNA for NADPH-ferri he moprote in reductase, X69791

ATGGATTCTAGCTCGGAGAAGTTGTCGCCGTTCGAATTGATGAGCGCGATCTTGAAG GGAGCTAA ATTAGATGGGTCTAACTCTTCAGATTCTGGCGTAGCTGTGTCGCCGGCAGTTATGGCTAT GTTGT TGGAGAATAAGGAGTTAGTGATGATTTTGACTACTTCAGTGGCGGTTTTGATCGGTTGTG TCGTA GTTTTGATATGGCGGCGATCTTCCGGATCGGGTAAAAAAGTCGTGGAGCCTCCGAAGCTC ATAGT GCCTAAATCTGTTGTAGAACCGGAGGAAATTGATGAAGGGAAGAAGAAATTTACCATATT TTTTGG AACACAAACTGGAACAGCTGAAGGCTTCGCTAAGGCTCTAGCTGAGGAAGCCAAAGCTCG ATAT GAAAAGGCAGTTATCAAAGTGATTGATATAGATGATTATGCGGCTGATGATGAAGAATAC GAGGA GAAATTCAGAAAAGAGACCTTGGCATTTTTCATCTTGGCCACGTATGGAGATGGTGAGCC AACCG ACAATGCTGCAAGGTTCTACAAATGGTTTGTAGAGGGAAATGATAGAGGGGACTGGCTAA AGAAT CTGCAATATGGAGTTTTTGGCCTTGGTAACAGACAATATGAGCATTTCAACAAGATTGCT AAAGTG GTGGATGAGAAAGTTGCTGAACAGGGTGGTAAGCGGATTGTTCCATTGGTTCTGGGAGAC GATG ACCAGTGCATTGAAGATGACTTTGCTGCATGGCGTGAGAATGTATGGCCTGAGTTGGATA ACTTG CTCCGGGATGAGGATGATACAACTGTTTCTACAACCTACACTGCTGCTATTCCAGAATAT CGTGTT GTGTTCCCTGACAAATCAGATTCACTTATTTCAGAAGCAAATGGCCATGCCAATGGTTAT GCTAAT GGCAACACCGTATATGATGCCCAGCATCCTTGCAGATCTAATGTTGCAGTGAGGAAGGAG CTTCA TACTCCAGCATCTGATCGTTCTTGCACCCATTTGGATTTTGACATTGCTGGCACTGGCCT TTCATA TGGAACTGGAGATCATGTTGGAGTGTACTGTGATAATCTATCTGAAACCGTGGAGGAGGC TGAGA GATTACTGAATTTACCCCCAGAAACTTATTTCTCGCTTCATGCTGATAAAGAGGATGGAA CCCCAC TTGCTGGGAGCTCATTGCCTCCTCCTTTCCCACCTTGTACTCTAAGAACCGCCCTCACTC GTTAT GCAGATCTCTTAAATACTCCTAAGAAGTCTGCTTTGTTAGCTCTAGCAGCTTATGCATCT GATCCA AATGAGGCCGATCGTCTAAAATATCTTGCTTCTCCAGCCGGAAAGGATGAATATGCTCAG TCACT AGTTGCAAATCAGAGAAGCCTCCTCGAGGTCATGGCTGAATTTCCATCAGCAAAGCCTCC TCTTG GAGTATTCTTTGCAGCAATTGCTCCACGCCTCCAACCCAGATTCTATTCTATATCGTCTT CTCCAA GGATGGCACCATCTAGAATTCATGTCACTTGTGCACTTGTTTATGAAAAAACACCTGGAG GACGA ATTC AC AAG GGTGTGTGTTCG AC ATGG ATG AAG AATGCC ATTCC ATTGG AG GAAAG CCGTG ACTG CAGCTGGGCTCCTATCTTTGTCAGGCAGTCTAACTTCAAACTCCCTGCCGATCCTAAAGT GCCTG TTATAATGATCGGCCCTGGTACTGGACTAGCTCCCTTCAGAGGATTCCTTCAGGAAAGAT TAGCT CTGAAGGAAGAAGGAGCTGAACTTGGTACTGCAGTTTTCTTTTTTGGATGCAGGAACCGC AAAAT GGATTACATCTATGAAGATGAGCTAAACCATTTCCTTGAAATTGGTGCACTTTCCGAGCT ACTTGT TGCTTTCTCACGTGAGGGACCCACTAAGCAGTATGTGCAACACAAGATGGCAGAAAAGGC TTCTG ATATTTGGAGGATGATTTCTGATGGAGCATATGTTTACGTCTGCGGTGATGCCAAAGGCA TGGCC AGGGATGTCCACAGAACTCTCCACACCATTGCTCAAGAGCAGGGATCGATGGATAGCACA CAGG CTGAGGGTTTTGTGAAGAATCTGCAAATGACCGGAAGGTATCTCCGAGATGTCTGGTGA

SEQ ID No 16. Medicago truncatula NADPH cytochrome P450 reductase (MTR_3g100160) mRNA, complete cds, XM_003602850

ATGACTTCTTCCAATTCCGATTTAGTCCGTACAATCGAATCCGTACTCGGAGTTTCCCTC GGCGAC TCCGTTTCAGATTCGGTTGTTCTCATCGTTACCACCTCCGCCGCCGTCATAATTGGACTT CTCGTT TTTCTATGGAAGAAATCTTCGGATCGGAGCAAAGAGTTGAAACCGGTTATAGTTCCTAAG TCCTTG GTGAAAGAAGAAGATGATGATGCTGATATTGCTGATGGAAAAACCAAAGTTACCGTTTTC TTTGGT ACTCAAACTGGTACTGCTGAAGGATTCGCTAAGGCATTGGCAGAGGAGATCAAGGCAAGA TATGA AAAAGCATTTGTCAAAGTTGTTGATATGGATGACTATGCAGCGGATGATGATCAATATGA AGAGAA GCTGAAGAAAGAAACTCTTGCATTTTTCATGCTGGCGACTTATGGAGATGGAGAGCCAAC TGACA ATGCCGCAAGATTCTATAAATGGTTTACTGAGGGTAAAGACGAGAGGGGAACCTGGCTTC AACAG CTCACATATGGTGTTTTTGGCCTAGGTAACAGGCAATATGAACATTTTAACAAGATAGGT AAAGTT GTTGACGACGATCTCAGTGAACAAGGGGCAAAGCGTCTTGTTCCACTTGGAATGGGTGAT GATG ATCAATCCATTGAGGATGATTTTAATGCCTGGAAAGAATCTCTGTGGCCTGAGTTGGATC AGTTGC TCCGAGATGAGGATGATGTAAATACTGTGTCTACTCCTTATACAGCTGCTATTTCTGAAT ATCGAG TAGTGTTTCACGACCCCACTGTCACGCCGTCCTACGAGAATCACTTTAACGCGGCAAATG GGGGT GCTGTATTTGATATTCATCATCCTTGTAGGGCGAATGTCGCTGTTCGAAGGGAGCTTCAT AAACCT CAGTCTGACCGTTCTTGTATACATTTGGAGTTTGATGTATCAGGGACCGGCGTAACATAC GAAAC TGGAGACCATGTGGGTGTTTATGCTGATAACTGTGATGAAACTGTTAAAGAAGCTGGGAA GTTGT TGGGTCAGGATTTAGATTTGCTGTTTTCTCTTCACACTGATAATGAGGATGGCACTTCCC TAGGTG GTTCTCTTCTACCTCCTTTCCCTGGTCCTTGCACAGTTCGCACTGCATTAGCACGTTATG CAGATC TCTTGAACCCCCCACGAAAGGCTGCTTTAATTGCATTAGCTGCTCATGCTTCCGAGCCTA GTGAA GCAGAAAGATTGAAGTTTCTCTCATCTCCTCAGGGAAAGGATGAATACTCCAAATGGGTT GTTGG AAGCCATAGAACTCTTCTTGAGGTGATGGCTGATTTTCCATCAGCAAAACCACCCCTTGG TGTGTT TTTTGCTGCCATAGCCCCTCGTTTACAACCTCGTTATTATTCTATTTCATCATCTCCTAG GTTTGCC CCACAAAGGGTACACGTAACTTGTGCCCTGGTAGAAGGTCCAACTCCAACTGGCAGAATT CACAA AGGAGTATGTTCAACCTGGATGAAGAATGCTATTCCCTCAGAGGAAAGCCGTGACTGTAG CTGG GCTCCCATTTTTATCAGGCCATCGAATTTCAAGCTACCTGCTGATCCTTCAATTCCTATT ATT ATGG TTGGACCTGGTACTGGTTTAGCACCTTTTAGGGGATTTTTACAGGAGAGATTTGCTCTCA AAGAG GACGGTGTTCAACTTGGTCCTGCATTACTATTCTTCGGGTGCAGGAACCGTCAAATGGAT TTTATA TATGAGGAAGAGCTGAATAATTTTGTGGAACAAGGTTCTCTGTCAGAGTTGATAGTTGCA TTCTCT AGAGAGGGGCCTGAAAAGGAGTATGTTCAACACAAAATGATGGATAAAGCATCATACTTC TGGAG TCTCATTTCTCAGGGAGGTTATCTTTATGTATGTGGTGATGCCAAGGGCATGGCCAGAGA TGTTC ATCGAACTCTTCACACCATTGTCCAGCAGCAGGAAAATGCAGACTCTTCAAAGGCGGAGG CTACG GTG AAAAAACTCC AGATG GATG G ACGCTACCTTAGG GATGTCTGGTG A SEQ ID No 17. Saccharomyces cerevisiae S288c Ncpl p (NCP1 ), mRNA, NM_001 179172

ATGCCGTTTGGAATAGACAACACCGACTTCACTGTCCTGGCGGGGCTAGTGCTTGCCGTG CTAC TGTACGTAAAGAGAAACTCCATCAAGGAACTGCTGATGTCCGATGACGGAGATATCACAG CTGTC AGCTCGGGCAACAGAGACATTGCTCAGGTGGTGACCGAAAACAACAAGAACTACTTGGTG TTGTA TGCGTCGCAGACTGGGACTGCCGAGGATTACGCCAAAAAGTTTTCCAAGGAGCTGGTGGC CAAG TTCAACCTAAACGTGATGTGCGCAGATGTTGAGAACTACGACTTTGAGTCGCTAAACGAT GTGCC CGTCATAGTCTCGATTTTTATCTCTACATATGGTGAAGGAGACTTCCCCGACGGGGCGGT CAACT TTGAAGACTTTATTTGTAATGCGGAAGCGGGTGCACTATCGAACCTGAGGTATAATATGT TTGGTC TGGGAAATTCTACTTATGAATTCTTTAATGGTGCCGCCAAGAAGGCCGAGAAGCATCTCT CCGCC GCGGGCGCTATCAGACTAGGCAAGCTCGGTGAAGCTGATGATGGTGCAGGAACTACAGAC GAA GATTACATGGCCTGGAAGGACTCCATCCTGGAGGTTTTGAAAGACGAACTGCATTTGGAC GAACA GGAAGCCAAGTTCACCTCTCAATTCCAGTACACTGTGTTGAACGAAATCACTGACTCCAT GTCGC TTGGTGAACCCTCTGCTCACTATTTGCCCTCGCATCAGTTGAACCGCAACGCAGACGGCA TCCAA TTGGGTCCCTTCGATTTGTCTCAACCGTATATTGCACCCATCGTGAAATCTCGCGAACTG TTCTCT TCCAATGACCGTAATTGCATCCACTCTGAATTTGACTTGTCCGGCTCTAACATCAAGTAC TCCACT GGTGACCATCTTGCTGTTTGGCCTTCCAACCCATTGGAAAAGGTCGAACAGTTCTTATCC ATATTC AACCTGGACCCTGAAACCATTTTTGACTTGAAGCCCCTGGATCCCACCGTCAAAGTGCCC TTCCC AACGCCAACTACTATTGGCGCTGCTATTAAACACTATTTGGAAATTACAGGACCTGTCTC CAGACA ATTGTTTTCATCTTTGATTCAGTTCGCCCCCAACGCTGACGTCAAGGAAAAATTGACTCT GCTTTC GAAAGACAAGGACCAATTCGCCGTCGAGATAACCTCCAAATATTTCAACATCGCAGATGC TCTGA AATATTTGTCTGATGGCGCCAAATGGGACACCGTACCCATGCAATTCTTGGTCGAATCAG TTCCC CAAATGACTCCTCGTTACTACTCTATCTCTTCCTCTTCTCTGTCTGAAAAGCAAACCGTC CATGTC ACCTCCATTGTGGAAAACTTTCCTAACCCAGAATTGCCTGATGCTCCTCCAGTTGTTGGT GTTACG ACTAACTTGTTAAGAAACATTCAATTGGCTCAAAACAATGTTAACATTGCCGAAACTAAC CTACCT GTTCACTACGATTTAAATGGCCCACGTAAACTTTTCGCCAATTACAAATTGCCCGTCCAC GTTCGT CGTTCTAACTTCAGATTGCCTTCCAACCCTTCCACCCCAGTTATCATGATCGGTCCAGGT ACCGG TGTTGCCCCATTCCGTGGGTTTATCAGAGAGCGTGTCGCGTTCCTCGAATCACAAAAGAA GGGC GGTAACAACGTTTCGCTAGGTAAGCATATACTGTTTTATGGATCCCGTAACACTGATGAT TTCTTG TACCAGGACGAATGGCCAGAATACGCCAAAAAATTGGATGGTTCGTTCGAAATGGTCGTG GCCC ATTCCAGGTTGCCAAACACCAAAAAAGTTTATGTTCAAGATAAATTAAAGGATTACGAAG ACCAAG TATTTGAAATGATTAACAACGGTGCATTTATCTACGTCTGTGGTGATGCAAAGGGTATGG CCAAG GGTGTGTCAACCGCATTGGTTGGCATCTTATCCCGTGGTAAATCCATTACCACTGATGAA GCAAC AGAGCTAATCAAGATGCTCAAGACTTCAGGTAGATACCAAGAAGATGTCTGGTAA SEQ ID No 18. A.thaliana mRNA ATR2 for NADPH-cytochrome P450 reductase, X66017

ATGTCCTCTTCTTCTTCTTCGTCAACCTCCATGATCGATCTCATGGCAGCAATCATCAAA GGAGAG CCTGTAATTGTCTCCGACCCAGCTAATGCCTCCGCTTACGAGTCCGTAGCTGCTGAATTA TCCTC TATGCTTATAGAGAATCGTCAATTCGCCATGATTGTTACCACTTCCATTGCTGTTCTTAT TGGTTGC ATCGTTATGCTCGTTTGGAGGAGATCCGGTTCTGGGAATTCAAAACGTGTCGAGCCTCTT AAGCC TTTGGTTATTAAGCCTCGTGAGGAAGAGATTGATGATGGGCGTAAGAAAGTTACCATCTT TTTCGG TAC AC AAACTG GTACTGCTG AAGGTTTTG CAAAG GCTTTAGG AG AAG AAGCTAAAGC AAG ATATG AAAAGACCAGATTCAAAATCGTTGATTTGGATGATTACGCGGCTGATGATGATGAGTATG AGGAG AAATTGAAGAAAGAGGATGTGGCTTTCTTCTTCTTAGCCACATATGGAGATGGTGAGCCT ACCGA CAATGCAGCGAGATTCTACAAATGGTTCACCGAGGGGAATGACAGAGGAGAATGGCTTAA GAAC TTGAAGTATGGAGTGTTTGGATTAGGAAACAGACAATATGAGCATTTTAATAAGGTTGCC AAAGTT GTAGATGACATTCTTGTCGAACAAGGTGCACAGCGTCTTGTACAAGTTGGTCTTGGAGAT GATGA CCAGTGTATTGAAGATGACTTTACCGCTTGGCGAGAAGCATTGTGGCCCGAGCTTGATAC AATAC TGAGGGAAGAAGGGGATACAGCTGTTGCCACACCATACACTGCAGCTGTGTTAGAATACA GAGTT TCTATTC ACG ACTCTG AAG ATGCC AAATTC AATG ATATAAC ATTG GCAAATGG G AATG GTTAC ACT GTGTTTGATGCTCAACATCCTTACAAAGCAAATGTCGCTGTTAAAAGGGAGCTTCATACT CCCGA GTCTGATCGTTCTTGTATCCATTTGGAATTTGACATTGCTGGAAGTGGACTTACGATGAA ACTTGG AGATCATGTTGGTGTACTTTGTGATAACTTAAGTGAAACTGTAGATGAAGCTCTTAGATT GCTGGA TATGTCACCTGATACTTATTTCTCACTTCACGCTGAAAAAGAAGACGGCACACCAATCAG CAGCTC ACTGCCTCCTCCCTTCCCACCTTGCAACTTGAGAACAGCGCTTACACGATATGCATGTCT TTTGA GTTCTCCAAAGAAGTCTGCTTTAGTTGCGTTGGCTGCTCATGCATCTGATCCTACCGAAG CAGAA CGATTAAAACACCTTGCTTCACCTGCTGGAAAGGATGAATATTCAAAGTGGGTAGTAGAG AGTCA AAGAAGTCTACTTGAGGTGATGGCCGAGTTTCCTTCAGCCAAGCCACCACTTGGTGTCTT CTTCG CTGGAGTTGCTCCAAGGTTGCAGCCTAGGTTCTATTCGATATCATCATCGCCCAAGATTG CTGAA ACTAGAATTCACGTCACATGTGCACTGGTTTATGAGAAAATGCCAACTGGCAGGATTCAT AAGGG AGTGTGTTCCACTTGGATGAAGAATGCTGTGCCTTACGAGAAGAGTGAAAAACTGTTCCT CGGGC GGCCGATATTTGTTAGGCAATCCAACTTCAAGCTTCCTTCTGATTCTAAGGTACCGATCA TCATGA TCGGTCCAGGGACTGGATTAGCTCCATTCAGAGGATTCCTTCAGGAAAGACTAGCGTTGG TAGAA TCTGGTGTTGAACTTGGGCCATCAGTTTTGTTCTTTGGATGCAGAAACCGTAGAATGGAT TTCATC TACGAGGAAGAGCTCCAGCGATTTGTTGAGAGTGGTGCTCTCGCAGAGCTAAGTGTCGCC TTCT CTCGTGAAGGACCCACCAAAGAATACGTACAGCACAAGATGATGGACAAGGCTTCTGATA TCTGG AATATGATCTCTCAAGGAGCTTATTTATATGTTTGTGGTGACGCCAAAGGCATGGCAAGA GATGTT CACAGATCTCTCCACACAATAGCTCAAGAACAGGGGTCAATGGATTCAACTAAAGCAGAG GGCTT CGTGAAGAATCTGCAAACGAGTGGAAGATATCTTAGAGATGTATGGTAA

SEQ ID No 19. Artemisia annua cytochrome P450 reductase (CPR) mRNA, complete cds, JN594507 ATGCAATCAACAACTTCCGTTAAGTTATCTCCCTTCGATCTAATGACGGCGTTACTTAAC GGCAAG GTATCGTTCGACACATCAAACACATCCGATACGAATATTCCGTTAGCGGTGTTTATGGAG AATCGT GAGCTTTTGATGATTTTAACTACTTCAGTTGCGGTGTTGATCGGATGCGTTGTGGTGCTT GTGTG GAGACGGTCGTCGTCGGCGGCGAAGAGAGCGGCGGAGTCGCCGGTGATTGTTGTGCCGAA GAA AGTGACGGAGGATGAGGTTGATGATGGACGGAAGAAAGTTACTGTGTTTTTTGGAACTCA GACTG GTACTGCTGAAGGTTTTGCTAAGGCGCTTGTTGAAGAAGCTAAAGCGCGATATGAAAAGG CGGT GTTTAAAGTGATTGATTTGGATGATTATGCTGCTGAAGATGATGAGTATGAGGAGAAGTT AAAGAA AGAATCTCTTGCTTTTTTCTTTTTAGCTACGTATGGAGATGGTGAGCCGACAGATAATGC TGCTAG ATTCTATAAATGGTTTACCGAGGGTGAAGAGAAAGGTGAATGGCTTGAAAAGCTTCAATA CGCAG TGTTTGGACTTGGTAACAGACAGTATGAGCATTTCAACAAGATTGCGAAGGTGGTCGATG AAAAA CTTACGGAACAGGGTGCAAAGCGCCTTGTTCCTGTTGGCATGGGAGACGACGATCAATGT ATTG AAG ACG ACTTC ACTGCATG G AAAGAGTTG GTGTG GCCTG AGTTG G ATC AATTACTTCGTG ATG AG GATGATACATCTGTTGCCACCCCATACACAGCTGCTGTTGCAGAATACCGTGTTGTGTTC CATGA TAAACCAG AG ACATATG ATCAGG ATCAACTG ACAAATGGCCATGCTGTTCATG ATGCTCAACATC CATGCAGATCCAATGTAGCTGTCAAAAAGGAGCTCCATTCCCCTCTATCTGACCGTTCTT GCACT CATTTGGAATTTGATATCTCTAATACTGGATTATCGTATGAAACTGGGGACCATGTTGGA GTCTAC GTTGAGAATCTAAGTGAAGTTGTGGACGAAGCTGAAAAATTAATAGGTTTACCGCCGCAC ACTTAT TTCTCAATACACGCTGATAACGAAGACGGGACACCACTTGGTGGAGCCTCTTTGCCACCT CCTTT CCCTCCATGCACTTTAAGAAAAGCATTGGCTTCCTATGCCGATGTTTTGAGCTCTCCTAA AAAGTC AGCTTTGCTTGCTTTAGCTGCTCATGCTACTGATTCTACTGAAGCTGATAGACTGAAATT TCTTGC GTCTCCTGCGGGAAAGGATGAATATGCTCAGTGGATAGTTGCAAGCCACAGAAGTCTCCT TGAG GTCATGGAGGCCTTCCCATCAGCTAAGCCTCCGCTTGGTGTTTTTTTTGCATCTGTCGCC CCACG TTTGCAGCCGAGATACTATTCCATTTCTTCTTCCCCAAAGTTTGCGCCAAATAGGATTCA TGTAAC TTGTGCATTAGTGTATGAGCAAACACCATCAGGCCGCGTTCACAAGGGAGTCTGTTCAAC ATGGA TGAAGAATGCTGTGCCTATGACAGAAAGCCAGGATTGCAGTTGGGCCCCAATTTATGTTA GAACA TCCAATTTCAGACTTCCTTCTGATCCTAAGGTCCCAGTTATCATGATTGGCCCAGGCACT GGATTG GCTCCATTTAGAGGTTTCCTTCAGGAAAGGTTAGCTCAGAAGGAAGCTGGGACTGAGCTC GGAA CAGCCATCTTATTCTTCGGATGCAGGAATCGCAAAGTGGATTTCATATATGAGGACGAGC TTAATA ATTTCGTGGAGACTGGGGCTCTTTCCGAGCTTGTTACGGCCTTCTCTCGTGAAGGTGCCA CTAAG GAGTACGTGCAACACAAGATGACTCAGAAGACTTCGGATATCTGGAATTTACTCTCTGAG GGAGC ATATTTGTATGTTTGCGGTGATGCCAAAGGCATGGCCAAAGATGTACATCGGACTCTGCA CACTA TTGTGCAAGAACAGGGATCTCTAGACTCCTCAAAGGCGGAGCTCTACGTGAAGAATCTAC AAATG GCAGGAAGATATCTCCGTGATGTATGGTAA SEQ ID No 20. Artemisia annua cytochrome P450 reductase mRNA, complete cds, DQ984181

ATGCAATCAACAACTTCCGTTAAGTTATCTCCCTTCGATCTAATGACGGCGTTACTT AACGGCAAG GTATCGTTCGACACATCAAACACATCGGATACGAATATTCCGTTAGCGGTGTTTATGGAG AATCGT GAGCTTTTGATGATTTTAACTACTTCGGTTGCGGTTTTGATCGGATGCGTTGTGGTGCTT GTGTGG AGACGGTCGTCGTCGGCGGCGAAGAAAGCGGCGGAGTCGCCGGTGATTGTTGTGCCGAAG AAA GTGACGGAGGATGAGGTTGATGATGGACGGAAGAAAGTTACTGTGTTTTTTGGAACTCAG ACTGG TACTGCTGAAGGTTTTGCTAAGGCGCTTGTTGAAGAAGCTAAAGCGCGATATGAAAAGGC GGTGT TTAAAGTGATTGATTTGGATGATTATGCTGCTGAGGACGATGAGTATGAGGAGAAGTTAA AGAAA GAATCTCTTGCTTTTTTCTTTTTAGCTACGTATGGAGATGGTGAGCCGACAGATAATGCT GCTAGA TTCTATAAATGGTTTACCGAGGGTGAAGAGAAAGGTGAATGGCTTGACAAGCTTCAATAC GCAGT GTTTGGACTTGGTAACAGACAGTATGAGCATTTCAACAAGATTGCGAAGGTGGTCGATGA AAAAC TTGTGGAGCAGGGTGCAAAGCGCCTTGTTCCTGTTGGCATGGGAGACGATGATCAATGTA TTGAA GACGACTTCACTGCATGGAAAGAGTTGGTGTGGCCTGAGTTGGATCAATTACTTCGTGAT GAGGA TGATACATCTGTTGCCACTCCATACACAGCTGCTGTTGCAGAATACCGTGTTGTGTTCCA TGATAA ACCAGAGACATATGATCAGGATCAACTGACAAATGGCCATGCTGTTCATGATGCTCAACA TCCAT GCAGATCCAATGTCGCTGTCAAAAAGGAGCTCCATTCCCCTCTATCTGACCGGTCTTGCA CTCAT TTGGAATTTGATATCTCTAATACTGGATTATCGTATGAAACTGGGGACCATGTTGGAGTC TACGTT GAGAATCTAAGTGAAGTTGTGGACGAAGCTGAAAAATTAATAGGTTTACCGCCGCACACT TATTTC TCAGTACACGCTGATAACGAAGACGGGACACCACTTGGTGGAGCCTCTTTGCCACCTCCT TTCCC TCCATGCACTTTAAGAAAAGCATTGGCTTCCTATGCCGATGTTTTGAGCTCTCCTAAAAA GTCAGC TTTGCTTGCTTTAGCTGCTCATGCTACTGATTCTACTGAAGCTGATAGACTGAAATTTCT TGCGTC TCCTGCGGGAAAGGATGAATATGCTCAGTGGATAGTTGCAAGCCACAGAAGTCTCCTTGA GGTCA TGGAGGCCTTCCCATCAGCTAAGCCTCCGCTTGGTGTTTTTTTTGCATCTGTCGCCCCAC GTTTG CAGCCGAGATACTATTCCATTTCTTCTTCCCCAAGGTTTGCGCCAAATAGGATTCATGTA ACTTGT GCATTAGTGTATGAGCAAACACCATCAGGCCGCGTTCACAAGGGAGTCTGTTCAACATGG ATGAA GAATGCCGTGCCTATGACAGAAAGCCAGGATTGCAGTTGGGCCCCAATTTATGTTAGAAC ATCCA ATTTCAGACTTCCTTCTGATCCTAAGGTCCCAGTTATCATGATTGGCCCAGGCACTGGAT TGGCT CCATTTAGAGGTTTCCTTCAGGAAAGGTTAGCTCAGAAGGAAGCTGGGACTGAGCTCGGA ACAG CCATCTTATTCTTCGGATGCAGGAATCGCAAAGTGGATTTCATATATGAGGACGAGCTTA ATAATT TCGTGGAGACTGGGGCTCTTTCCGAGCTTGTTACGGCCTTCTCTCGTGAAGGTGCCACTA AGGA GTACGTGCAACACAAGATGACTCAGAAGGCTTCGGATATCTGGAATTTACTCTCTGAGGG AGCAT ATTTGTATGTTTGCGGTGATGCCAAAGGCATGGCCAAAGATGTACATCGGACTCTGCACA CTATT GTGCAAGAACAGGGATCTCTAGACTCCTCAAAGGCGGAGCTCTACGTGAAGAATCTACAA ATGG CAGGAAGATATCTCCGTGATGTATGGTAA

SEQ ID No 21 . Artemisia annua cytochrome P450 reductase mRNA, complete cds, DQ318192 ATGCAATCAACAACTTCCGTTAAGTTATCTCCCTTCGATCTAATGACGGCGTTACTTAAC GGCAAG GTATCGTTCGACACATCAAACACATCGGATACGAATATTCCGTTAGCGGTGTTTATGGAG AATCGT GAGCTTTTGATGATTTTAACTACTTCGGTTGCGGTGTTGATCGGATGCGTTGTGGTGCTT GTGTG GAGACGGTCGTCGTCGGCGGCGAAGAAAGCGGCGGAGTCGCCGGTGATTGTTGTGCCGAA GAA AGTGACGGAGGATGAGGTTGATGACGGACGGAAGAAAGTTACTGTGTTTTTTGGAACTCA GACTG GTACTGCTGAAGGTTTTGCTAAGGCGCTTGTTGAAGAAGCTAAAGCGCGATATGAAAAGG CGGT GTTTAAAGTGATTGATTTGGATGATTATGCTGCTGAAGATGATGAGTATGAGGAGAAGTT AAAGAA AGAATCTCTTGCTTTTTTCTTTTTAGCTACGTATGGAGATGGTGAGCCGACAGATAATGC TGCTAG ATTCTATAAATG GTTTACCG AGG GTG AAG AG AAAGGTG AATG GCTTG AC AAGCTTC AATACGCAG TGTTTGGACTTGGTAACAGACAGTATGAGCATTTCAACAAGATTGCGAAGGTGGTCGATG AAAAA CTTGTGGAGCAGGGTGCAAAGCGCCTTGTTCCTGTTGGCATGGGAGACGATGATCAATGT ATCG AAG ACG ACTTC ACTGCATG G AAAGAGTTG GTG TG GCCTG AGTTG G ATC AATTACTTCGTG ATG AG GATGATACATCTGTTGCCACTCCATACACAGCTGCTGTTGGAGAATACCGTGTTGTGTTC CATGA CAAACCAGAGACATATGATCAGGATCAACTGACAAATGGCCATGCTGTTCATGATGCTCA ACATC CATGCAGATCCAATGTCGCTGTCAAAAAGGAGCTCCATTCCCCTCTATCTGACCGGTCTT GCACT CATTTGGAATTTGATATCTCTAATACTGGATTATCGTATGAAACTGGGGACCATGTTGGA GTCTAC GTTGAGAATCTAAGTGAAGTTGTGGACGAAGCTGAAAAATTAATAGGTTTACCGCCGCAC ACTTAT TTCTCAGTACATACTGATAACGAAGACGGGACACCACTTGGTGGAGCCTCTTTGCCACCT CCTTT CCCTCCATGCACTTTAAGAAAAGCATTGGCTTCCTATGCCGATGTTTTGAGCTCTCCTAA AAAGTC AGCTTTGCTTGCTTTAGCTGCTCATGCTACTGATTCTACTGAAGCTGATAGACTGAAATT TTTTGC GTCTCCTGCTGGAAAGGATGAATATGCTCAGTGGATAGTTGCAAGCCACAGAAGTCTCCT TGAGG TCATGGAGGCCTTCCCATCAGCTAAGCCTCCGCTTGGTGTTTTTTTTGCATCTGTCGCCC CACGT TTGCAGCCGAGATACTATTCCATTTCTTCTTCCCCAAAGTTTGCGCCAAATAGGATTCAT GTAACT TGTGCATTAGTGTATGAGCAAACACCATCAGGCCGCGTTCACAAGGGAGTCTGTTCAACA TGGAT GAAGAATGCCGTGCCTATGACAGAAAGCCAGGATTGCAGTTGGGCCCCAATTTATGTTAG AACAT CCAATTTCAGACTTCCTTCTGATCCTAAGGTCCCAGTTATCATGATTGGCCCAGGCACTG GATTG GCTCCATTTAGAGGTTTCCTTCAGGAAAGGTTAGCTCAGAAGGAAGCTGGGACTGAGCTC GGAA CAGCCATCTTATTCTTCGGATGCAGGAATCGCAAAGTGGATTTCATATATGAGGACGAGC TTAATA ATTTCGTGGAGACGGGGGCTCTTTCCGAGCTTGTTACGGCCTTCTCTCGTGAAGGTGCCA CTAA GGAGTACGTGCAACACAAGATGACTCAGAAGGCTTCGGATATCTGGAATTTACTCTCTGA GGGAG CATATTTGTATGTTTGCGGTGATGCCAAAGGCATGGCCAAAGATGTACATCGGACTCTGC ACACT ATTGTGCAAGAACAGGGATCTCTAGACTCCTCAAAGGCGGAGCTCTACGTGAAGAATCTA CAAAT GGCAGGAAGATATCTCCGTGATGTATGGTAA

SEQ ID No 22. Hybrid poplar (Populus trichocarpa x P. deltoides) NADPH-cytochrome P450 oxydoreductase isoform 1 mRNA, complete cds, AF302496

ATGAGTTCAGGTGGTTCAAATTTGGCGAGGTTCGTTCAATCAGTGCTAGGGATATCT TTTGGCGA CTCCCTGTCTGACTCAGTTGTTGTGATAATTACCACGTCGTTTGCTGCTCTAGTTGGATT GGTGGT GCTTGTATTGAAGAGATCGTCCGATCGGAGCAAAGACGTCAAGCCGTTGGTGGTTCCTAA GTCAC TTTCAATTAAGGACGAGGAGGATGAGTCCGAGGCTCTGGGTGGGAAAACTAAGGTTACTA TCTTT TATGGGACTCAGACCGGAACTGCGGAGGGTTTTGCTAAGGCTTTAGCTGAAGAGGTCAAA GCAA GATATGAGAAAGCAGCTGTTAAAGTGTTTGACCTGGATGATTATGCTATGGAAGATGATC AATATG AAGAAAAATTGAAGAAAGAGACTTTGGCATTATTCATGGTTGCCACTTATGGAGATGGAG AGCCA ACTGATAACGCTGCGAGATTTTATAAGTGGTTTACTGAGGGAAATGAAAGGGGAATCTGG CTTCA ACAGCTTTCTTATGGTGTTTTTGGTCTTGGTAACCGTCAATATGAACATTTTAATAAGAT AGCGAAG GTGCTTGATGACCTGCTCTATGAACAAGGAGGAAAGCGTCTCGTTCCTGTTGGTCTTGGC GACGA TGATCAATGCATAGAGGATGATTTTTCTGCTTGGAAAGAATTTTTGTGGCCTGAGCTAGA CCAGTT GCTCAGAGATGAAGATGATGTGAATGCTCCATCTACTCCTTATACAGCTGCTATACCTGA ATATCG ATTAGTGATTCATGATCCTTCTATAATATCTGTTGAGGATAAATTCTCAAACTTGGCAAA TGGGAAT GTGTCTTTTGATATTCACCATCCATGCAGAGTCAATGTTGCTGTCCAAAAAGAGCTTCAC AAAGCA GAGTCTGACCGGTCTTGCATACATCTGGAATTTGACATCACAGGGACTGGAATTACATAT GAAAC TGGAGACCATTTGGGGGTGTATGCTGAGAATAGTGATGAAACTGTTGAAGAAGCAGGGAA GTTG CTAGATAAACCTTTAGATTTGTTGTTTTCTATTCATGCTGATAATGAGGATGGCACAGCT ATTGGAA GCTCATTGCCGCCTCCTTTCCCAGGTCCCTGCACACTTCACACTGCATTGGCATGCTATG CAGAT CTCTTGAGCCCTCCTAAAAAGGCTGCTTTGCTTGCTTTGGCTGCTCATGCCAGTGAACCT AGCGA GGCAGATAGACTCAAGTTTTTATCATCACCGCAAGGAAAGAATGAATACTCTCACTGGGT CATGG CAAGTCAGAGAAGTCTTCTCGAGGTAATGGCTGAGTTCCCATCTTCGAAACCTCCCCTTG GTATC TTTTTTGCTGCAGTGGCTCCTCGCCTACAGCCTCGCTACTATTCTATCTCATCCTCTCCT AGATAT ACTCCCAATAGAGTACATGTGACCTGTGCTTTAGTATATGGTCCAACTCCCACTGGTAGA ATTCAC AAAGGGGTGTGTTCAACTTGGATGAAGAATGCAGTTCCTCTGGAGAAAAGTTATGAATGT AGTTG GGCTCCCATTTTCACCAGAACATCTAATTTCAAGTTACCAGCAGATCCTTCAACTCCAAT TATAAT GGTG GGTCCTGGTACTG GATTGGC ACCTTTC AG AGG ATTTTTACAGG AAAG AATAG CCCTGAAAG AGGATGGTGTGAAGCTTGGTCCCGCCCTGCTTTTCTTTGGATGCAGAAATCGCCGAATGG ATTTC ATATATGAGGATGAGCTCAATAATTTTGTCGAGCAAGGTGTGATATCCGAGTTGATAGTT GCATTC TCAAGGGAGGGGCCACAGAAGGAATATGTTCAACATAAGATGGTGGATAGAGCAGCAGAG ATAT GGACTATAATTTCTCAAGGAGGTTATTTTTACGTGTGCGGTGATGCCAAGGGTATGGCTA GAGAT GTTCATAGGACTCTGCACACTATTGTGCAAGAGCAGGGAGGCCTGGACTCGTCGAAAACC GAGT CTATGGTGAAGAAGCTCCAAATGGAAGGACGGTATCTAAGAGATGTCTGGTGA

SEQ ID No 23. Hybrid poplar (Populus trichocarpa x P. deltoides) NADPH-cytochrome P450 oxydoreductase isoform 2 mRNA, complete cds, AF302497

ATGCAATCATCAAGCAGCTCGATGAAAGTGTCACCACTTGAACTTATGCAAGCCATAATC AAAGG CAAAGTGGACCCAACAAATGTTTCATCGGAATCCGGTGGTTCTGCTGCTGAGATGGCAAC TTTGA TCCGCGAGAATCGTGAGTTTGTTATTATCTTAACTACTTCCATAGCGGTTTTGATCGGCT ACGTTG TCGTTTTAATTTGGAGAAGATCATCCGGCTATCAGAAACCTAAAGTCCCTGTCCCTCCTA AGCCGT TGATTGTTAAAGACCTCGAACCTGAAGTTGATGATGGCAAGAAAAAGGTCACCATCTTTT TCGGCA CCCAAACTGGTACTGCTGAAGGATTTGCTAAGGCTCTAGCTGAGGAGGCAAAAGCTCGGT ATGA GAAGGCTATATTTAAAACTGTTGATTTGGATGATTATGCGGAGGATGACGATGAATACGA AGAGA AATTGAAGAAAGAGTCTCTGGCCATTTTCTTCTTGGCCACATATGGAGATGGTGAGCCTA CAGAT AACGCCGCGAGGTTTTATAAATGGTTTACAGATGGCAATGAGAGGGGGGAATGGCTTAAG GAAC TTCCATATGCTGTTTTTGGTCTTGGCAACAGGCAATACGAGCATTTTAATAAGATTGCCA TAGTGG TGGATAAAATCCTTGGCAACCAGGGTGGGAAGCAGCTTGTTCCAGTGGGTCTTGGTGATG ATGAT CAATGCATGGAAGATGACTTTGCCGCATGGCGAGAATTGTTGTGGCCTGAGTTGGACCAG TTGCT TCTTGATGGGGATGATCCAACTGGTGTTTCTACCCCTTATACTGCTGCCGTGGCAGAATA TCGGG TTGTATTGCATGACCCTGAAGATGCACCATTAGAGGATGATAACTGGAGTAATGCGAATG GTCAT GCTATTTATGATGCTCAGCATCCATGCAGGGCTAATGTTACTGTGAGGAGGGAGCTTCAT ACCCC TGCATCTGATCGTTCATGTACCCATTTGGAGTTCGACATATCTGGCACTGGACTTGTATA TGGAAC TGGTGATCATGTTGGTGTGTACTGTGAAAATCTAAGTGAAATTGTTGAGGAAGCACTGCA GTTGTT GGGTTTATCGCCAGATATTTACTTCACTATCCATACTGATAATGAGGATGGCACACCACT TAGTGG AAGTGCCTTGCCACCTCCATTCCCATCGTCCACCTTAAGAACAGCTCTAACTCGATATGC TGATCT TTTGAGTTCACCCAAAAAGTCTGCTTTAATGGCTTTAGCAGCTCATGCTACTAATCCAAC CGAAGC TGATCGGCTAAGACATCTTGCATCACCTGCTGGAAAGGATGAATATGCACAATGGATAGT TGCAA ATCATAGAAGCCTCCTGGAAGTCATGGCTGAATTTCCATCAGCCAAACCCCCACTTGGAG TCTTC TTTGCTTCAGTTGCCCCGCGATTGCTGCCAAGATACTATTCTATTTCATCATCTCCAAGC ATGGCA CCTTCAAGGATTCATGTTACATGTGCACTGGTTCTTGAGAAAACACCAGCAGGTCGAATT CACAAA GGAGTGTGCTCAACTTGGATGAAGAATGCTGTGCCTTTAGAGAAAAGCCATGATTGCAGC TGGG CACCTATTTTTGTTAGACAATCAAACTTCAAACTTCCAGCAGATACTAAAGTTCCCATCA TTATGAT TGGCCCTGGAACTGGTTTAGCTCCTTTCAGGGGTTTCCTTCAGGAAAGATTAGCCCAGAA AGAAG CAGGAGCAGAACTGGGATCCTCTGTATTATTCTTTGGTTGCAGGAACCGTCAAATGGATT TTATCT ATGAAGATGAGCTCAACAATTTCGTTGAAAGTGGTGCACTTTCTGAACTATCTGTAGCCT TCTCAC GTGAGGGACCTACCAAGGAATATGTGCAGCATAAGATGATGCAGAAGGCTTCTGATATCT GGAAC ATGATTTCTCAAGGAGGATATTTATATGTTTGTGGAGATGCCAAGGGCATGGCTAAAGAT GTCCA CAGAACTCTCCACACTATCGTGCAAGAGCAGGGATCTCTTGACAACTCCAAGACAGAGAG CTTTG TGAAGGGTCTGCAAATGAATGGCAGGTATCTGCGTGATGTATGGTAA

SEQ ID No 24. Hybrid poplar (Populus trichocarpa x P. deltoides) NADPH-cytochrome P450 oxydoreductase isoform 3 mRNA, complete cds, AF302498

ATGGAGTCATCAAGCAGCTCGATCAAAGTGTCTCCACTTGATCTTATGCAAGCCATAATC AAAGG CAAAGTGGACCCCGCGAATGTTTCATCGGAGTCCGGTGGTTCTGTTGCTGAGGTAGCAAC TTTGA TCCTCGAGAATCGTGAGTTTGTTATGATCTTAACTACTTCCATCGCTGTTTTGATCGGCT GCGTCG TCGTTTTGATTTGGAGAAGATCATCTGGGTATCAGAGACCCAAAGTACCTGTGCCTCCCA AGCCC TTGATTGTTAAAGACCTTGAACCTGAAGTTGACGATGGCAAGAAAAAGGTCACCATCTTT TTCGGC ACCCAAACCGGTACGGCAGAAGGATTTGCTAAGGCTCTAGCTGAGGAGGCAAAAGCTCGG TATG ACAAGGCTACATTTAAAACTGTTGATATGGATGATTACGCGGGTGATGATGATGAATACG AAGAG AAATTGAAGAAAGAGGATCTGGTTATTTTCTTCTTGGCCACATACGGAGATGGTGAGCCT ACTGAT AATGCGGCAAGGTTCTACAAATGGTTTACAGAGGGAAATGAGAGAGGGGAATGGCTCAAG GACC TTCCATATGCAGTTTTTGGCCTTGGCAACAGGCAGTACGAGCATTTTAACAAGATTGCTA TAGTGG TGGATAAAATCTTTGCTGACCAGGGTGGGAAGCGCCTTGCCCCAGTGGGTCTTGGTGATG ATGA TCAATGCATGGAAGATGACTTTGCTGCATGGCGGGAATTGTTGTGGCCTGAGATGGACCA GTTG CTTCTTGATGGAGACGATCCAACAGCTGTTTCTACTCCTTATGCTGCCACTGTATCAGAA TATCGG GTTGTATTCCATAGCCCTGAAGATGCCCCATTAGAGGATGATAACTGGAGTAATGCAAAT GGCCA TGCTGTCTATGATGCTCAGCATCCATGCAGGGCTAATGTTGCTGTGAGGAGGGAGCTTCA TACCC CGGCATCTGATCGTTCATGTACCCATCTGGAGTTTGAAATATCAGGCACCGGACTTGCAT ATGGA ACTGGGGATCATGTTGGTGTGTACTGTGAAAATCTAAGTGAAACTGTAGAGGAAGCACTG CAGTT GTTGGGTTTATCACCAGATACTTATTTCTCTATCCACAATGATAATGAGGATGGCACGCC ACTTAG TGGAGGCGCCTTGCCACCTCCATTCCCACCGTCCACCTTAAAAACTGCTCTAGCTCGATA TGCTG ATCTTTTGAGTTTGCCCAAAAAGTCTGCTCTAATGGCTTTAGCAGCTCATGCTACTGATC CAACAG AAGCTGATCGACTAAGGCATCTTGCATCGCCTGCTGGGAAGGATGAATATGCACAATTGT TAGTT GCAAATCAGAGAAGCCTCCTTGAGGTCATGGCTGAATTTCCATCAGCCAAGCCCCCACTT GGTGT CTTCTTTGCTTCAGTTGCACCTCGGTTGCAGCCAAGATACTACTCTATTTCATCATCTCC AAGGAT GGCTCCATCAAGAATTCATGTTACATGTGCACTGGTTCTTGAGAAAACACTAGGAGGTCG TATTCA CAAAGGAGTTTGCTCAACTTGGATGAAGAACGCTGTGCCTCTGGAGAAAAGCCATGATTG CAGCT GGGCACCTGTTTTTGTTAGGCAATCAAACTTCAAACTTCCAGCAGATGCTAAAGTTCCCA TCATTA TGATTGGCCCTGGAACTGGTTTAGCTCCCTTCAGAGGTTTCCTCCAGGAAAGATTAGCCC TGAAA GAAGCAGGATCAGAACTGGGATCCTCTGTATTATTCTTTGGTTGCAGGAACCGCAAAATG GATTT TATCTATGAAGACGAGCTCAACAACTTCGTTGAAAGTGGTGCACTTTCTGAACTAGTTGT TGCCTT CTCCCGTGAGGGACCTACCAAGGAATACGTGCAGCATAAGATGATGCAGAAGGCTTCTGA TATCT GGAACATGATTTCACAAGGTGGATATTTATATGTTTGTGGTGATGCCAAAGGCATGGCTA AAGAT GTCCACAGAGCGCTCCACACTATTGTGCAAGAGCAGGGATCCCTTGACAACTCGAAGACG GAAA GCTTTGTGAAGAGTCTGCAAATGAATGGCAGGTATCTACGTGATGTATGGTAA

SEQ ID No 25. Vigna radiata NADPH cytochrome P450 mRNA, complete cds, L07843

ATGGCTTCCAATTCCGATTTGGTGCGCGCCGTTGAGTCGTTCCTTGGCGTTTCTCTAGGA GATTC

CGTTTCGGATTCGCTGCTTCTCATCGCCACCACCTCCGCGGCGGTTGTAGTCGGTCT TCTCGTGT

TTTTATGGAAGAAATCTTCGGATCGGAGCAAGGAGGTGAAGCCGGTGGTTGTGCCGA GGGATTT AATGATGGAGGAGGAAGAGGAAGTTGACGTTGCCGCCGGCAAGACTAAGGTCACCATTTT CTTC GGTACTCAGACCGGTACTGCTGAAGGCTTTGCTAAGGCGTTGGCAGAGGAGATCAAGGCA AGGT ATGAAAAAGCGGCTGTCAAAGTTGTTGACCTGGATGACTATGCAGCTGATGATGATCTAT ATGAG GAGAAGCTGAAGAAAGAGAGTCTTGTATTTTTCATGCTAGCAACTTACGGGGATGGAGAA CCAAT AGACAATGCTGCAAGATTCTACAAATGGTTTACTGAGGGGAAAGACGAAAGGGGAATCTG GCTTC AAAAACTC ACCTATGG AGTTTTCG GCCTAGGTAAC AG GC AATACG AAC ATTTTAATAAG ATAG GTA AAGTTGTGGATGAAGAACTTGCTGAACAAGGTGCAAAGCGTCTAGTTGCAGTTGGATTAG GTGAT GATGATCAATCCATTGAAGATGATTTTTCTGCCTGGAAAGAAAGTTTATGGTCTGAGTTG GATCAG TTGCTCAGAGATGAGGATGATGCTAATACTGTCTCTACTCCCTATACAGCTGCTATTCTT GAATAC CGAGTAGTGATTCACGATCCCACTGCAGCATCAACCTATGATAATCACTCAACCGTGGCA AATGG GAATACTGAGTTTGATATTCATCATCCTTGCAGGGTGAATGTTGCTGTACAAAAGGAGCT TCACAA ACCTGAGTCTGATCGTTCTTGCATACATTTGGAATTTGATATATCGGGGACGAGCATAAC ATATGA TACTGGAGACCATGTGGGTGTTTATGCTGAGAACTGCAATGAAACTGTCGAAGAAACTGG GAAGT TGTTGGGTCAGAATTTGGATCTATTTTTTTCTCTTCACACAGACAAGGATGATGGCACTT CCCTAG GTGGTTCTCTCCTACCTCCTTTCCCTGGCCCTTGTTCACTGCGAACTGCATTAGCACGTT ATGCT GATCTCTTGAACCCCCCACGAAAGGCTGCTTTACTTGCATTGGCTACTCATGCCTCTGAA CCTAG CGACGAAAGATTAAAGTTCCTTTCATCTCCTCAGGGGAAGGATGAGTATTCCAAATGGGT GGTTG GAAGCCAGAGGAGTCTCGTTGAGGTGATGGCTGAGTTTCCATCAGCAAAACCTCCTCTTG GTGT GTTTTTTGCTGCAATAGCCCCTCGTTTACAGCCTCGTTATTATTCTATTTCATCCTCTCC AAGGTTT GCTCCTCAAAGGGTACATGTAACTTGTGCTTTGGTGTATGGTCCAACTCCCACTGGTAGA ATTCA CAAAGGTGTATGTTCAACTTGGATGAAGAATGCTATTCCCTCAGAAAAAAGTCAAGACTG TAGCTC GGCTCCTATTTTTATTAGGCCATCAAATTTCAAGCTTCCAGTTGATCATTCAATACCTAT TATTATG GTTGGACCTGGTACCGGTCTTGCACCTTTCAGGGGATTTTTGCAGGAAAGATATGCTCTC AAAGA GGATGGTGTTCAACTTGGCCCTGCATTACTCTTCTTTGGATGTAGAAATCGTCAAATGGA TTTCAT TTATGAGGATGAGCTAAAGAGTTTTGTGGAACAAGGTTCTCTTTCAGAATTGATAGTTGC ATTCTC TAGAGAGGGGGCTGAAAAGGAATATGTTCAACACAAGATGATGGACAAAGCTGCGCACCT TTGG AGTTTGATTTCTCAAGGAGGTTATCTTTACGTCTGTGGAGATGCCAAGGGCATGGCCAGA GATGT CCATCGAACTCTTCATTCCATTGTCCAGGAGCAGGAAAACGTGGACTCAACAAAAGCTGA AGCTA TAGTGAAAAAACTCCAGATGGACGGACGTTACCTTAGAGATGTATGGTGA

SEQ ID No 26. Petroselinum crispum NADPH cytochrome P450 reductase (CPR1 ) mRNA, complete cds, AF024635

ATGCAATCGGAATCAATGGAAGTGTCGCCGGTGGATTTGCTGGCGTCGATTCTGAAGATT GATTC GGTTGAATCGATGACGTTGCTGCTCGAGAACCGTGACGTCTTGATGTTACTTACGACGTC GTTTG CGGTGTTGATTGGATTAGGATTGGTGATGATGTGGCGGAGATCAACGACGATGACGAAGA GCGC GAAGAAGCTCGAGCCGGCGAAGATTGTGATCCCGAAATTTGAAATGGAGGAGGAAGTTGA TGAC GGTAAAAAGAAGGTTACGATTTTTTACGGTACTCAGACCGGTACTGCTGAAGGTTTTGCT AAGGC ACTTGCGGAGGAGGCGAAAGCAAGATATCAGGATGCTATCTTTAAAACTATTGATTTGGA TGATTA TGCGGGTGATGATGACGAGTATGAGACGAAACTTAAGAAAGAATCTATGGTGTTCTTCTT CTTAG CCACGTATGGTGATGGTGAACCAACCGACAATGCAGCGAGATTTTACAAGTGGTTTTGTG AGGGC AAAGAGAGAGGGGAGTGGCTTAACAATCTTCAATATGGTGTGTTTGGCCTTGGCAACAGG CAATA TGAGCATTTCAACAAGATTGCAGTGGTTGTGGATGACGGCCTTGTTGAGCAGGGTGCCAA GCGT CTTGTTCCAGTTGGTATGGGAGATGACGACCAATGTATTGAAGATGACTTTACTGCATGG CGGGA GTTAGTCTGGCCTGAGTTGGATCAACTGCTCTTGGACGAGGAGTCTAAGGCTGCTGCAAC TCCAT ATACAGCTGCTGTGCTAGAATATCGTGTTCAGTTTTATAATCAAACTGATACATCATCTC CACTGG TTCGGAGTATGAGCAAATTAAATGGCCATGCTGTATATGATGCTCAACATCCCTGCAGGG CTAAT GTGGCTGTAAGAAGAGAGCTTCATACACCTGCATCGGATCGTTCCTGCACCCATCTGGAG TTCGA TATTTCCTCTACTGGACTTGCATATGAAACTGGTGACCATGTAGGAGTCTACACTGAAAA TCTGAT TGAAATTGTTGAGGAGGCTGAAAGATTGATTGATATATCGCCAGATACTTATTTCTCCAT TCATACT GAAAATGAAGATGGAACACCCCTTAGTGGGGGATCCCTGCCACCCCCCTTTCCCCCATGC AGCT TTAGAACTGCACTTACTAGATATGCAGATCTTTTGAGTACTCCAAAGAAGTCTGCTTTAG TTGCGT TGGCGGCTCATGCATCTGATCCTAGCGAAGCTGAACGATTGAGATTTCTTGCATCTCCTG TTGGA AAGGATGAATATGCGCAGTGGCTCGTCGCTAGTCAGAGGAGCCTGCTAGAAGTCTTGGCT GCGT TTCCATCAGCCAAACCCCCATTGGGAGTTTTCTTTGCATCTGTTGCCCCACGCTTGCAGC CCAGA TACTATTCCATCTCTTCCTCACCAAGGATGGCTCCATCAAGAATTCATGTAACTTGTGCA TTAGTT CACGAGACAACGCCTGCAGGAAGAATACACAAAGGGCTCTGTTCTACTTGGATGAAGAAT GCTGT CTCATTGGAGGATGCCCATGTGAGTAGCTGGGCTCCTATTTTTGTTAGGCAATCAAACTT CAGGC TTCCAACTGATTCGAAAGTACCTATTATTATGATTGGTCCTGGCACCGGGTTGGCTCCTT TTAGGG GTTTCATGCAGGAAAGGTTAGCTCTTAAGGAATCTGGAGCAGAACTTGGATCTGCAGTAC TGTAC TTTGGATGCAGGAATAGAAAATTGGATTTCATTTACGAGGATGAGCTTAATCACTTTGTT GAAACT GGTGCAATATCTGAGATGGTTGTTGCTTTCTCACGTGAGGGTCCTGCTAAGGAATATGTC CAACA TAAGATGAGTCAAAAGGCTTCAGAGATATGGGACATGATATCTCATGGAGCATATATTTA TGTCTG TGGTGATGCCAAAGGCATGGCCAGAGACGTGCACAGGATGCTCCACACAATTGCACAAGA GCAG GGAGCTCTGGACAGTAGCCATGCAGAGAGCTTGGTGAAAAATCTTCATATGAGTGGAAGA TATTT ACGTGATGTATGGTAA SEQ ID No 27. Petroselinum crispum NADPH cytochrome P450 reductase (CPR2) mRNA, complete cds, AF024634

ATGGGTGGTGAGAGCTTGGCCACGTCACTGCCGGCGACGCTCCTCGAGAATCGTGACCTG TTAA TGCTCCTCACCACGTCAATCGCCGTTTTGATTGGATGCGCTGTCGTTTTGGTGTGGCGCA GATCG AGCCTGCGATCGGTTAAATCAGTTGAGCCGCCGAAGCTGATTGTACCGAAAGTTGAAATT GAAGA TGAAGTTGATGACGGTAAAAAGAAAGTTACCGTGTTTTTCGGCACTCAAACTGGTACTGC TGAAG GCTTTGCTAAGGCTTTTGCGGAGGAGGCGAAAGCGCGGTACGAGAAGGCGAAATTCAGAG TTGT TGATTTAGATGATTATGCGGCGGAGGATGAGGAGTACGAGGCGAAATTTAAGAAGGAATC TTTTG CGTTTTTCTTCTTAGCTACATATGGTGACGGTGAGCCAACTGACAATGCGGCTAGATTCT ATAAGT GGTTTTCGGAGGGTGAAGAGAAAGGAGATTGGTTAAATAAGCTTCAATATGGAGTGTTTG GCCTT GGAAATAGGCAGTACGAACATTTTAACAAGATCGCGAAAGTTGTTGACGATGGTCTTGCA GATCA GGGAGCCAAGCGTATTGTTGAAGTGGGTATGGGTGATGATGATCAATGCATTGAAGATGA CTTCA CCGCATGGCGGGAATTGGTCTGGCCTGAATTGGATAAGTTGCTTTTGGATGAGGATGACA CATCT GCTGCAACTCCTTACACAGCTGCTGTTTTGGAATATCGGGTTGTGGTTTATGACCAACTT GATACA GCTACACTGGATCGGAGTTTAAGTACCCAAAATGGCCATACAGTTCATGATGCTCAACAT CCGTG CAGGTCTAGCGTAGCTGCAAAGAAAGAGCTTCATAAACCTGCATCTGATCGTTCGTGCAT TCACT TGGAGTTTGACATTTCACACACCGGGCTTGCATATGAAACTGGTGACCACGTCGGGGTCT ACTGT GAGAATCTGGTTGAAATTGTTGAGGAGGCTGAAAAGCTATTAGGCATGCAACCAAACACT TACTT CTCTGTCCATATTGACGACGAAGATGGAACACCACTTACTGGAGGCTCTCTGCCACCTCC CTTCC CGCCATGCACTGTGAGAAGTGCACTGGCAAAATATGCAGATCTTTTGAGCTCTCCGAAGA AGTCT GCCTTGCTTGCTCTGGCGGCACATGCTTCTGATCCTACCGAGGCTGACCGATTAAGATTG TTAGC ATCTCCTGCTGGAAAGGATGAATATGCACAATGGGTAGTTGCTAGCCACAGAAGCCTTCT TGAAG TCTTGGCTGAATTTCCATCAGCCAAACCCCCACTGGGAGTATTCTTTGCATCAGTTGCAC CACGC TTGCAGCCCAGATACTATTCTATCTCTTCTTCACCAAGGATGGTACCATCAAGGATTCAT GTTACT TGTGCTTTAGTTTATGAGAAAACACCTACGGGGCGAATTCACAAAGGAGTGTGTTCAACT TGGAT GAAGAATGCTGTTTCTTTGGAGGAAAGCCATGATTGCAGTTGGGCACCCATTTTTGTTAG ACAATC CAACTTCAAGCTTCCTTCTGATACGAAAGTCCCCATCATTATGATTGGCCCTGGAACTGG ATTAGC TCCTTTCAGGGGTTTCCTGCAGGAAAGGCAAGCTCTGAAGGATGCTGGAGCAGAGCTGGG AACT GCTGTGTTATACTTTGGGTGCAGGAATAGAAATTTGGATTTTATTTACGAGGATGAGCTA AATAAG TTTGTCGAAAGTGGTTCAATCTCTGAGCTAATTGTAGCTTTCTCACGTGAGGGGCCCACT AAGGA GTATGTGCAACATAAGATGTTGCAGAAAGCGTCAGAGATCTGGAACTTGATTTCTGAGGG TGCAT ATATTTATGTCTGCGGTGATGCAAAAGGCATGGCCAGGGATGTCCATCGCATGCTTCACA CAATT GCACAGGAGCAGGGAGCTCTTGACAGCAGCAAGGCGGAGAGCTGGGTTAAGAACCTTCAA ATGA CTGGGAGGTATCTTCGTGATGTATGGTAA SEQ ID No 28. Gossypium hirsutum cultivar CRI 12 NADP cytochrome P450 reductase (CPR1) imRNA, complete cds, FJ719368

ATGAGTTCGAGTTCCGATTTGGTGGGTTTTGTTGAATCGGTATTGGGAGTGTCGTTAGAG GGTTC

GGTAACGGATTCTATGATAGTGATCGCGACGACGTCGTTAGCGGTGATTCTGGGGCT TTTGGTGT

TTTTCTGGAAGAAATCGGGTTCCGAACGGAGCCGTGATGTCAAACCGTTGGTGGCAC CTAAGCC TGTTTCACTCAAGGACGAGGAAGACGACGACGCCGTTATCGCTGCCGGCAAAACTAAAGT TACC ATTTTCTACGGCACACAGACGGGAACGGCCGAGGGATTTGCTAAGGCTTTAGCCGAAGAG ATCA AGGCAAGATATGAGAAAGCTGCTGTCAAAGTTGTTGACCTGGATGATTATGCCATGGACG ATGAA CAATACGAAGAGAAGCTGAAAAAGGAGACTTTAGCTTTTTTCATGGTGGCCACTTATGGA GACGG AGAGCCAACCGATAACGCTGCTAGGTTTTACAAATGGTTTACTGAGGGAAATGAAAGGCT GCCGT GGCTTCAACAACTCACATATGGTGTATTTGGTCTGGGTAACCGTCAATATGAACATTTTA ATAAGA TAGCAAAGGTGCTTGATGAGCAACTTTCCGAACAAGGTGCTAAACGTCTTATTGAAGTTG GTCTT GGAGATGATGATCAATGCATTGAAGATGATTTTACTGCATGGAGAGAACTGCTCTGGCCA GAGTT AGATCAACTGCTTAGAGATGAAGATGATGAAAATGCTACCTCTACCCCGTATACGGCAGC TATTC CTGAATATAGAGTAGTGGTTCATGATCCTGCTGTGATGCACGTAGAGGAGAATTACTCAA ATAAG GCAAATGGGAATGCTACATATGACCTCCACCATCCATGCAGAGTTAATGTTGCCGTTCAG AGAGA GCTCCACAAGCCTGAATCTGATCGCTCCTGTATTCATTTGGAGTTTGACATATCAGGGAC TGGTAT CACATATGAAACCGGAGATCACGTTGGTGTCTACGCGGATAATTGCGTTGAGACTGTTGA GGAAG CTGCAAGATTGTTGGGTCAACCTCTGGATTTGCTATTTTCTATACACACTGACAATGAGG ACGGCA CATCTGCTGGAAGCTCATTGCCGCCACCTTTTGCCAGTCCATGTACACTGCGAATGGCAT TGGCA CGATATGCAGATCTTTTAAACCCTCCACGGAAGGCTGCTTTGATTGCCTTGGCTGCTCAT GCCAC TGAACCCAGTGAAGCAGAAAAGCTTAAGTTCTTATCGTCACCACAGGGGAAGGATGAGTA CTCAC AATGGGTTGTTGCAAGTCAGAGAAGTCTTCTTGAGGTTATGGCTGAGTTCCCATCAGCAA AACCT CCTCTTGGTGTATTTTTTGCTGCAGTAGCTCCTCGTTTACAGCCTCGTTATTATTCTATC TCATCCT CCCCTAGGTTTGTACCTGCCAGGGTTCATGTAACCTGCGCTTTAGTTTATGGTCCAACTC CAACT GGAAGAATTCACCGGGGTGTGTGCTCAACATGGATGAAGAATGCAGTTCCTTTAGAGAAA AGCAA TGATTGTAGCTGGGCTCCTATTTTTATTCGGCAATCCAATTTTAAGCTACCAGCAGATCC TTCAGT TCCAATCATCATGGTTGGACCCGGGACTGGATTGGCACCTTTCAGAGGTTTTCTACAGGA AAGAT TGGTCCTCAAAGAAGATGGTGCAGAACTTGGCTCTTCTCTACTCTTTTTTGGATGTAGGA ATCGG CGAATGGATTTCATTTATGAGGATGAGCTCAATAACTTTGTGGAACAAGGTGCCCTTTCT GAGCTT GTTGTTGCATTTTCACGAGAAGGTCCGCAGAAGGAATATGTTCAACACAAAATGATGGAT AAAGC TGCAGATATATGGAACCTAATTTCTAAGGGTGGATATCTTTATGTTTGTGGTGATGCCAA GGGTAT GGCAAGAGATGTTCATCGCACTTTGCACACTATTATTCAGGAGCAGGAAAATGTGGATTC ATCAA AGGCGGAGTCTATGGTGAAGAAACTCCAGATGGACGGACGATACCTTAGAGATGTGTGGT GA

SEQ ID No 29. Gossypium hirsutum cultivar CRI 12 NADP cytochrome P450 reductase (CPR2) mRNA, complete cds, FJ719369

ATGGATTCTTCATCATCATCATCATCTTCAGGTCCCTCACCTCTCGATCTCATGTCGGCT TTAGTC AAGGCCAAAATGGACCCTTCCAACGCTTCCTCCGACTCTGCTGCTCAAGTAACCACCGTC CTTTT CGAGAACAGAGAGTTCGTTATGATTTTAACTACCTCCATTGCTGTGCTCATCGGCTGCGT CGTCA TTTTGATCTGGCGTAGATCCGCTTCTCAAAAGCCTAAACAAATCCAGCTTCCTCTTAAGC CTTCGA TCATTAAAGAACCAGAACTTGAAGTTGACGATGGAAAGAAAAAAGTCACCATCCTCTTCG GTACTC AAACCGGCACCGCCGAAGGCTTCGCTAAGGCTCTAGTCGAGGAGGCAAAAGCACGCTATG AAAA GGCGACTTTTAATATTGTAGATTTGGATGATTATGCAGCAGATGATGAAGAATACGAGGA GAAGAT GAAGAAAGATAATTTGGCTTTCTTCTTCTTGGCCACTTATGGAGACGGTGAGCCAACAGA TAATG CAGCCAGGTTCTATAAATGGTTCACTGAGGGAAAAGAGAGGGGAGAATGGCTTCAGAACA TGAA GTATGGGATTTTCGGCCTTGGTAACAAACAGTATGAACATTTTAACAAGGTTGCAAAGGT GGTTGA TGAACTCCTTACCGAGCAGGGAGCGAAGCGCATAGTTCCTTTGGGTCTTGGAGATGATGA CCAAT GCATAGAAGATGACTTCACTGCATGGCGTGAATTAGTGTGGCCCGAGTTAGATCAGCTTC TGCGT GATGAAGATGATGCAACTGTTTCTACCCCGTACACTGCTGCTGTTTTGGAATACCGTGTT GTATTT TATGATCCTGCAGATGCACCCCTTGAGGATAAGAACTGGAGTAATGCAAATGGTCATGCT ACTTA TGATGCTCAACATCCTTGCAGGTCTAATGTGGCTGTGAGGAAGGAGCTTCATGCTCCTGA ATCTG ATCGGTCTTGCACCCACCTTGAATTTGACATTGCTGGAACTGGACTTTCATACGAGACAG GCGAT CATGTCGGTGTTTACTGTGAGAACCTGGATGAAGTTGTAGATGAAGCATTGAGTTTACTG GGCTT ATCACCCGACACTTATTTCTCTGTTCACACTGATAAAGAGGATGGTACACCACTTGGTGG AAGTTC TTTACCTTCTTCTTTCCCCCCTTGTACTCTGAGAACAGCACTGGCACGATATGCTGATCT TTTGAG CTCGCCAAAAAAGGCTGCCTTACTTGCTTTGGCTGCTCATGCCTCTGATCCAACTGAAGC CGATC GACTAAGACACCTTGCATCACCTGCTGGAAAGGATGAGTATGCTCAATGGATTGTTGCAA ACCAG AGAAGTCTCCTTGAGGTCATGGCGGAATTTCCTTCAGCCAAGCCTCCACTTGGTGTTTTC TTTGC AGCTGTTGCTCCAAGGTTGCAGCCTAGATATTATTCGATATCATCCTCACCAAGGTTGGC ACCAT CAAGGATTCATGTAACTTGTGCATTGGTTTATGAGAAAACGCCAACAGGTCGTATTCACA AAGGT GTTTGTTCAACTTGGATGAAGAATGCTGTGTCCTCGGGGAAAAGCGATGACTGCGGCTGG GCAC CCATTTTTGTCAGGCAATCAAACTTTAAACTTCCTTCAGATACTAAAGTGCCCATCATAA TGATTGG TCCTGGTACTGGATTGGCTCCTTTCAGGGGATTCCTTCAGGAAAGGCTTGCACTGAAAGA AGCTG GTGCTGAGTTGGGTCCATCTGTATTGTTCTTTGGCTGCAGAAACCGGAAAATGGATTTCA TATATG AAGATGAGCTCAACAACTTTGTCAACAGTGGTGCACTATCTGAGCTTGTGGTTGCCTTTT CACGT GAGGGACCTACCAAGGAATATGTGCAACATAAAATGATGGAGAAGGCCAAGGACATATGG GACA TGATTTCTCAGGGAGGTTACCTGTATGTGTGTGGTGATGCCAAGGGCATGGCTAGAGATG TTCAT CGAGCTCTTCACACTATTTTCCAAGAGCAGGGATCACTAGACAGCTCAAAGGCTGAGAGC ATGGT GAAAAATCTGCAAATGAGCGGCAGGTACCTACGCGATGTATGGTGA

Die folgenden Gensequenzen werden besonders bevorzugt für die Kodierung von Cytochrome P450 Monooxygenases (CYPs) eingesetzt:

SEQ ID No 30. Vitis vinifera CYP716A15 mRNA for cytochrome P450, complete cds, AB619802

ATGGAGGTGTTCTTCCTCTCCCTGCTCCTCATCTTTGTGCTCTCAGTCTCCATCGGA CTTCACTTG CTCTTCTACAAGCATAGATCCCACTTCACTGGCCCCAATCTCCCTCCTGGCAAGATTGGT TGGCC TATGGTTG GTGAAAGCCTTG AATTCCTCTCC ACCG GCTGG AAAGGCC ACCCG GAAAAATTCATCT TCGATCGCATCTCCAAATACTCCTCTGAAGTCTTCAAGACCTCCCTCCTCGGAGAGCCTG CTGCC GTCTTTGCTGGCGCTGCGGGCAACAAGTTTTTGTTCTCCAACGAAAACAAACTTGTTCAT GCGTG GTGGCCTAGCTCTGTCGACAAGGTCTTCCCCTCCTCCACCCAAACCTCATCCAAAGAGGA GGCC AAGAAGATGAGGAAGTTGCTCCCTCAGTTCTTTAAGCCTGAAGCCTTGCAACGTTACATT GGCAT CATGGATCACATTGCGCAGAGGCATTTTGCTGATAGCTGGGACAACAGAGATGAAGTCAT TGTAT TTCCACTGGCCAAGAGGTTCACTTTCTGGCTAGCTTGCCGCCTGTTTATGAGCATAGAAG ATCCT GCCCACGTCGCTAAATTTGAAAAGCCCTTCCATGTCTTGGCCTCAGGACTCATCACCGTC CCAAT TGACTTGCCTGGGACACCTTTCCACCGCGCTATCAAGGCCTCCAACTTCATCAGAAAGGA GCTTA GAGCCATCATCAAGCAAAGGAAGATCGATCTGGCTGAGGGCAAGGCCTCACAAAATCAAG ATATA TTGTCCCACATGCTTCTGGCTACAGATGAAGATGGATGCCACATGAATGAAATGGAAATT GCTGA TAAAATCCTCGGTTTGTTGATTGGTGGCCATGACACTGCCAGTGCTGCCATTACATTCCT TATCAA GTACATGGCTGAGCTGCCTCACATCTACGAGAAAGTCTACGAGGAGCAAATGGAAATTGC CAATT CAAAAGCACCAGGTGAATTGCTGAACTGGGATGATGTTCAAAACATGAGATATTCATGGA ATGTT GCCTGTGAAGTGATGAGACTTGCACCCCCACTCCAAGGAGCTTTCCGGGAAGCAATCACT GACT TCGTGTTCAACGGTTTCTCCATTCCTAAGGGTTGGAAGCTGTACTGGAGCGCAAACTCAA CCCAC AAAAGCCCAGAATGCTTCCCTCAACCCGAAAATTTTGACCCTACAAGATTTGAAGGAAAC GGGCC TGCTCCTTACACATTCGTTCCCTTTGGTGGCGGACCTAGGATGTGCCCTGGTAAAGAGTA CGCCC GCTTGGAAATACTAGTCTTCATGCACAACGTGGTTAAAAGGTTCAAATGGGATAAATTGC TTCCTG ATGAGAAGATAATCGTTGACCCCATGCCCATGCCTGCTAAGGGACTTCCAGTTCGCCTCC ATCCT CACAAACCATAG

SEQ ID No 31 . Vitis vinifera CYP716A17 mRNA for Cytochrome P450, complete cds, AB619803

ATGGAGGTGTTCTTCCTCTCCCTGCTCCTCATCTCTGTGCTCTCAGTCTCCATCAGA CTTTACTTG CTCTTATACAAGCATAGATCCCACTTCACTGGCCCCAATCTCCCTCCTGGCAAGATTGGT TGGCC AATGGTTGGTGAAAGCCTTGAATTCCTCTCCACCGGCTGGAAAGGCCACCCGGAAAAATT CATCT TCGATCGCATCTCCAAATACTCCTCTGAAGTCTTCAAGACCTCCCTCCTCGGAGAGCCTG CTGCC GTCTTTGCTGGCGCTGCGGGCAACAAGTTTTTGTTCTCCAACGAAAACAAACTTGTTCAT GCATG GTGGCCTAGCTCCGTCGACAAGGTCTTCCCCTCCTCCACCCAAACCTCATCCAAAGAGGA GGCC AAGAAGATGAGGAAGTTGCTCCCTCAGTTCCTTAAGCCTGAAGCCTTGCAACGTTACACC GGCAT CATGGATCACATTGCACAGAGGCATTTTGCTGATAGCTGGGACAACAGAGATGAAGTCAT TGTAT TTCCACTGGCCAAGAGGTTCACTTTCTGGCTAGCTTGCCGCCTGTTTATGAGCATAGAAG ATCCT GCCCACGTCGCTAAATTTGAAAAGCCCTTCCACGTCTTGGCCTCAGGACTCATCACCATC CCAAT TGACCTGCCTGGGACACCTTTCCACCGCGCTATCAAGGCCTCCAACTTCATCAGAAAGGA GCTTA GAGCCATCATCAAGCAAAGGAAGATCGATCTGGCTGAGAGCAAGGCCTCAAAAACTCAAG ATATA TTGTCCCACATGCTTCTGGCTACAGATGAAGATGGATGCCACATGAATGAAATGAGTATT GCTGA TAAAATCCTCGGTTTGTTGATTGGTGGCCATGACACTGCCAGTTCTGCCATTACATTCCT TGTCAA GTACATGGCTGAGCTGCCTCACATCTACGAGAAAGTCTACAAGGAGCAAATGGAAATTGC CAATT CAAAAGCACCAGGTGAATTGCTGAACTGGGATGATGTTCAAAAGATGAGATATTCATGGA ATGTT GCCTGTGAAGTGATGAGACTTGCACCCCCACTCCAAGGAGCTTTCCGGGAAGCAATCACT GACT TCGTGTTCAACGGTTTCTCCATTCCTAAGGGTTGGAAGCTGTACTGGAGCGCAAACTCAA CCCAC AAAAGCCTAGAATGCTTCCCTCAACCCGAAAAATTTGACCCTACAAGATTTGAAGGAGCC GGGCC TGCTCCTTACACATTCGTTCCCTTTGGTGGCGGACCTAGGATGTGCCCTGGTAAAGAGTA CGCCC GCTTGGAGATACTTATCTTCATGCACAACTTGGTTAAAAGGTTCAAATGGGATAAATTGC TTCCTG ATGAGAAGATAATCGTTGACCCCATGCCCATGCCTGCTAAGGGACTTCCAGTTCGCCTCC ATCCT CACAAACCATAG

SEQ ID No 32. Medicago truncatula cytochrome P450 monooxygenase CYP716A12 (CYP716A12) imRNA, complete cds, DQ335781

ATGGAGCCTAATTTCTATCTCTCCCTTCTCCTTCTCTTTGTCACTTTCATATCTCTCTCT CTTTTTTT CATATTCTACAAACAGAAATCTCCATTAAATTTGCCACCTGGTAAAATGGGTTACCCAAT CATAGG TGAAAGCCTTGAGTTCTTATCAACAGGATGGAAAGGACATCCTGAAAAATTCATTTTCGA CCGTAT GCGTAAATATTCCTCAGAACTCTTTAAAACATCAATCGTAGGAGAATCTACGGTGGTTTG TTGCGG AGCAGCAAGTAACAAGTTTTTGTTTTCAAACGAGAATAAACTTGTGACTGCATGGTGGCC AGATAG TGTAAACAAAATCTTCCCTACTACTTCTCTTGACTCTAACTTGAAGGAAGAATCCATCAA GATGAG AAAATTGCTTCCACAATTCTTTAAACCCGAAGCTCTACAACGTTATGTTGGTGTCATGGA TGTTATT GCTCAAAGACATTTTGTTACTCATTGGGATAATAAAAATGAAATCACCGTCTACCCCTTG GCCAAG AGGTACACCTTTTTGTTAGCTTGTCGGTTGTTCATGAGCGTTGAAGACGAGAATCATGTA GCAAAA TTTAGTGATCCATTTCAGTTAATTGCGGCCGGAATCATATCTCTACCAATTGATTTGCCA GGAACA CCATTCAACAAAGCTATAAAGGCCTCAAACTTTATAAGAAAGGAGTTGATTAAGATCATA AAGCAA AGGAGGGTAGATTTGGCAGAAGGGACAGCATCACCAACACAAGATATATTGTCTCACATG TTGTT GACAAGTGATGAAAATGGAAAGAGTATGAATGAACTTAATATTGCTGATAAGATTCTTGG CCTTTT GATCGGAGGACATGACACTGCTAGCGTCGCATGCACTTTCCTTGTCAAATATCTCGGCGA GTTAC CTCACATTTATGATAAAGTCTATCAAGAGCAAATGGAAATTGCAAAATCGAAACCAGCAG GAGAAT TGTTGAATTGGGATGACCTGAAGAAAATGAAATACTCTTGGAACGTAGCTTGTGAAGTAA TGAGA CTTTCCCCTCCACTCCAAGGAGGTTTCAGGGAAGCCATCACTGACTTTATGTTCAATGGA TTCTCA ATTCCTAAGGGATGGAAGCTTTATTGGAGTGCAAATTCAACACATAAGAACGCAGAATGT TTTCCC ATGCCAGAGAAATTTGACCCAACAAGATTTGAAGGAAATGGACCAGCTCCTTATACTTTT GTTCCC TTTGGTGGAGGACCAAGGATGTGTCCTGGAAAAGAGTATGCAAGATTAGAAATACTTGTT TTCAT GCACAATTTGGTGAAAAGGTTTAAGTGGGAAAAGGTGATTCCAGATGAGAAGATTATTGT TGATC CATTCCCCATCCCTGCAAAGGATCTTCCAATTCGCCTTTATCCACACAAAGCTTAA

SEQ ID No 33. Catharanthus roseus cytochrome P450 (CYP716AL1 ) mRNA, complete cds, JN565975

ATGGAGATCTTCTATGTCACTCTCCTTAGCTTATTCGTTCTCCTTGTTTCCCTTTCC TTTCATTTCC TCTTCTACAAAAACAAATCAACCTTGCCGGGACCGTTACCTCCGGGCCGGACCGGCTGGC CGAT GGTG GG AG AAAGTCTTC AATTTCTCTC AGCGGG CTG G AAAGGCC ATCCTGAAAAATTCATATTTG ATCGTATGGCTAAGTATTCTTCGAATGTCTTTAGGTCACATCTACTAGGTGAACCTGCCG CGGTAT TTTGTGGTGCAATTGGAAATAAATTTTTATTCTCAAATGAAAATAAACTTGTTCAAGCAT GGTGGCC TGATTCAGTAAACAAAGTTTTCCCATCTTCAAATCAAACTTCTTCAAAAGAAGAAGCTAT TAAAATG CGAAAGATGCTTCCGAATTTTCTTAAACCGGAAGCTTTACAACGTTACATAGGTTTAATG GACCAA ATTGCCCAAAAACATTTTTCTTCCGGTTGGGAAAATAGGGAACAAGTTGAAGTTTTTCCT TTAGCC AAAAATTATACTTTTTGGTTAGCTTCAAGATTATTTGTTAGTGTTGAAGATCCAATTGAA GTTGCAA AATTACTTGAACCCTTTAATGTTTTGGCCTCGGGACTAATTTCTGTCCCTATTGATTTGC CTGGTAC ACCTTTTAATCGTGCTATAAAGGCATCAAATCAAGTAAGAAAAATGCTTATTTCTATAAT TAAACAA AG AAAAATTG ATTTAG CTG AAG G AAAAG CATCTCC AAC AC AAG ATATTTTGTC AC ATATGCTTTTAA CAAGTGATGAAAATGGTAAATTCATGCATGAATTGGATATTGCTGATAAAATCCTTGGTT TGTTAAT TGGTGGACATGATACTGCAAGTTCTGCATGTACTTTTATTGTCAAGTTTCTTGGAGAATT GCCAGA GATATATG AAG GAGTTTATAAAG AAC AAATGG AG ATTGCC AACTC AAAAGCCCCTG GTGAATTCTT GAATTGGGAAGATATTCAAAAGATGAAATATTCATGGAATGTAGCATGTGAAGTGTTGAG ACTTGC ACCACCTCTCCAAGGTGCTTTTAGAGAAGCCCTAAATGATTTCATGTTCCATGGATTCTC TATTCC AAAAGGATGGAAGATTTACTGGAGTGTGAATTCAACACACAGAAATCCAGAATGTTTTCC AGATCC ACTTAAATTTGACCCGTCAAGATTTGATGGATCTGGACCTGCTCCATATACATTTGTACC ATTTGG TGGAGGACCAAGAATGTGCCCTGGAAAAGAATACGCTAGGCTGGAAATTCTGGTTTTTAT GCATA ATCTTGTGAAGAGATTCAAGTGGGAAAAAATTATCCCAAATGAAAAGATTGTTGTTGATC CAATGC CAATTCCTGAAAAAGGACTTCCTGTTCGACTTTATCCTCACATTAATGCATAA

SEQ ID No 34. Populus trichocarpa cytochrome P450 (CYP716A9), mRNA, XM_002331391

ATGGAGCTTCTCTTCCTCTCACTCCTCCTCGCCCTCTTTGTTTCCTCCGTCACTATT CCCCTCTTT CTCATCTTTTACAATCATCGATCCCAGAACAGCCACCCCAACCTCCCTCCAGGCAAGCTA GGCCT TCCCCTTGTTGGAGAAAGCTTTGAGTTCTTGGCCACGGGATGGAAAGGCCATCCTGAAAA GTTCA TCTTTGATCGCATAGCTAAATACTCATCTCACATCTTCAAGACAAATATTCTTGGTCAAC CAGCAGT TGTCTTTTGTGGTGTTGCTTGTAACAAGTTTTTGTTTTCCAATGAGAACAAGCTCGTTGT ATCCTG GTGGCCCG ACTCTGTTAACAAAATCTTTCCCTCTTCACTTCAAACATCATCTAAAG AGG AAGCCAA GAAAATGAGAAAACTTCTCCCTCAGTTCTTGAAACCTGAGGCCTTGCAAGGATACATTGG TATCAT GGATACCATTGCACAAAGACACTTCGCCTCGGAATGGGAACATAAAGAACAAGTGCTGGT GTTCC CTTTGTCAAAGAATTACACCTTTCGTTTGGCTTGTAGATTGTTTCTGAGTATTGAAGATC CAAGCC ACGTAGCTAAATTTTCTGACCCCTTTAATCTTTTAGCCTCGGGTATCATTTCCATCCCCA TTGATTT GCCCGGG ACTCC ATTC AACCG AGCTATC AAAGCCTC AAACTTC ATCAG AACTG AGCTTTTAGCTT TTATAAGACAAAGAAAGAAGGATCTTGCAGAGGGAAAAGCTTCCCCCACGCAGGATATAT TGTCA CACATGTTGTTGACATGTGATGAAAATGGAAAATGCATGAATGAGCTTGATATTGCTGAT AAGATC ATTGGATTGTTGATTGGTGGGCATGATACAGCCAGCGCTGCTTGTACCTTCATTGTCAAG TATCTT GCAGAGCTTCCACATATATATGAGGAAGTTTACAAGGAACAAATGGAGATAGCCAAATCC AAAAC TCCTGGTGAATTCTTGAATTGGGATGACATTCAGAAGATGAAATACTCATGGAAAGTAGC TTGTGA AGTGATGAGGATCTCACCACCGCTTCAAGGTGCTTTTAGGGAAGCTCTCAATGATTTCAT TTTCAA TGGCTTTACCATTCCAAAGGGTTGGAAGTTATATTGGAGCACCAACTCAACCCATAGAGA TCCCG TCTACTTTCCTGAACCTGAGAAATTTGATCCTAGGAGGTTTGAAGGAAGTGGGCCAGCTC CATAC ACGTTTGTCCCCTTCGGTGGAGGACCTCGGATGTGCCCTGGAAAGGAGTATGCTCGCTTG GAAA TACTC GTTTTC ATG CATAATTTG GTC AG AAG GTTTAAATTTG ATAAGTTG ATTC AAG ATGAAAAG AT TGTAGTGAATCCACTGCCAATCCCTGATAAAGGACTTCCTGTTCGCCTTCATCCTCACAA GGCCT AG

SEQ ID No 35.: Glycine max cytochrome P450 716B2-like (LOCI 00801007), mRNA, XM_003525274

ATGGACCATAATAACTTGTACCTCTCCCTCCTTCTCCTCTTCGTTTCTTTCGTGACC CTCTCCCTCT TCTTCCTCTTCTACAAACACAGGTCTCCATTCGTGGCCCCGAACCTGCCACCTGGAGCAA CCGGT TACCCGGTGATCGGGGAGAGCCTGGAGTTCCTGTCAACAGGATGGAAGGGTCATCCGGAG AAG TTCATCTTCGACCGGATGATCAGGTACTCCTCCCAACTGTTCAAGACCTCCATCTTCGGG GAACC CGCGGTCATATTCTGTGGGGCCACCTGCAACAAGTTCTTGTTCTCTAACGAGAACAAGCT TGTTG CAGCGTGGTGGCCCAACAGCGTCAACAAGGTGTTCCCCTCCACGCTTCAGAGCAACTCCA AAGA AGAGTCCAAAAAGATGAGGAAGTTGCTCCCTCAGTTCCTCAAGCCCGAGGCTCTCCAACG CTAC GTTGGCATCATGGACACCATCGCTCAAAACCACTTCGCTTCCCTTTGGGACAACAAGACG GAACT CACCGTCTATCCCTTGGCTAAGAGGTACACGTTCTTGTTGGCTTGTCGTTTGTTTATGAG CGTTGA GGATGTGAATCACGTAGCAAAATTTGAGAACCCTTTTCACCTGTTGGCGTCTGGAATCAT ATCAGT GCCTATTGATCTTCCTGGAACGCCGTTCAACAAAGCAATCAAGGCAGCAAACGCAATCAG GAAGG AACTGTTAAAGATCATTAGACAGAGGAAGGTTGATTTAGCTGAAGGAAAAGCTTCACCAA CACAA GACATTTTATCTCACATGTTGTTAACATGCAATGAGAATGGACAATTCATGAATGAATTG GATATTG CCGAC AAG ATTCTTG GCCTTTTG ATTG GAGGCC ATG AC ACTGCTAGTG CTG CATGC ACTTTC ATT GTCAAATATCTTGCTGAACTCCCTCACATTTATGATAGTGTCTATCAAGAACAAATGGAA ATCGCA AAATCGAAATTGCCCGGAGAGTTATTGAATTGGGATGATATCAACAGGATGAAGTATTCT TGGAAT GTAGCTTGTGAAGTAATGAGAATCGCTCCTCCACTTCAAGGAGGTTTTAGGGAAGCTATC AATGA CTTTATTTTCAATGGCTTCTCAATTCCAAAGGGATGGAAGTTGTATTGGAGTGCAAATTC AACACA TAAAAATCCGGAATACTTTCCAGAGCCAGAGAAATTCGATCCAACTAGATTCGAAGGACA AGGGC CAGCTCCTTTTACTTTTGTACCATTTGGTGGAGGACCAAGGATGTGCCCCGGAAAAGAGT ATGCT CGATTGGAAATATTGGTTTTCATGCACAACCTAGTGAAGAGGTTTAAGTGGGAAAAATTG ATTCCA GATGAGAAGATTATCGTTGATCCCTTGCCCGTACCTGCAAAGAACCTCCCAATTCGTCTT CATCCT CACAAACCCTGA

SEQ ID No 36. Bupleurum chinense cytochrome P450 CYP716A41 mRNA, complete cds, JF803813

ATGATGATGTACTTGTATTTTTCAGTCATCAGCATTCTTGTTCTACTTCCTTGTGTA TGGCTCTTCT TCTTACACTCGAACAGAAAATCAACCCAACAATCATACAAATCTCTCCCACCAGGAGAAA CGGGC TATTTTCTCATCGGAGAAAGCTTAGAATTTCTGTCCACAGGAAGGAAAGGCCATCCTGAA AAGTTC ATTTTTGATCGCATGACAAAGTACGCCTCTAAAATTTTCAAATCATCGCTATTTGGAGAG AAAACAA TAGTCTTTTGTGGTGCTGCTAACAACAAGTTTTTGTTTTCTGACGAAAACAAGCTGGTGC AGTCGT GGTGGCCTAACTCCGTAAACAAACTCTTCCCTTCCTCTACACAAACTTCTTCGAAAGAAG AAGCCA TCAAAATGAGGAAAATGCTTCCAAACTTCTTCAAACCCGAGGCCTTGCAAAGATATGTTG GTGTTA TGGATGAAATAGCTCAAAAACACTTTGATTCTTGTTGGGAAAACAAACACACGGTCATTG TTGCAC CTCTCACCAAGCGTTTCACCTTTTGGCTTGCTTGTCGTTTGTTTGTCAGCCTTGAAGATC CTACAC AGGTAGCTAAATTTGCTGAGCCTTTCAATCTATTGGCCTCTGGAGTTTTTTCTATTCCTA TTGATTT ACCGGGAACAGCATTCAATCGAGCTATTAAAGCCTCTAACTTCATTCGAAAAACGCTTAT TGGCAT CATTAAAAAAAGAAAGGTTGATTTAGAGGATGGAACTGCATCAGCCACACAAGATATTTT GTCGCA TATGCTCTTGACAAGCGATGAGACTGGAAAGTTCATGACTGAAGCCGATATTGCTGATAA AATATT AGGTTTGTTGATAGGAGGTCATGATACTGCTAGCTCTGCTTGTGCTTTGATTGTCAAGTA TCTTGC TGAACTCCCTCACATATATGATGGAGTCTATAGAGAGCAAATGGAAATTGCAAAATCTAA ATCTCC AGGGGAGTTGCTAAACTGGGATGATGTACAAAAGATGAAATATTCATGGAATGTAGCATG TGAAG TTTTGAGACTTGCACCACCCCTCCAAGGAAGTTTTAGAGAAGTACTTTCTGATTTCATGC ACAATG GTTTCTCCATACCCAAGGGATGGAAGATCTATTGGAGTGCGAATTCGACACATAAAAGTT CAGAA TATTTCCCAGAGCCAGAAAAGTTTGATCCGAGACGATTTGAAGGGTCAGGACCAGCACCC TACAC ATTTGTGCCATTTGGAGGTGGACCAAGAATGTGCCCTGGAAAAGAATATGGTAGATTGGA GATAC TTGTATTCATGCACCACTTGGTGAAGAGGTTCAGATGGCAAAAAATATATCCTCTGGAGA AGATTA CTGTTAATCCAATGCCTTTCCCTGACAAGGATCTTCCAATTCGCCTATTTCCTCACAAAG CATAG

SEQ ID No 37.: Cucumis sativus cytochrome P450 716B1 -like (LOC101206033), mRNA,

XM_004139039

ATGGAGCTTTTCCTCATCTCTCTCTTAATCCTTTTGTTCTTCTTTCTTTCTCTTACTCTT TTCATCCT CTTCCACAATCACAAATCCTTATTCTCTTATCCCAACACTCCTCCTGGCGCCATCGGCCT TCCCAT ACTCGGCGAGAGCGTCGAGTTCTTATCATCTGGTTGGAAAGGCCATCCTGAGAAGTTCAT CTTCG ATCGTTTGAATAAGTACAAGTCAGATGTGTTCAAAACCTCGATCGTGGGAGTTCCAGCCG CCATT TTCTGCGGCCCTATTTGTAACAAGTTCCTCTTCTCTAACGAGAATAAACTGGTTACTCCT TGGTGG CCAGATTCCGTGAACAAGATCTTCCCCTCTACAACTCAGACTAGCACCAAAGAAGAAGCT AAGAA ACTCAAGAAACTCCTTCCGCAATTCCTTAAACCCGAAGCGCTTCAGCGTTATATTGGAAT TATGGA CGAACTTGCTGAACGCCATTTCAATTCCTTTTGGAAGAACAGAGAAGAGGTCCTCGTGTT TCCTCT TGCTAAAAGCTTCACATTCTCAATAGCGTGCCGACTGTTCATGAGCGTGGAAGATGAAAT TCACG TGGAGAGATTATCGGGACCATTCGAGCACATTGCAGCAGGAATCATATCGATGCCGATCG ATTTA CCAGGAACGCCATTCAATAGAGCAATAAAGGCGTCAAAGTTCATCAGAAAGGAAGTGGTG GCGA TCGTGAGGCAGAGGAAACAGGATTTGGCGGAAGGAAAGGCGTTGGCGACGCAGGATATTT TGTC CCACATGCTTCTAACGTGCGATGAGAATGGTGTGTACATGAACGAATCAGATATCACCGA TAAGA TTCTTGGGTTGTTGATCGGCGGCCATGACACTGCCAGTGTTGCATGCACCTTCATCGTTA AGTTC CTCGCTGAGCTTCCTCATATCTACGATGCTGTATATACAGAGCAAATGGAAATAGCAAGA GCAAA AGCGGAAGGGGAAACGTTGAAGTGGGAAGACATTAAGAAGATGAAATATTCATGGAATGT GGCTT GTGAGGTTCTAAGAATTGCTTCCCCACTCCAAGGTGCCTTTAGGGAAGCCTTAAGTGACT TCGTT TTCAATGGTTTTTTCATTCCCAAGGGTTGGAAGCTATATTGGAGTGCAAACTCGACACAC AAAAAC CCCGAGTACTTCCCAGAACCTTATAAGTTCGATCCGGGAAGATTTGAAGGAAATGGACCA TTACC CTACACATTTGTGCCGTTTGGGGGAGGGCCAAGGATGTGCCCTGGTAAGGAGTATGCAAA GCTT GAGATTTTGGTGTTCATGCATAATTTGGTGAAGAGATTCAAATGGACAAAGCTTCTTGAA AATGAA AACATCATTGTTAACCCAATGCCAATCCCTCAAAAAGGTCTCCCAGTTCGCCTTTTTCCT CATCAA CCTCTTTCTCTTTAA

SEQ ID No 38. Panax notoginseng ebne 00445η cytochrome P450 mRNA, complete eds, GU997666 ATGGAACTCTTCTATGTCCCTCTCCTCTCCCTCTTTGTTCTCTTCATCTCTTTATCATTC CACTTCC TCTTCTACAAGTCCAAATCCAGCTCCTCCGTCGGGCTTCCTCTCCCGCCGGGCAAGACCG GATG GCCCATTATCGGCGAGAGCTACGAGTTTCTCTCCACGGGGTGGAAAGGCTACCCGGAGAA GTTT ATATTTGACCGTATGACCAAGTACTCCTCAAATGTCTTTAAAACCTCTATTTTCGGAGAG CCCGCC GCAGTATTCTGCGGCGCGKCTTGTAACAAGTTCTTGTTCTCGAACGAAAACAAGCTTGTT CAGGC GTGGTGGCCTGACTCCGTAAACAAAGTTTTTCCTTCTTCAACTCAAACCTCTTCGAAAGA AGAGG CGATTAAGATGCGAAAAATGCTGCCAAACTTCTTTAAACCGGAGGCCTTGCAGCGCTACA TCGGC CTCATGGACCAAATCGCTGCAAAGCACTTTGAATCCGGTTGGGAAAATAAAGACGAAGTG GTTGT ATTTCCCCTGGCAAAATCCTAYACGTTTTGGATCGCGTGTAAGGTATTTGTTAGCGTAGA GGAAC CTGCGCAGGTTGCGGAGCTGTTGGAACCATTTAGCGCGATTGCTTCTGGGATTATATCCG TGCCA ATAGATTTGCCCGGCACGCCGTTTAACAGTGCCATAAAATCATCGAAAATTGTTAGGAGA AAGCTT GTGG GG ATTATTAACC AGAGG AAAATTG ATTTAG GGG AGGG AAAG GCTTC ACC AAC AC AAG AC AT ATTGTCACACATGTTGTTGACGAGTGATGAAAGTGGCAAGTTTATGGGTGAGGGGGAAAT TGCTG ATAAGATATTGGGGTTGTTGATTGGAGGACATGACACTGCAAGTTCTGCATGTACTTTTG TTGTCA AGTTTCTTGCTGAGCTGCCTCAGATTTATGRGGGAGTCTACCAGGAGCAAATGGAGATAG TGAAA TCTAAAAAGGCAGGAGAATTATTGAAGTGGGAGGACATACAAAAGATGAAATATTCGTGG AATGT AGCCTGTGAAGTGCTGAGACTTGCACCACCCCTTCAAGGAGCTTTTAGAGAAGCCCTCTC CGATT TCACCTACAACGGTTTCTCAATCCCCAAAGGCTGGAAGCTATATTGGAGTGCAAATTCAA CCCAC AGAAACTCAGAAGTTTTCCCGGAGCCACTAAAATTTGATCCATCAAGATTCGACGGAGCC GGGCC GCCGCCGTTCTCGTTCGTGCCGTTCGGCGGCGGGCCGAGAATGTGCCCCGGAAAAGAGTA TGC CCGGCTGGAAATACTGGTGTTTATGCACCATCTTGTCAAGAGGTTCAAGTGGGAAAAGGT TATTC CTGATGAGAAAATTGTTGTTAATCCCATGCCAATTCCTGCCAACGGACTTCCTGTTCGCC TATTTC CACACAAAGCCTAA SEQ ID No 39. Panax ginseng cytochrome P450 CYP716A52v2 mRNA, complete cds, JX036032

ATGGAACTCTTCTATGTCCCTCTCCTCTCACTCTTTGTTCTCTTCATCTCTTTATCA TTCCACTTCC TCTTCTACAAGTCCAAACCCAGCTCCTCCGGCGGGTTTCCTCTCCCGCCGGGCAAGACTG GGTG GCCCATTATTGGAGAGAGCTACGAGTTTCTCTCCACGGGATGGAAAGGCTACCCGGAGAA GTTC ATATTTGACCGTATGACCAAGTACTCCTCAAATGTCTTTAAAACCTCTATTTTCGGAGAG CCCGCC GCAGTATTCTGCGGCGCGGCTTGTAACAAGTTCTTGTTCTCGAACGAGAATAAGCTTGTT CAGGC CTGGTGGCCTGACTCCGTGAACAAAGTTTTTCCTTCATCAACCCAAACCTCTTCGAAAGA AGAGG CGATTAAGATGCGAAAAATGCTGCCAAACTTCTTTAAACCGGAGGCTTTGCAGCGCTACA TCGGC CTCATGGACCAAATCGCTGCAAATCACTTTGAATCCGGTTGGGAAAATAAAAACGAAGTG GTTGT ATTTCCCCTGGCAAAATCCTACACGTTTTGGATCGCGTGTAAGGTATTTGTTAGCGTAGA GGAAC CTGCGCAGGTTGCGGAGCTGTTGGAACCATTCAGCGCGATTGCTTCTGGGATTATATCCG TCCC AATAGATTTGCCCGGCACGCCGTTTAACAGTGCCATAAAATCATCGAAAATTGTTAGGAG GAAGC TTGTGGGGATTATTAAGCAGAGGAAAATTGATTTAGGGGAGGGAAAGGCTTCAGCAACAC AAGAC ATATTGTCACACATGCTGTTGACAAGTGATGAAAGTGGCAAGTTTATGGGTGAGGGGGAT ATTGC CGATAAGATATTGGGGTTGTTGATTGGAGGCCATGACACTGCAAGTTCTGCATGTACTTT TGTTGT CAAGTTTCTTGCTGAGCTGCCTCAGATTTATGAGGGAGTCTACCAGGAGCAAATGGAGAT AGTGA AATCTAAAAAGGC AG GAG AATTATTGAAGTG GG AGG AC ATAC AAAAGATG AAATATTCGTG G AAT GTAGCCTGTGAAGTGCTGAGACTTGCACCACCTCTTCAAGGAGCTTTTAGAGAAGCCCTC TCCGA TTTCACCTACAACGGTTTCTCAATCCCTAAAGGCTGGAAGCTATATTGGAGTGCAAATTC AACCCA CATAAACTCAGAAGTTTTCCCGGAGCCACTAAAATTTGATCCATCAAGATTCGACGGAGC CGGGC CGCCGCCGTTCTCGTTCGTGCCGTTCGGCGGCGGGCCGAGAATGTGCCCCGGAAAAGAGT ATG CCCGGCTGGAAATACTGGTGTTTATGCACCATCTTGTCAAGAGGTTCAAGTGGGAAAAGG TTATT CCTGATGAGAAAATTGTTGTTAATCCCATGCCAATTCCTGCCAACGGACTTCCTGTTCGC CTATTT CCACACAAAGCCTAA

SEQ ID No 40. Ricinus communis cytochrome P450, putative, mRNA, XM_002522891

ATGGACCACTTCTATCTTACCCTTCTTTTCCTCTTCGTTTCCTTCATCACCTTTTCA ATTTTTATCAT ATTTTACAAGCACAAATCTCAATACAATTATCCAAGTCTTCCTCCAGGGAAGCCTGGCCT CCCTTT TGTTGGTGAAAGCCTTGAATTTTTGTCTTCAGGTTGGAAGGGTCACCCTGAAAAGTTTGT GTTTGA TAGAACTTCTAAATATTCTTCTGAGATTTTTAAAACTAATCTTCTTGGCCAACCTGCTGC TGTCTTC TGTGGTGCTTCTGCCAACAAGTTTTTGTTCTCCAATGAAAACAAGCTTGTTCAGGCCTGG TGGCC TGATTCTGTTAACAAAATATTCCCTTCTTCTCTTCAAACTTCTTCTAAAGAAGAAGCCAT TAAAATG AGAAAGCTTCTCCCTCAGTTCATGAAACCTGAAGCCCTCCAGCGTTATATTGGTATCATG GATACA ATTGCTCAGAGGCACTTTGCTTCGGGATGGGAAAAAAAAAATGAAGTAGTTGTGTTTCCT CTAGC GAAGAATTACACCTTCTGGTTAGCGTGCAGACTGTTTGTCAGCCTGGAAGATCCAGATCA CATCG CTAAATTTGCAGACCCTTTTCAGGAATTGGCTTCAGGAATCATTTCCGTGCCAATAGATT TGCCTG GAACACCATTCAGAAGAGCAATCAAAGCTTCAAACTTCATCAGGAAAGAGCTTATAAGTA TTATAA AGCAAAGAAAGATTGATCTAGCAGAAGGGAAAGCTTCTGGTACACAGGATATATTGTCCC ATATG TTGTTAACATCAGATGAGGATGGAAAGTTTATGAATGAGATGGATATTGCCGACAAAATT CTTGGA TTGCTGATTGGTGGGCATGATACTGCTAGTGCTGCTTGTACTTTCATTATCAAGTACCTT GCTGAG CTCCCTCAAATCTATGATGCAGTTTACAAAGAGCAAATGGAGATTGCAAAATCAAAAGGA GAAGG AGAGTTGTTGAATTGGGAAGACATACAGAAGATGAAATATTCATGGAATGTGGCATGTGA AGTTAT GAGAGTTGCACCACCCCTTCAAGGTGCTTTCAGGGAAGCTATCAATGACTTTATCTTTAA TGGCTT CTATATTCCAAAAGGCTGGAAGCTATATTGGAGTGCAAACTCAACACACAAAAGTGCAAC ATACTT TGAAGAACCAGAGAAATTTGATCCAAGTAGATTTGAAGGGAAAGGACCAGCCCCATACAC ATTTG TACCATTTGGAGGAGGACCAAGAATGTGCCCTGGGAAAGAGTATGCTAGACTGGAAATTC TTGTT TTCATGCATAATCTGGTCAAAAGATTCAATTTCCAAAAGATAATTCCTGATGAGAACATC ATTGTTA ATCCTTTGCCTATCCCTGCTAAGGGTCTTCCAGTTCGCCTTCTTCCTCATCAAATTTAG

SEQ ID No 41 . Vitis vinifera contig W78X175946.8, whole genome shotgun sequence, AM457725 ATGGAGGTGTTCTTCCTCTCCCTGCTCCTCATCTGTGTGCTCTCAGTCTCCATCAGACTT TACTTG CTCTTATACAAGCATAGATCCCACTTCACTGGCCCCAATCTCCCTCCTGGCAAGATTGGT TGGCC AATGGTTGGTGAAAGCCTTGAATTCCTCTCCACCGGCTGGAAAGGCCACCCGGAAAAATT CATCT TCGATCGCATCTCCAAATACTCCTCTGAAGTCTTCAAGACCTCCCTCCTCGGAGAGCCTG CTGCC GTCTTTGCTGGCGCTGCGGGCAACAAGTTTTTGTTCTCCAACGAAAACAAACTTGTTCAT GCGTG GTGGCCTAGCTCTGTCGACAAGGTCTTCCCCTCCTCCACCCAAACCTCATCCAAAGAGGA GGCC AAGAAGATGAGGAAGTTGCTCCCTCAGTTCCTTAAGCCTGAAGCCTTGCAACGTTACACC GGCAT CATGGATCACATTGCACAGAGGCATTTTGCTGATAGCTGGGACAACAGAGATGAAGTCAT TGTAT TTCCACTGGCCAAGAGGTTCACTTTCTGGCTAGCTTGCCGCCTGTTTATGAGCATAGAAG ATCCT GCCCACGTCGCTAAATTTGAAAAGCCCTTCCACGTCTTGGCCTCRGGACTCATCACCATC CCAAT TGACCTGCCTGGGACACCTTTCCACCGCGCTATCAAGGCCTCCAACTTCATCAGAAAGGA GCTTA GAGCCATCATCAAGCAAAGGAAGATCGATCTGGCTGAGAGCAAGGCCTCAAAAACTCAAG ATATA TTGTCCCACATGCTTCTGGCTACAGATGAAGATGGATGCCACATGAATGAAATGARTATT GCTGAT AAAATCCTCGGTTTGTTGATTGGTGGCCATGACACTGCCAGTTCTGCCATTACATTCCTT GTCAAG TACATGGCTG AGCTGCCTCACATCTACG AG AAAGTCTACAAGG AGCAAATGG AAATTGCCAATTC AAAAGCACCAGGTGAATTGCTGAACTGGGATGATGTTCAAAAGATGAGATATTCATGGAA TGTTG CCTGTGAAGTGATGAGACTTGCACCCCCACTCCAAGGAGCTTTCCGGGAAGCAATCACTG ACTTC GTGTTCAACGGTTTCTCCATTCCTAAGGGTTGGAAGCTGTACTGGAGCGCAAACTCAACC CACAA AAGCCTAGAATGCTTCCCTCAACCCGAAAAATTTGACCCTACAAGATTTGAAGGAGCCGG GCCTG CTCCTTACACATTCGTTCCCTTTGGTGGCGGACCTAGGATGTGCCCTGGTAAAGAGTACG CCCG CTTGGARATACTTATCTTCATGCACAACTTGGTTAAAAGGTTCAAATGGGATAAATTGCT TCCTGA TGAGAAGATAATCGTTGACCCCATGCCCATGCCTGCTAAGGGACTTCCAGTTCGCCTCCA TCCTC ACAAACCATAG

SEQ ID No 42. : Vitis vinifera cytochrome P450 716B24ike (LOCI 00262400), mRNA, XM_002265988 ATGGAGGTGTTCTTCCTCTCCCTGCTCCTCATCTGTGTGCTCTCAGTCTCCATCGGACTT CAGTTC CTCTTCTACAAGCACAGATCCCACTTCACTGGCCCCAACCTCCCCCCTGGCAGGATTGGT TGGC CTATGGTTGGTGAAAGCCTTGAATTCCTCTCCACCGGCTGGAAAGGCCACCCGGAAAAAT TCATC TTCGATCGCATCTCCAAATACTCCTCTGAAGTCTTCAAGACCTCCCTCCTCGGAGAGCCT GCTGC CGTCTTTGCTGGCGCTGCGGGCAACAAGTTTTTGTTCTCCAACGAAAACAAGCTTGTTCA TGCGT GGTGGCCTAGCTCCGTGGACAAGGTCTTCCCCTCCTCCACCCAAACCTCATCCAAAGAGG AGGC CAAGAAGATGAGGAAGTTGCTCCCTCGGTTCCTTAAGCCTGAAGCCTTGCAACGTTACAT CGGCA TCATGGATCACATTGCGCAGAGGCACTTTGCTGATAGCTGGGACAACAGAGATGAAGTCA TTGTG TTTCCACTGTCCAAGAGGTTCACTTTCTGGCTAGCTTGCCGCCTCTTTATGAGCATAGAA GATCCT GACCACATCGCTAAATTTGAAAAGCCCTTCCATGTCTTGGCCTCAGGACTCATCACCGTC CCGAT TGACTTGCCTGGGACACCTTTCCACCGCGCTATCAAGGCCTCCAACTTCATCAGAAAGGA GCTTA GAGCCATCATCAAGCAAAGGAAGATCGATCTGGCCGAGGGAAAAGCCTCACCAACTCAAG ATAT ATTGTCCGACCTGCTTCTGGCCACAGATGAAGATGGACGCCACATGAACGAAATTAATAT TGCTG ATAAAATCCTTGGCTTGTTGATTGGTGGCCATGATACGGCCAGTTCTGCCATTACATTCA TTGTTA AGTACATGGCTGAGCTGCCTCATATGTACGAGAAAGTCTACGAAGAGCAAATGGAAATTG CCAAT TCAAAAGCACCAGGTGAATTATTGAACTGGGATGATGTTCAAAAGATGAGATATTCATGG AATGTT GCTTGTGAAGTGATGAGACTTGCACCCCCACTCCAAGGAGCTTTCCGAGAAGCAATCACT GACTT CGTGTTCAATGGTTTCTCCATTCCTAAGGGTTGGAAGTTGTACTGGAGCACAAGCTCAAC CCACA AAAGCCCAAAATGCTTCCCTGAACCTGAAAAATTTGACCCTACAAGATTTGAAGGAGCTG GGCCT GCTCCTTACACATTCGTTCCCTTTGGTGGTGGACCTAGGATGTGCCCTGGTAAAGAGTAC GCCCG CTTGGAAATACTTGTCTTCATGCATAACGTGGTTAAAAGGTTCAAATGGGATAAATTGCT TCCTGA TGAGAAGATAATAATTGACCCCATGCGCATGCCTGCTAAGGGACTTCCAGTTCGCCTCCG TCTTC ACAAACCATAA

SEQ ID No 43. Ricinus communis cytochrome P450, putative, mRNA, XM_002527956

ATGTTTCCCTTTGCCGTCCTCCTCATCGCTCTTTCAATCTCATACCTCATCTTCAAACAC AAGTCCA ACGCCTCCAGCAGGAAGAATCTCCCACCTGGCAATACCGGTTGGCCTCTCATAGGCGAAA GCAT AGAGTTCCTAAGCACCGGGCGAAAGGGTCACCCGGAGAAGTTCATATTTGACCGAATGGA GAAG TTCTCGAGCAAGGTGTTCAAGACCTCATTGCTTCTGGAGCCGGCAGCAGTGTTTTGTGGG GCAG CAGGGAACAAGTTCTTGTTCTCCAATGAGAATAAACTAGTCACTGCATGGTGGCCTAACT CTGTTA ATAAAATCTTCCCATCCTCTCTCCAAACCTCTTCACAGGAGGAATCCAAGAGAATGAGAA AGCTTC TTCCTCAATTTCTGAAGCCAGAAGCTCTTCAAAGATATATAAGTATCATGGATGTTATTG CACAAA GACATTTCGCATTCGGATGGAACAACAAACAACAAGTGACAGTTTTCCCTCTAGCTAAGA TGTATA CTTTCTGGTTAGCCTGTCGGTTGTTTCTAAGCATGGAAGACCGGGAAGAAGTCGAAAAGT TTGCA AAGCCATTCGATGTATTGGCATCAGGTATTATATCGATACCTATTGATTTTCCAGGGACG CCATTT AACCGAGGGATCAAAGCATCAAATGAGGTAAGAAGGGAGCTGATAAAGATGATCGAACAG AGGA AGATTGATCTAGCCGAGAATAAGGCATCCCCAACACAGGATATATTGTCTCACATGCTAA CCACA GCAGACGAGTACATGAATGAAATGGATATAGCTGATAAGATTCTTGGTTTGCTTATTGGA GGCCA CGACACAGCCAGTGCTGCCATAACGTTTGTTGTCAAGTATCTTGCGGAGATGCCTCAAGT CTACA ATAAGGTGTTAGAGGAACAAATGGAGATTGCGAAAGCAAAAGCAGCTGGAGAGCTGTTGA ACTG GGAAGACATCCAAAAGATGAGATATTCATGGAACGTAGCATGTGAAGTGATGAGACTTGC TCCTC CGCTACAAGGAGCCTTTAGAGAGGCCATGACAGACTTCACCTATGCAGGTTTCACTATTC CTAAA GGATGGAAGTTGTACTGGGGTGCTAACTCTACACACAGAAACCCCGAGTGTTTCCCAGAA CCAG AAAAGTTCGACCCCTCAAGGTTTGAAGGCAAGGGACCTGCCCCTTACACATTCGTTCCTT TTGGA GGCGGACCCAGAATGTGCCCTGGAAAAGAATATGCTAGATTGGAGATCCTCGTTTTCATG CACAA CATTGTCAAAAAGTTCAGATGGGAGAAGCTGCTTCCTGAAGAGAAGATTATTGTTGATCC TCTCCC GATTCCCGCTAAAGGCCTTCCCCTTCGTCTTCATCCCCACACCTCCTAG

SEQ ID No 44. Medicago truncatula ebne JCVI-FLMt-11 H3 unknown mRNA, BT147421

ATGGAGCCTAATTTCTATCTCTCCCTTCTCCTTCTCTTTGTCACTTTCATATCTCTCTCT CTTTTTTT CATATTCTACAAACAGAAATCTCCATTAAATTTGCCACCTGGTAAAATGGGTTACCCAAT CATAGG TGAAAGCCTTGAGTTCTTATCAACAGGATGGAAAGGACATCCTGAAAAATTCATTTTCGA CCGTAT GCGTAAATATTCCTCAGAACTCTTTAAAACATCAATCGTAGGAGAATCTACGGTGGTTTG TTGCGG AGCAGCAAGTAACAAGTTTTTGTTTTCAAACGAGAATAAACTTGTGACTGCATGGTGGCC AGATAG TGTAAACAAAATCTTCCCTACTACTTCTCTTGACTCTAACTTGAAGGAAGAATCCATCAA GATGAG AAAATTGCTTCCACAATTCTTTAAACCCGAAGCTCTACAACGTTATGTTGGTGTCATGGA TGTTATT GCTCAAAGACATTTTGTTACTCATTGGGATAATAAAAATGAAACCACCGTCTACCCCTTG GCCAAG AGGTACACCTTTTTGTTAGCTTGTCGGTTGTTCATGAGCGTTGAAGACGAGAATCATGTA GCAAAA TTTAGTGATCCATTTCAGTTAATTGCGGCCGGAATCATATCTCTACCAATTGATTTGCCA GGAACA CCATTCAACAAAGCTATAAAGGCCTCAAACTTTATAAGAAAGGAGTTGATTAAGATCATA AAGCAA AGGAGGGTAGATTTGGCAGAAGGGACAGCATCACCAACACAAGATATATTGTCTCACATG TTGTT GACAAGTGATGAAAATGGAAAGAGTATGAATGAACTTAATATTGCTGATAAGATTCTTGG CCTTTT GATCGGAGGACATGACACTGCTAGCGTCGCATGCACTTTCCTTGTCAAATATCTCGGCGA GTTAC CTCACATTTATGATAAAGTCTATCAAGAGCAAATGGAAATTGCAAAATCGAAACCAGCAG GAGAAT TGTTGAATTGGGATGACCTGAAGAAAATGAAATACTCTTGGAACGTAGCTTGTGAAGTAA TGAGA CTTTCCCCTCCACTCCAAGGAGGTTTCAGGGAAGCCATCACTGACTTTATGTTCAATGGA TTCTCA ATTCCTAAGGGATGGAAGCTTTATTGGAGTGCAAATTCAACACATAAGAACGCAGAATGT TTTCCC ATGCCAGAGAAATTTGACCCAACAAGATTTGAAGGAAATGGACCAGCTCCTTATACTTTT GTTCCC TTTGGTGGAGGACCAAGGATGTGTCCTGGAAAAGAGTATGCAAGATTAGAAATACTTGTT TTCAT GCACAATTTGGCGAAAAGGTTTAAGTGGGAAAAGGTGATTCCAGATGAGAAGATTATTGT TGATC CATTCCCCATCCCTGCAAAGGATCTTCCAATTCGCCTTTATCCACACAAAGCTTAA

SEQ ID No 45. : Glycine max cytochrome P450 716B2-like (LOCI 00813159), mRNA, XM_003530477

ATGGAGGATAATAACTTGCATCTCTCCCTCCTTCTCCTCTTCGTTTCTATAGTGACC CTCTCCCTC TTCGTCCTCTTCTACAAGCACAGGTCTGCATTTGCGGCCCCGAACCTGCCACCGGGAGCC ACCG GTTACCCGGTGATCGGGGAGAGCCTGGAGTTCCTGTCCACAGGATGGAAGGGTCATCCGG AGA AGTTCATCTTCGACCGGATGATCAGGTACTCCTCCCAGCTGTTCAAGACCTCCATCCTGG GGGAA CCGGCGGTAATATTCTGTGGGGCCACCTGCAACAAGTTCTTATTTTCGAACGAGAACAAG CTTGT TGCAGCGTGGTGGCCCAACAGCGTCAACAAGGTGTTCCCCACCACGCTTCTTAGCAACTC CAAA CAAGAGTCCAAAAAGATGAGGAAGTTGCTCCCTCAGTTCCTTAAGCCCGAGGCTCTCCAA CGCTA CGTTGGAATCATGGACACCATTGCTCGAAACCACTTCGCTTCCCTTTGGGACAACAAGAC GGAAC TCACCGTCTATCCCTTGGCCAAGAGGTACACGTTCTTGTTGGCTTGTCGTTTGTTTATGA GCATTG AGGACGTGAATCACGTAGCAAAATTTGAGAACCCTTTTCACCTGTTGGCGTCTGGAATCA TATCA GTGCCTATTGATCTTCCCGGAACGCCGTTCAACAAAGCAATTAAAGCAGCAAACGCAATC AGGAA GGAGCTGTTGAAGATCATTAGACAGAGGAAGGTGGATTTAGCTGAAGGGAAAGCATCGCC AACA CAAGACATTTTGTCTCATATGTTGTTAACATGCGATGAGAAGGGACAGTTCATGAATGAA TTGGAT ATTGCCGACAAGATTCTTGGCCTTTTGATTGGAGGCCATGACACTGCTAGTGCTGCAATC ACTTT CATTGTCAAATATCTTGCTGAACTCCCTCACATTTATGATAGAGTCTATCAAGAGCAAAT GGAAATT GCAAAACTGAAATCGCCAGGAGAGTTATTGAATTGGGATGATGTCAACAGGATGCAGTAT TCTTG GAATGTAGCTTGTGAAGTAATGAGAATCGCTCCTCCACTTCAAGGAGGTTTTAGGGAAGC TATCA ATGACTTTATTTTCGATGGCTTTTCAATACCAAAGGGATGGAAGTTGTATTGGAGTGCAA ATTCAA CACATAAAAGTCCAGAATATTTTCCAGAGCCAGAGAAATTCGATCCAACTAGATTCGAAG GACAA GGGCCAGCTCCTTATACTTTTGTACCATTTGGTGGAGGACCAAGGATGTGCCCCGGAAAA GAGTA TGCTCGATTGGAAATATTGGTTTTCATGCACAACCTAGTGAAGAGGTTTAAGTGGCAAAA ATTGAT TCCAGATGAGAAAATTATCGTTGATCCCTTGCCCATACCTGCAAAGAACCTTCCAATTCG TCTTCA TCCTCACAAACCCTGA

SEQ ID No 46. Soybean ebne JCVI-FLGm-20N8 unknown mRNA, BT096613

ATGGAGGATAATAACTTGCATCTCTCCCTCCTTCTCCTCTTCGTTTCTATAGTGACCCTC TCCCTC TTCGTCCTCTTCTACAAGCACAGGTCTGCATTTGCGGCCCCGAACCTGCCACCGGGAGCC ACCG GTTACCCGGTGATCGGGGAGAGCCTGGAGTTCCTGTCCACAGGATGGAAGGGTCATCCGG AGA AGTTCATCTTCGACCGGATGATCAGGTACTCCTCCCAGCTGTTCAAGACCTCCATCCTGG GGGAA CCGGCGGTAATATTCTGTGGGGCCACCTGCAACAAGTTCTTATTTTCGAACGAGAACAAG CTTGT TGCAGCGTGGTGGCCCAACAGCGTCAACAAGGTGTTCCCCACCACGCTTCTTAGCAACTC CAAA CAAGAGTCCAAAAAGATGAGGAAGTTGCTCCCTCAGTTCCTTAAGCCCGAGGCTCTCCAA CGCTA CGTTGG AATC ATGG AC ACC ATTGCTCG AAACC ACTTCGCTTCCCTTTGGG AC AAC AAG ACGG AAC TCACCGTCTATCCCTTGGCCAAGAGGTACACGTTCTTGTTGGCTTGTCGTTTGTTTATGA GCATTG AGGACGTGAATCACGTAGCAAAATTTGAGAACCCTTTTCACCTGTTGGCGTCTGGAATCA TATCA GTGCCTATTGATCTTCCCGGAACGCCGTTCAACAAAGCAATTAAAGCAGCGAACGCAATC AGGAA GGAGCTGTTGAAGATCATTAGACAGAGGAAGGTGGATTTAGCTGAAGGGAAAGCATCGCC AACA CAAGACATTTTGTCTCATATGTTGTTAACATGCGATGAGAAGGGACAGTTCATGAATGAA TTGGAT ATTGCCGACAAGATTCTTGGCCTTTTGATTGGAGGCCATGACACTGCTAGTGCTGCAATC ACTTT CATTGTCAAATATCTTGCTGAACTCCCTCACATTTATGATAGAGTCTATCAAGAGCAAAT GGAAATT GCAAAACTGAAATCGCCAGGAGAGTTATTGAATTGGGATGATGTCAACAGGATGCAGTAT TCTTG GAATGTAGCTTGTGAAGTAATGAGAATCGCTCCTCCACTTCAAGGAGGTTTTAGGGAAGC TATCA ATGACTTTATTTTCGATGGCTTTTCAATACCAAAGGGATGGAAGTTGTATTGGAGTGCAA ATTCAA CACATAAAAGTCCAGAATATTTTCCAGAGCCAGAGAAATTCGATCCAACTAGATTCGAAG GACAA GGGCCAGCTCCTTACACTTTTGTACCATTTGGTGGAGGACCAAGGATGTGCCCCGGAAAA GAGT ATGCTCGATTGGAAATATTGGTTTTCATGTACAAC

SEQ ID No 47. : Vitis vinifera cytochrome P450 716B2-like (LOCI 00242305), mRNA, XM_002280933 ATGGAGCTCTCTTTACTCCACATACTTCCATGGGCCACCCTCTTCACCACTCTTTCTCTT TCATTC CTCATCTACAAGCTCATGATCATCTCCCATGGCACACCCAGAAACCTTCCGTCCGGCAAT ACCGG TCTGCCCTATATCGGAGAAAGCATCCAGTTCCTCTCCAATGGCAGAAAGGGTCATCCCGA GAAGT TCATTTCTGAGAGAATGTTGAAGTTCTCATCCAAAGTTTTCAAGACCTCACTCTTCGGAG AAACTG CTGCAGTCTTCTGTGGCTCGGCCGGGAACAAGTTCTTGTTCTCCAACGAGAACAAGCTTG TGACC GCATGGTGGCCGAGCTCCGTAAACAAAATCTTCCCTTCCTCTCTGCAAACCTCCTCGCAG GAAGA ATCAAAGAAAATGAGAAAGCTGCTTCCGGGCTTTCTCAAACCCGAAGCCCTCCAAAGATA TATCA GTATCATGGACGTGATAGCTCAGAGGCACTTTGAGTCCAGCTGGAACAACAAGGAAGAAG TCAC AGTCTTCCCGCTAGCCAAGATGTTCACATTCTGGCTGGCTTGTCGTCTGTTTTTGAGCGT AGAAG ACCCCGACCATGTCGAAAAGCTTGCAGAGCCCTTCAACGAACTGGCCGCCGGAATCATAG CCCT ACCTATTGATTTGCCTGGGACGTCATTTAACAAGGGGATCAAAGCTTCAAACCTGGTCAG AAAGG AGCTTCATGCAATAATCAAGAAGAGGAAGATGAATCTTGCGGACAACAAGGCGTCGACGA CGCA GGACATATTGTCACATATGCTTCTCACTTGTGATGAGAATGGAGAGTACATGAATGAAGA GGATAT AGCTGATAAAATTCTTGGGTTGCTCGTCGGAGGTCATGACACAGCCAGTGCTACCATTAC TTTTAT TGTCAAGTTTCTTGCAGAGCTGCCTCATGTTTACGATGAAGTTTTCAAGGAACAAATGGA GATAGC AAAATCAAAGGCCCCAGGTGAGCTGTTGAATTGGGAGGACATTCCAAAGATGAGGTATTC ATGGA ATGTAGCATGTGAAGTGATGAGACTGGCACCACCCGTTCAAGGAGCTTTCCGAGAAGCCA TGAAT GACTTCATCTTCGAGGGTTTCTCCATTCCAAAGGGATGGAAGCTGTACTGGAGCACGCAC TCGAC CCACCGGAACCCGGAGTTCTTCCCCAAGCCGGAAAAATTCGACCCCTCGAGGTTTGACGG AAAG GGACCAGCCCCTTACACCTATGTGCCTTTCGGAGGAGGACCCAGGATGTGCCCTGGCAAA GAGT ATGCTAGATTGGAAGTACTAGTGTTCATGCACAATTTAGTGAGAAGGTTCAAATGGGAGA AGCTG CTGCCAGATGAGAAGATTATAGTAGACCCCATGCCCATTCCTGCAAAAGGCCTTCCCATT CGCCT CCATCATCACCAACCCTAG

SEQ ID No 48. Populus trichocarpa hypothetical protein (POPTR_0006s08560g) mRNA, complete eds, XM_002309021

ATGGAACTTCCCTTCATCTCCCTGCTTCCCTATGGAATCCTCTTCATCATCTCTGCA GTTTCACTAT CATACCTCATAAACAAACACAAATATTATCTCTCCTCCCTCAACAACCTCCCGCCTGGTA ATACCG GTTTGCCATTAATCGGTGAAAGTCTGGAGTTCCTGACCACGGGGCAAAAGGGTCAGCCGG AGAA GTTCATATTAGACAGAATGGCAAAGTTCTCATCCAAAGTCTTCAAAACCTCGTTGTTTTG TGAACC AACTGCAGTATTCTGTGGTGCAGCAGGGAACAAGTTCTTGTTCTCTAATGAGAATAAGCT TGTCAC TGCATGGTGGCCTGATTCTGTCAACAAAATCTTCCCTTCCTCTCAACAAACTTCTTCACA AGAAGA ATCCAAGAAAATGAGAAAGCTTTTCCCACTTTTTTTCAAGCCAGAATCACTTCAAAGATA TATTAGT GTGATGGATGTGATTGCACAAAGGCACTTGGCTTCTGATTGGGAAGGCAAACAGGAAGTC AGTG TTTTCCCTCTGGCTAAGACGTACACTTTTTGGTTAGCTTGCCGCTTATTTCTAAGCATGG AAGATC CTGAGGAAGTCCAAAAGTTCGCCAAACCCTTCAATGATTTAGCCGCTGGGATTATATCCA TACCC ATTGATTTGCCCTGGACACCCTTTAATCGCGGGGTCAAAGCATCAAATGTGGTGCACAAG GAGCT TCTAAAGATCATAAAGCAGAGGAAGATTGATCTAGCGGAGAACAAGGCATCCCCCACACA AGATA TACTGTCCCATATGCTAACCACAGCAGACGATAATGGGCAATGCATGAAAAAGATCGATA TTGCC GATAAGATACTTGGTTTGCTTGTTGGAGGTCACGACACAGCCAGTGCTGCTATAACTTTT ATTGTC AAGTATCTTGCAGAGTTGCCTCATGTCTACAACAAGCTCTTGGAAGAACAAAGAGAGATC GCAAA AACGAAAACACCTGGAGAGCTGTTGAATTGGGAGGACATACAAAGGATGAGATATTCATG GAACG TTGCCTGTGAAGTGATGAGAGTTGCTCCCCCACTCCAAGGAGCTTTCCGAGAGGCCATGA CCGA GTTCAACTACGCAGGTTTTACAATTCCGAAGGGATGGAAGCTGTATTGGAGCGCAAACAC TACAC ACAAAAATCCTGAATGTTTCCCTGAGCCAGAGAATTTTGACCCATCAAGATTCGAAGGCA ATGGA CCGGCCCCATACACCTTTGTTCCATTTGGAGGAGGTCCTAGGATGTGTCCAGGCAAAGAA TATGC TAGACTGGAAATACTTGTTTTCTTGCACAACTTGGTTAAAAAGTTCAGATGGGAGAAGCT GCTTCC TAAAGAGAGGATAATTGTAGATCCAATGCCAATACCTTCAAAAGGCCTTCCGATCCGCCT CCACC CTCACGAGGCTGCCTAA

SEQ ID No 49. Medicago truncatula ebne MTYF5_F6_F7_F81 G-O-7 unknown im RNA, BT051785

ATGGAGCCTAATTTCTATCTCTCCCTTCTCCTTCTCTTTGTCACTTTCATATCTCTC TCTCTTTTTTT CATATTCTACAAACAGAAATCTCCATTAAATTTGCCACCTGGTAAAATGGGTTACCCAAT CATAGG TGAAAGCCTTGAGTTCTTATCAACAGGATGGAAAGGACATCCTGAAAAATTCATTTTCGA CCGTAT GCGTAAATATTCCTCAGAACTCTTTAAAACATCAATCGTAGGAGAATCTACGGTGGTTTG TTGCGG AGCAGCAAGTAACAAGTTTTTGTTTTCAAACGAGAATAAACTTGTGACTGCATGGTGGCC AGATAG TGTAAACAAAATCTTCCCTACTACTTCTCTTGACTCTAACTTGAAGGAAGAATCCATCAA GATGAG AAAATTGCTTCCACAATTCTTTAAACCCGAAGCTCTACAACGTTATGTTGGTGTCATGGA TGTTATT GCTCAAAGACATTTTGTTACTCATTGGGATAATAAAAATGAAACCACCGTCTACCCCTTG GCCAAG AGGTACACCTTTTTGTTAGCTTGTCGGTTGTTCATGAGCGTTGAAGACGAGAATCATGTA GCAAAA TTTAGTGATCCATTTCAGTTAATTGCGGCCGGAATCATATCTCTACCAATTGATTTGCCA GGAACA CCATTCAACAAAGCTATAAAGGCCTCAAACTTTATAAGAAAGGAGTTGATTAAGATCATA AAGCAA AGGAGGGTAGATTTGGCAGAAGGGACAGCATCACCAACACAAGATATATTGTCTCACATG TTGTT GACAAGTGATGAAAATGGAAAGAGTATGAATGAACTTAATATTGCTGATAAGATTCTTGG CCTTTT GACCG G AGG AC ATG AC ACTGCTAG CGTCGC ATGC ACTTTCCTTGTC AAATATCTCG GCG AGTTAC CTCACATTTATGATAAAGTCTATCAAGAGCAAATGGAAATTGCAAAATCGAAACCAGCAG GAGAAT TGTTGAATTGGGATGACCTGAAGAAAATGAAATACTCTTGGAACGTAGCTTGTGAAGTAA TGAGA CTTTCCCCTCCACTCCAAGGAGGTTTCAGGGAAGCCATCACTGACTTTATGTTCAATGGA TTCTCA ATTCCTAAGGGATGGAAGCTTTATTGGAGTGCAAATTCAACACATAAGAACGCAGAATGT TTTCCC ATGCCAGAGAAATTTGACCCAACAAGATTTGAAGGAAATGGACCAGCTCCTTATACTTTT GTTCCC TTTGGTGGAGGACCAAGGATGTGTCCTGGAAAAGAGTATGCAAGATTAGAAATACTTGTT TTCAT GCACAATTTGGCGAAAAGGTTTAAGTGGGAAAAGGTGATTCCAGATGAGAAGATTATTGT TGATC CATTCCCCATCCCTGCAAAGGATCTTCCAATTCGCCTTTATCCACACAAAGCTTAA SEQ ID No 50. Ricinus communis cytochrome P450, putative, mRNA, XM_002513137

ATGGAGTTGTTCTTTCTCATAGCCTTAACCCTTTTCATTATTCTTGTCACTCTTCCAATT CTGGCTG TCTTATACAGACCAAATATTATCAATCTACCACCAGGCAAGACGGGCTTGCCATACATAG GAGAG AGCCTGGAATTTCTTTCCACAGGCAGAAAAGGTCATCCTGAGAAGTTTTTATCAGATAGA ATGGAA AAATTCTCACGTCAAGTTTTCAGGACTTCAATTCTTGGTGAACAAACTGCAGTCGTCTGT GGCGCA CAAGGCAACAAGTTCTTGTTCTCTAATGAGAACAAGCTTGTCACTGCTTGGTGGCCAAAA TCAATC CTGAGACTCTTCCCTTCCTCTAATCAAAGCACTATCCTAGCTGAAGGCATGAGGATGAGG AAGAT GCTACCTCACTTTCTCAAACCTGAGGCCCTGCAAAGATACATAGGTGTAATGGACCATAT GGCAC AAGTTCACTTTCAGGATAGCTGGGAAAACAAGCAAGAAGTCACAGTTTATCCGCTTGCAA AGATG TATACATTTTCAGTTGCTTGCAAAGTGTTCTTGAGCATGGATGACCCAAAGGAGGTCGCA AAGTTC GCTGCTCCTTTCAATGATATGGCCTCAGGAATTATTTCTATTCCTATCAATTTTCCTGGA ACATCTT TCAATCGTGGACTCAAGGCCTCGAAGATTATAAGGAACGAAATGTTGCGTATGATTAAGC AAAGA AGAAAAGATCTTGCTGAGAATAAAGCAACTCCTATGCAAGATATACTGTCCCATATGCTG GTAGCA ACTGATGAAGAAGGTCAGAGATTGGGAGAAGTTGGGATTGCTGATAAGATCATCTCTTTG CTCAT TGGTGGCCACGACACAGCAAGTGCTACAATCACTTTCGTTGTCAAGTTTCTTGCCGAGCT CCCAG ATATCTACGATCAAGTCTTGAAAGAGCAATTGGAGATTGCTAAATCAAAAGAACCAGGAG AATTAT TGACCTGGGAAGACATTCAGAAGATGAAGTACTCGTGGAATGTTGCTTGTGAAGTAATGA GATTA GCCCCACCTCTTCAGGGTTCTTTCAGAGAAGCCTTACATGACTTCGACTATGCTGGTTTC TCTATT CCAAAGGGTTGGAAATTATATTGGAGCACACATACAACACACAAAAATCCAGAATATTTT TCGGAT CCTGAAAAGTTTGATCCTTCAAGATTTGAAGGATCAGGGCCAGCACCTTACACATTTGTT CCATTT GGAGGAGGGCCAAGGATGTGTCCTGGAAAAGAGTATGCAAGATTGGAAATTCTTGTTTTC ATGCA CAATATAGCGAAGAGGTTCAAGTGGAACAAGGTTATTCCTGACGAGAAAATTGTTGTTGA CCCCA TGCCAATACCAGCTAAAGGCCTTCCAGTTCACCTCTATCCTCAAAAACATGAGTAA SEQ ID No 51 . : Vitis vinifera cytochrome P450 716B2-like (LOCI 00265713), mRNA, XM_002264607

ATGATCATGCAGCAAAGCGACATGGAGCTCTTGCTCCTCTCCTTTCTCCTCCTCATG GCTCTCTCT CTCTCTTTTTGGATTCGCTTCTTTGTCCATAAACTCGAAAAAAGCAGTGGTATTAACCTG CCTCCA GGG AAAATGG GTTTTCC ATTC ATTGGTG AAAGTCTAG AATTCCTTCG GATG GGC AGG AAGG G AAC CCCTGAAAGGTTCATTCAAGATAGGATGGCCAAATACTCAACCCAGATCTTCAAAACTTG CTTACT CGGAGAACCAACTGCAGTTGTGTGTGGGGCTGCTGGAAACAAGTTGTTGTTCTCCAACGA GAAC AAGCTTGTTACTTCATGGTGGCCGCGCTCTGTGGAGAAGATATTTCCCTCTTCTCTTCAG ACTTCG ACCAAAGAAGAGTCCATGAAAACTCGTAAGTTGCTTCCAGCCTTTCTCAAACCCGAGGCG TTGCA AAAGTATGTGGGGATCATGGATTCCATAGCGAAGTGGCATTTGGATAACCACTGGGACTT GAATG AAACCGTTACTGTTTTCCCTCTTGCCAAGCAATACACCTTCATGGTGGCTTGTAGATTGT TCTTGA GCATAG ATG ACCCTAAGCACATTGCAAAATTCGCTAACCCATTTCATATTTTGGCTGCTGGGGTCA TGTCAATACCTATAAACTTCCCTGGGACCCCATTCAACCGTGCTATCAAGGCTGCGGATT CCGTA AGAAAGGAGCTCAGAGCAATAATCAAGCAAAGGAAAATTCAAGTTTTAGCGGGGAAAAGT TCATC CTCTAAGCATGATATACTGTCCCATATGCTCACCACAACAGATGAGAATGGACAGTTCTT GAATGA GATGGACATTGCGGATAAGATACTTGGTTTGCTAATTGGTGGCCATGACACTGCAAGTGC TGTCA TAACTTTCATCATCAAGTATCTTGCAGAGTTGCCACAAGTCTACAATGAGGTTTTAAAGG AGCAAA TGGAGGTTGCAGCCGGGAAGAAAAGTGGAGAGATGCTTGATTGGGAGGACATACAAAAGA TGAA GTATTCATGGAATGTGGCAAATGAAGTAATGAGGCTGGCACCACCACTTCAAGGTAGTTT CCGAG AGGCCATAACTGACTTCACCTATGCTGGTTTCTCCATTCCCAAAGGGTGGAAGTTGTACT GGAGC ACAAATGCAACACACAAGAACCCTGACTACTTCCCTGATCCGGAGAAATTTGATCCTTCA AGGTTT GAAGGAAATGGACCCATTCCTTACACCTATGTTCCTTTCGGAGGAGGACCACGAATGTGC CCTGG GAAAGAGTATGCTCGTTTGGAAATACTTGTTTTCATACACAATGTTGTGAGACGGTTCAG TTGGTA TAAACTGCATCCAAATGAAGATGTCATAGTGGATCCAATGCCAATGCCTGCAAAAGGACT TCCCA TTCGCCTTCGTCACCATTAA

SEQ ID No 52. Populus trichocarpa hypothetical protein (POPTR_0018s 13390g) mRNA, complete cds, XM_002324633

ATGGAGACTCTCTATTTCATCCTTCTCCTCTTTGTCCCCATCATTCTCTCCCTCGTTGCC ATAATTT ACAAGCACAGATACCAGGATAAACTCCAAAACGTTCCTCCAGGCAATCTAGGCCTCCCTT TTGTG GGAGAGAGCCTAGATTTCCTGTCAAAAGGATGGAAAGGTTGCCCAGAAAACTTCATATTC GATCG CATTCGGAAATATTCGTCAGAAATATTCAAAACAAATCTTTTTCTTCAGCCTGTAGTGAT GTTAAAT GGTGTTGCCGGAAACAAGTTCTTATTCTCCAACGAGAACAGACTTGTTGAAACATGGTGG CCTGA TTTTGTGAACAGGATATTTCCATCTGCAGTAGAAACGTCACCCAAAGAAGAAGCGAAAAG AATGC GTAGGTTGTTCCCTCGATTCTTGAAACCTGAGGCCTTGCAGAGGTATATAGGTACCATGG ATATG GTTACCAAAAGACACTTTGCCTTGGAGTGGGGAAACAAAGCAGAGGTGGTTGTCTTCCCT CTGGC AAAAAGCTACACATTCGAGTTGGCTTGCCGCTTGTTTCTAAGTATTGAAGATCCCAGCCA CATAGC CAGATTTTCCCACCCATTCAACCAAATAACCTCTGGTATTTTTACCATCCCCATTGATTT TCCTGGA ACTCCATTTAATCGAGCCATCAAGGCCTCAAAGTTAATCAGAATTGAGCTTTTGGCCATT ATCAGG CAAAGAAAGAAGGATCTTGCAGAAGGAAAGGCATCCCCAACCCAGGACATTTTGTCACAC ATGCT GTTGAGCAATGATGCGGATGGAAAGTACATGAATGAGGTGCAGATTTCTGACAAGATTCT TGCAT TATTGATGGGTGGACATGAAAGCACTGCTGCTTCTTGTACTTTCATTGTCAAATATCTTG CTGAGC TGCCTCATATCTATGAAGCAGTTTACAAGGAACAAGCTGAGATCATTAAATCCAAAGCAC CCGGT GAGTTGTTGAATTGGGATGACATTCAAAAGATGAAATATTCATGGAATGTAGCTTGTGAA ACGTTG AGACTCTCACCACCGCTTATTGGTAACTTCAAAGAAGCCATCAAGGACTTCACATTCAAC GGGTT CTCCATCCCAAAGGGCTGGAAGGCAAGTCATTTTCTCACTTTGTATTGGAGTGCAAGCTC GACCC ATAAAAATCCTGAATACTTTTCTGAGCCTGAAAAGTTCGATCCCAGTAGATTTGAAGGGA AAGGAC CAGCTCCTTACACGTTTATTCCATTTGGTGGAGGACCAAGGATGTGCCCTGGAAATGAAT ATGCT CGATTAGAAATTCTTGTTTTCATGCATAACTTGGTGAAGAGGTTCAAATTTGAAAGATTG ATTCTCG ATGAGAAGATAGTATTCGATCCAACGCCAAAACCAGAAATGGGACTTCCAGTTCGTCTGC TTCCT CACAAAGCTTGA

SEQ ID No 53. : Glycine max cytochrome P450 716B2-like (LOCI 00815640), transcript variant X1 , mRNA; XM_003531801

ATGGAGCAGTTGTACTACCTCACCCTTGTGCTACTGTTTGTGTCCTTCGTCTCTGTCTCT TTTTTC ATCATTTTCTACAGGCATCGTTCTCCGTTCAGCGTCCCCAACTTGCCGCCGGGGAAGGCG GGGT TTCCGGTGATCGGCGAGAGCCTGGAGTTTCTGTCGGCGGGACGGAAGGGGCTTCCGGAGA AGT TCTTCTCCGATCGCATGACAGAGTACTCTTCCAAAGTGTTCAAGACCTCCATCTTAGGGG AGCCT ACAGTGATTTTCTGTGGAGCCGCATGTAACAAGTTCTTGTTTTCTAACGAGAACAAACAC GTCATT TCGTGGTGGCCTGAAAATGTCAAGAAGTTGTTCCCAACGAATATTCAAACAAACTCTAAG GAAGA AGCCAAGAAGTTGAGAAACATTCTCCCTCAGTTCCTCAGCGCCAAAGCCATCCAACGTTA CGTTG GTATTATGGACACTGTTGCCCAAAGACACTTTGCTCTGGAGTGGGAGAACAACACCCAAG TCACC GTATTGCCCTTGGCCAAGAGGTATACCTTTGGGGTGGCTAGCCGTGTGTTCATGAGCATT GATGA TTTGAATCAAGTGGCGAAATTGGCAGAACCTTTAAATCAGGTGAATGCAGGAATTATATC AATGCC CATTAACTTCCCCGGAACTGTGTTCAACCGAGGAATCAAGGCCTCCAAGTTCATTAGGAG GGAGC TGTTGAGGATTGTCAAGCAGAGGAAGGTGGAACTAGCTAATGGAATGTCCACACCAACAC AAGAC ATTTTGTCTCACATGCTAATATATTGTGATGAGAATGGACAATATTTGGCTGAACATGAT ATTGTCA ACAAGATCCTTGGCTTGCTGATAGGTAGCCATGAAACCACAAGTACTGTTTGCACTTTCG TTGTCA AATACCTTGCCGAGCTCCCTCAAAATATTTATGAAAATGTCTATCAAGAACAAATGGCGA TTGCAA AATCCAAAGCTCCAGGAGAGTTGTTGAATTGGGATGACATCCAGAAGATGAAATATTCAT GGAAT GTAGCTTGTGAAGTAATAAGGCTTAACCCTCCAGCCCAAGGAGCTTTTAGGGAAGCCATC AATGA CTTTATCTTCGATGGATTCTCAATTCCAAAAGGCTGGAAGTTGTATTGGAGTGCAAATTC AACTCA CAAAAATCCAGAGTACTTCCCTGAGCCAGAGAAATTTGATCCAAGCAGATTTGAAGGAAC TGGAC CAGCTCCTTATACTTATGTGCCATTTGGTGGAGGGCCAAGTATGTGCCCTGGAAAAGAGT ATGCG CGAATGGAACTATTGGTGTTCATGCACAACTTAGTGAAGAGGTTCAAGTGTGAAACTCTT TTTCCT AATGGAAATGTTACTTATAACCCTACGCCTATTCCTGCCAAGGGCCTTCCTGTTCGTCTT ATTCCT CACCGATCATGA

Es ist außerdem bevorzugt, dass Abwandlungen der oben genannten Sequenzen, sogenannte Sequenzvarianten, ausgewählt werden, wobei diese abgewandelten Sequenzen eine

ausreichende Sequenzidentität zu den oben genannten Sequenzen aufweisen, um zu einer solchen funktionsanalog zu sein. Dabei ist eine Sequenzidentität von mindestens 70%, bevorzugt 75%, 80% oder 85%, besonders bevorzugt 90% oder 95% vorteilhaft. Die Sequenzidentität zwischen zwei Sequenzen kann durch üblichen Methoden analysiert werden, z. B. mit NCBI Blast oder Clustal.

In einer bevorzugten Ausführungsform kodieren die funktionsanalogen Sequenzvarianten für die gleichen Aminosäuresequenzen, die durch die explizit genannten Sequenzen SEQ ID No 1 bis 53 kodiert sind.

Die Erfindung umfasst daher die Anwendung von Nukleinsäuresequenzen, sowie Hefestämme umfassend solche Sequenzen, die für einem oder mehreren der oben genannten Enzyme (bevorzugt gemäß einer der Sequenzen SEQ ID No 54 bis 105) kodieren. Die

Nukleinsäuresequenzen sind bevorzugt ausgewählt aus der Gruppe umfassend:

a) ein Nukleinsäuremolekül umfassend eine Nukleotidsequenz gemäß SEQ ID No. 1 bis SEQ ID No. 53;

b) ein Nukleinsäuremolekül, welches zu einer Nukleotidsequenz gemäß a) komplementär ist,

c) Ein Nukleinsäuremolekül, welches mit einer Nukleotidsequenz gemäß a) oder b) unter stringenten Bedingungen hybridisiert (Hybridisierungsbedingungen sind einem Fachmann bekannt, und sind z. B. in Sambrook, Molecular Cloning, Ed. 1-3, Cold Spring Harbor, N.Y., beschrieben);

d) ein Nukleinsäuremolekül umfassend eine Nukleotidsequenz, die eine ausreichende

Sequenzidentität aufweist, um zu einer Nukleotidsequenz gemäß a), b) oder c) funktionsanalog zu sein,

ein Nuklei nsäüremolekül, das infolge des genetisches Codes zu einer Nükleotidsequenz gemäß a) bis c) degeneriert ist; und

ein Nuklei nsäüremolekül gemäß einer Nükleotidsequenz nach a) bis e), welches durch Deletionen, Additionen, Substitutionen, Translokationen, Inversionen und/oder

Insertionen modifiziert und funktionsanalog zu einer Nükleotidsequenz gemäß a) bis e) ist.

In einer bevorzugten Ausführungsform der Erfindung ist die Anwendung einer

Nukleinsäuresequenz vorgesehen, die eine ausreichende Sequenzidentität aufweist, um mit der Nukleinsäuresequenz gemäß Punkt a), b) und/oder c) funktionsanalog zu sein. Im Sinne der

Erfindung heißt, um zu den genannten Nukleotidseq Uenzen bzw. mit diesen Nukleotidsequenzen hybridisierenden Sequenzen funktionsanalog zu sein, dass die Sequenzvariante effektiv die gewünschte Produktion von den pentazyklischen Triterpenoiden in den gleichen oder ähnlichen Mengen hervorrufen kann. Funktionsanaloge Sequenzen im Sinne der Erfindung sind alle Sequenzen, die der Fachmann durch Routineversuche als gleichwirkend identifizieren kann.

Insbesondere umfasst die vorliegende Erfindung Nukleinsäuresequenzen und deren Anwendung, sowie Hefestämme umfassend solche Sequenzen, die für folgende Aminosäuresequenzen (gemäß der Sequenzen SEQ ID No 54 bis 105) kodieren:

Oxidosqualenzyklasen (OSCs):

>gi| 18147594|dbj|BAB83087.1 | lupeol synthase [Betula platyphylla] SEQ ID No 54:

MWKLKIAEGGPGLVSGNDFIGRQHWEFDPDAGTPQERAEVEKVREEFTKNRFQMKQSADL LMRMQ LRKENPCQPIPPPVKVKETEVITEEAVITTLRRSLSFYSSIQAHDGHWPGESAGPLFFLQ PFVMALYITG DLNTIFSPAHQKEIIRYLYNHQNEDGGWGFHIEGHSTMFGSALSYIALRILGEGLEDGED GAMAKSRK WILDHGGLVAIPSWGKFWVTVLGLYEWSGCNPLPPEFWFLPDIFPIHPGKMLCYCRLVYM PMSYLYG KRFVGPITGLIQSLRQELYNEPYHQINWNKARSTVAKEDLYYPHPLIQDLLWGFLHHVAE PVLTRWPF SMLREKALKAAIGHVHYEDENSKYLCIGSVEKVLCLIACWAEDPNGEAYKLHLGRIPDNY WVAEDGLKI QSFGCQMWDAGFAIQAILSCNLNEEYWPTLRKAHEFVKASQVPENPSGDFKAMYRHINKG AWTFSM QDHGWQVSDCTAEGLKVAILFSQMPPDLVGEKIEKERLYDAVNVILSLQSSNGGFPAWEP QRAYGWL EKFNPTEFFEDTLIEREYVECTSPAVHGLALFRKFYPRHRGTEIDSSIYRGIQYIEDVQE PDGSWYGHW GICYTYGTWFAVGALAACGRNYKNCPALRKSCEFLLSKQLPNGGWGESYLSSQNK WTNIEGNRAN LVQTAWALLSLIDARQAEIDPTPIHRGVRVLINSQMEDGDFPQQEITGVFMRNCTLNYSS YRNIFPIWA LGEYRRRVLFA

>gi|6456434|dbj|BAA86930.1 | lupeol synthase [Olea europaea] SEQ ID No 55:

MWKLKIADGTGPWLTTTNNHIGRQHWEFDPEAGTPDERVEVERLREEFKKNRFRTKQSAD LLMRMQ LVKENQRVQIPPAIKIKETEGITEEAVITTLRRAISFYSTIQAHDGHWPAESAGPLFFLP PLVLALYVTGAI NVVLSREHQKEITRYIYNHQNEDGGWGIHIEGHSTMFGSVLSYITLRLLGEGQEDGEDKA VARGRKWI LDHGGAVGIPSWGKFWLTVLGVYEWDGCNPMPPEFWLLPNFSPIHPGKMLCYCRLVYMPM SYLYGK RFVGPITGLVLSLRQEIYTEPYHGINWNRARNTCAKEDLYYPHPLAQDMLWGFLHHFAEP VLTRWPFS KLREKALKVAMEHVHYEDMNSRYLCIGCVEKVLCLIACWVEDPNSEAYKRHIARIPDYFW VAEDGLKM QSFGCQMWDAAFAIQAILSSNLAEEYGPTLMKAHNFVKASQVQENPSGDFNEMYRHTSKG AWTFSM QDHGWQVSDCTAEGLKAALLFSQMPIELVGAEIETGHLYDAVNVILTLQSASGGFPAWEP QKAYRWL EKLNPTEFFEDVLIERDYVECTSSAVQALKLFKQLHPGHRRKEIASCISKAIQYIEATQN PDGSWDGSW GICFTYGTWFAVEGLVACGKNYHNSPTLRRACEFLLSKQLPDGGWSESYLSSSNKVYTNL EGNRSNL VQTSWALLSLIKAGQVEIDPGPIHRGIKLLVNSQMEDGDFPQEEITGAFMKNCTLNYSSY RNIFPIWAL GEYRRRILHAQT

>gi|360038892|dbj|BAL41371.1 | lupeol synthase [Glycyrrhiza uralensis] SEQ ID No 56:

MWKLKIGEGGAGLISVNNFIGRQHWEFDPNAGTPQEHAEIERLRREFTKNRFSIKQSADL LMRMQLR

KENHYGTNNNIPAAVKLSDAENITVEALVTTIRRAISFYSSIQAHDGHWPAESAGPL FFLQPLVMALYIT GSLDDVLGPEHKKEIVRYLYNHQNEDGGWGFHIEGHSTMFGSALSYVALRILGEGPEDKA MAKGRK WILDHGGLVAIPSWGKFWVTVLGAYEWSGCNPLPPELWLLPKFTPFHPGKMLCYCRLVYM PMSYLY GKKFVGPITALIRSLREELYNEPYNQINWNTARNTVAKEDLYYPHPLIQDMLWGFLYHVG ERFLNCWP FSMLRRKALEIAINHVHYEDENSRYLCIGSVEKVLCLIARWVEDPNSEAYKLHLARIPDY FWLAEDGLKI QSFGCQMWDAAFAIQAILACNVSEEYGPTLRKAHHFVKASQVRENPSGDFNAMYRHISKG AWTFSM HDHGWQVSDCTAEGLKAALLLSEMPSELVGGKMETERFYDAVNVILSLQSSNGGFPAWEP QKAYRW LEKFNPTEFFEDTMIEREYVECTGSAMQGLALFRKQYPQHRSKEIDRCIAKAIRYIENMQ NPDGSWYG CWGICYTYGTWFAVEGLTACGKNCHNSLSLRKACQFLLSKQLPNAGWGESYLSSQNKVYT NLEGNR ANLVQSSWALLSLTHAGQAEIDPTPIHRGMKLLINSQMEDGDFPQQEITGVFMRNCTLNY SSYRNIFPI WAMGEYRRQVLCAHSY

>gi 130699380| ref|NP_849903.1 | lupeol synthase 1 [Arabidopsis thaliana] SEQ ID No 57:

MWKLKIGKGNGEDPHLFSSNNFVGRQTWKFDHKAGSPEERAAVEEARRGFLDNRFRV KGCSDLLW RMQFLREKKFEQGIPQLKATNIEEITYETTTNALRRGVRYFTALQASDGHWPGEITGPLF FLPPLIFCLY ITGHLEEVFDAEHRKEMLRHIYCHQNEDGGWGLHIESKSVMFCTVLNYICLRMLGENPEQ DACKRAR QWILDRGGVIFIPSWGKFWLSILGVYDWSGTNPTPPELLMLPSFLPIHPGKILCYSRMVS IPMSYLYGK RFVGPITPLILLLREELYLEPYEEINWKKSRRLYAKEDMYYAHPLVQDLLSDTLQNFVEP LLTRWPLNKL VREKALQLTMKHIHYEDENSHYITIGCVEKVLCMLACWVENPNGDYFKKHLARIPDYMWV AEDGMKM QSFGCQLWDTGFAIQALLASNLPDETDDALKRGHNYIKASQVRENPSGDFRSMYRHISKG AWTFSDR DHGWQVSDCTAEALKCCLLLSMMSADIVGQKIDDEQLYDSVNLLLSLQSGNGGVNAWEPS RAYKWL ELLNPTEFMANTMVEREFVECTSSVIQALDLFRKLYPDHRKKEINRSIEKAVQFIQDNQT PDGSWYGN WGVCFIYATWFALGGLAAAGETYNDCLAMRNGVHFLLTTQRDDGGWGESYLSCSEQRYIP SEGERS NLVQTSWAMMALIHTGQAERDLIPLHRAAKLIINSQLENGDFPQQEIVGAFMNTCMLHYA TYRNTFPL WALAEYRKVVFIVN

>gi|83016477|dbj|BAE53430.1 | lupeol synthase [Lotus japonicus] SEQ ID No 58:

MWKLKVAEGGKGLVSVSNFIGRQHWVFDPNAGTPQEHEEIERMRQEFTKNRFSIKQS ADLLMRMQL RKENPCGPIPPAVKLRDVEKVTAEALITTIRRSITFYSSIQAHDGHWPAESAGPLFFVQP LVMALYITGS LDDVLGPQHKKEIIRYLYNHQNEDGGWGFHIEGHSTMFGSALSYIALRVLGQSLEDGEDM AVARGRK WILDHGGLVAIPSWGKFWVTVLGVYEWSGCNPLPPEFWLLPKIFPIHPGKMLCYCRLVYM PMSYLYG KKFVGPITALVRSLRKELYNEPYDRVDWNKARNTVAKEDLYYPHPLIQDMLWGFLHHVGE RVLNTWP FSMLRQKAIEVAINHVRYEDETTRYLCIGSVEKVLYLIARWVEDPNSEAYKLHLARIPDY FWLAEDGLKI QSFGCQMWDAAFAIQAILSGNVSEEYGPTLKKAHHFVKASQVRENPSGDFKAMYRHISKG AWTFSM HDHGWQVSDCTAEGLKVALLLSEMSDDLVGAKMETEQFYDAVNVILSLQSSNGGFPAWEP QRAYQ WLEKFNPTEFFEETLIEREYVECTGSAMQALALFRKLYPKHRRKEIDRCISKAIRYIENT QNPDGSWYG CWGICYTYGTWFAVEGLTACGKNFQNSVTLRRACKFLLSKQLPNGGWGESYLSSQDKVYT NIEGKR ANLVQSSWALLSLMRAGQAEIDPTPIHRGIRLLINSQMDDGDFPQQEITGVFMRNCTLNY SSYRNIFPI WALGEYRRRVLCA

>gi|82468803|gb|ABB76766.1 | lupeol synthase [Ricinus communis] SEQ ID No 59:

MWRIKIAEGGNNPYIYSTNNFQGRQIWVFDPNAGTPEEQAEVEEARQNFWKNRFQVKPNS DLLWQL

QFLREKNFKQKIPKVKVEDGEEITSEIAAAALRRSVHLFSALQASDGHWCAENGGLL FFLPPLVFAVYI TGHLNTVFSPEHRKEILRYIYCHQNEDGGWGIHIEGHSTMFCTVLNYICMRILGEARDGG IENACERG RKWILDHGGATGISSWGKT LSILGVYEWDGTNPMPPEFWAFPSSFPLHPAKMFCYCRITYMPMSYL YGKRFVGPITPLILQIREEIYNEPYNKIKWNSVRHLCAKEDNYFPHPTIQKLLWDALYTF SEPLFSRWPF NKLREKALKITMDHIHYEDHNSRYITIGCVEKPLCMLACWIEDPHGEAFKKHLARIADYI WVGEDGIKM QSFGSQTWDTSLALQALIASDLSHEIGPTLKQGHVFTKNSQATENPSGDFRKMFRHISKG AWTFSDK DQGWQVSDCTAESLKCCLLFSMMPPEIVGEKMEPEKVYDSVNVILSLQSQNGGFTAWEPA RAGSW MEWLNPVEFMEDLVVEHEYVECTSSAIQALVLFKKLYPRHRNKEIENCIINAAQFIENIQ EPDGSWYGN WGICFSYGTWFALKGLAAAGRTYENCSAIRKGVDFLLKSQRDDGGWAESYLSCPKKVYVP FEGNRS NLVQTAWAMMGLIYGGQAKRDPMPLHRAAKLLINSQTDLGDFPQQELTGAFMRNCMLHYA LFRNTF PIWALAEYRRHVLFPSAGFGFGFTNNL

>gi|6456467|dbj|BAA86932.1 | lupeol synthase [Taraxacum officinale] SEQ ID No 60:

MWKLKIAEGGDDEWLTTTNNHVGRQHWQFDPDAGTEEERAEIEKIRLNFKLNRFQFKQSA DLLMRT QLRKENPINKIPDAIKLNETEEVTNDAVTTTLKRAISFYSTIQAHDGHWPAESAGPLFFL PPLVIALYVTG AMNDILTPAHQLEIKRYIYNHQNEDGGWGLHIEGHSTIFGSVLSYITLRLLGEEADSVAE DMALVKGRK WILDHGGAVGIPSWGKFWLTILGVYEWGGCNPMPPEFWLMPKFFPIHPGKMLCYCRLVYM PMSYLY GKRFVGKITELVRDLRQELYTDPYDEINWNKARNTCAKEDLYYPHPFVQDMVWGVLHNVV EPVLTSR PISTLREKALKVAMDHVHYEDKSSRYLCIGCVEKVLCLIATWVEDPNGDAYKRHLARIPD YFWVAEDG MKMQSFGCQMWDAAFAIQAIFSSNLTEEYGPTLKKAHEFVKASQVRDNPPGDFSKMYRHT SKGAWT FSIQDHGWQVSDCTAEGLKVSLLYSQMNPKLVGEKVETEHLYDAVNVILSLQSENGGFPA WEPQRAY AWLEKFNPTEFFEDVLIEREYVECTSSAIQGLTLFKKLHPGHRTKEIEHCISRAVKYVED TQESDGSWY GCWGICYTYGTWFAVDALVACGKNYHNCPALQKACKFLLSKQLPDGGWGESYLSSSNKVY TNLEGN RSNLVHTSWALISLIKAGQAEIDPTPISNGVRLLINSQMEEGDFPQQEITGVFMKNCNLN YSSFRNIFPI WALGEYRRIVQNI

>gi|41687978|dbj|BAD08587.1 | lupeol synthase [Glycyrrhiza glabra] SEQ ID No 61 :

MWKLKIGEGGAGLISVNNFIGRQHWEFDPNAGTPQEHAEIERLRREFTKNRFSIKQSADL LMRMQLR KENHYGTNNNIPAAVKLSDAENITVEALVTTITRAISFYSSIQAHDGHWPAESAGPLFFL QPLVMALYIT GSLDDVLGPEHKKEIVRYLYNHQNEDGGWGFHIEGHSTMFGSALSYVALRILGEGPQDKA MAKGRK WILDHGGLVAIPSWGKFWVTVLGAYEWSGCNPLPPELWLLPKFAPFHPGKMLCYCRLVYM PMSYLY GKKFVGPITALIRSLREELYNEPYNQINWNTARNTVAKEDLYYPHPLIQDMLWGFLYHVG ERFLNCWP FSMLRRKALEIAINHVHYEDENSRYLCIGSVEKVLCLIARWVEDPNSEAYKLHLARIPDY FWLAEDGLKI QSFGCQMWDAAFAIQAILACNVSEEYGPTLRKAHHFVKASQVRENPSGDFNAMYRHISKG AWTFSM HDHGWQVSDCTAEGLKAALLLSEMPSELVGGKMETERFYDAVNVILSLQSSNGGFPAWEP QKAYRW LEKFNPTEFFEDTMIEREYVECTGSAMQGLALFRKQFPQHRSKEIDRCIAKAIRYIENMQ NPDGSWYG CWGICYTYGTWFAVEGLTACGKNCHNSLSLRKACQFLLSKQLPNAGWGESYLSSQNKVYT NLEGNR ANLVQSSWALLSLTHAGQAEIDPTPIHRGMKLLINSQMEDGDFPQQEITGVFMRNCTLNY SSYRNIFPI WAMGEYRRQVLCAHSY

>gi|392621787|gb|AFM82492.1 | lupeol synthase [Eleutherococcus trifoliatus] SEQ ID No 62:

MWKLKIAEGDKNDPYLYSTNNFVGRQTWEFDPDYVGSPGELEEVEEARRQFWENRYK VKPCGDLL WRMQFLREKNFKQTIPQVKVGDDEAVTYDAATTTLRRAVHFFSALQASDGHWPAEIAGPL FFLPPLV MCVYITGHLDTVFPAKHRKEILRYIYCHQNENGGGGLHIEGHSTMFGTTFSYICMRILGK GPDGGVNN ACAKGRKWILDHGSATAIPSWGKT LSILGVYEWTGSNPMPPEFWLLPSSLSVHPAKMLCYCRMVYL PMSYLYGKRFVGPITPLILQLKEELYAQPYNEIRWGKVRHVCAKEDIYYPHPLIQDLLWD SLHVLAEPLL TRWPFNKLREKALQTTMKHIHYEDENSRYITIGCVEKILCMLACWVEDPNGDYFKKHLAR IPDYLWVA EDGMKMQSFGSQEWDIGFGIQALLASDLTHELGPTLMKGHDFIKKSQVKDNPSGDFKSMY RHISKGS WTFSDQDHGWQVSDCTAEGLKCCLIFSTMPEEIVGKKMEPELLYNSVNVLLSLQSKNGGV AAWEPA TAQDWLELFNPTEFFADTIIEHEYVECTSSAIQALTLFKKLYPGHRKKEIDNFITNAIRF IEDIQIPDGSWY GNWGVCFTYGTWFALGGLAAGGKTYNNCAAVRKAVNFLLESQLDDGGWGESHLSCPRKVY VPLEG NRSNLVHTGWALMGLIHSGQAERDPTPLHRAAKLLINSQMEDGDFPQQEITGAFMKNCML HYAVYRN IYPLWALAEYRRRVPLPTLGA

>gi|300807980|gb|ADK35126.1 | lupeol synthase [Kalanchoe daigremontiana] SEQ ID No 63:

MWKLKIADGGSNPYIFTTNNFVGRQIWEFDPQATDPQQLAKVEAARLDFYHNRYKLK PNSDLLWRMQ FLEEKAFTQTIPQVKVEDGEEVSYEAVTAALRRGVHLYSALQASDGHWPAENAGPMFFMP PMVMCL YITGHLNAIFTEEHRSETLRYIYYHQNEDGGWGFHIEGHSTMFGTVLNYICMRLLGEGPE GGQDNAVS RGRKWILDHGGATSIPSWGKTWLSIMGLCDWSGCNPMPPEFWLLPSYLPMHPGKMWCYCR MVYM PMSYLYGKRFTARITPLILQLREEIHIQPYDQIDWKKVRHVCCKEDMYYPHPLLQDLLWD TLYLTTEPLL TRWPLNKLIRKRALQTTMKHIHYEDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHLA RIPDYLWIA EDGMKMQSFGSQHWDTAFSIQALLASNMAEEIGITLAKGHDFIKKSQVKDNPSGDFKGMY RHISKGA WTFSDQDHGWQVSDCTAEGLKCCLLFSMMQPEVVGESMAPESLYNSVNVLLSLQSQNGGL PAWEP AGAPEWLELLNPTEFFENIVIEHEYVECTSSAVQALVLFKKLYPLHRRKEVERFITNGAK YLEDIQMPD GSWYGNWGVCFTYGAWFALEGLSAAGKTYNNCAAVRKGVDFLLNIQLEDGGWGESYQSCP DKKYV PLEDNRSNLVQTSWALMGLIYAGQADRDPTPLHRAAQLLINSQLEDGDFPQQEITGVFQR NCMLHYA AYRNIFPLWALAEYRRQIQLHSEATKMV

>gi| 157679393|dbj|BAF80444.1 | lupeol synthase [Bruguiera gymnorhiza] SEQ ID No 64:

MWRLKIAEGGNNPYIYSTNNFVGRQTWEFDPEAGTPEERAQVEEARENFWRDRFLIK PSSDLLWRF QFLSEKKFKQRIPQVKVQDGEEITREIATTALRRSVHLVSALQASDGHWCAENSGPMFFV PPMVFSLY ITGHLNAVFSAEHCKEILRYIYCHPNEDGGWGLHIEGHSAMFSTVLNYNWLGKLGEGRDG GKDNACE RARRRILDHGSATAISSWGKT LAILGVYEWDGCNPMPPEFWAFPTFFPIHPARMLCYCRLTYMAMS YLYGKKFVGPITPLILQLREEIYNEPYDQINWSRMRHLCAKEDNYYAHTLTQIILWDAIY MLGEPLLKRW PFNKLREKALKITMDHIHYEDENSQYITIGSVEKPLLMLACWHEDPNGDAFKKHLARIPD YVWLGEDGI KIQSFGSQVWDTSFVLQALIASNLPSETGPTLEKGHNFIKNSQVTQNPSGDFRRMFRHIS KGSWTFSD KDHGWQVSDCTAESLKCCLLFSMMPPELVGEKMGPQRMYDAVNVIISLQSKNGGCSAWEP AGAGS WMEWLNPVEFLADLVIEHEYVECTSSSLQALVLFKKLYPEHRRKEIEIFILNAVRFTEEI QQPDGSWYG NWGICFLSGTWFGLKGLAAAGKTYYNCTAVRKGVEFLLQTQRDDGGWGESYLSCPKKIYV PLEGNR SNLVQTALAMMGLILGGQGERDPTPLHRAAKLLINSQTELGDFPQQELSGCFMRNCMLHY SEYRDIF PTWALAEYCKLFPLPSKND

>gi| 18147596|dbj|BAB83088.1 | beta-amyrin synthase [Betula platyphylla] SEQ ID No 65: MWRLKIADGGSDPYIYSTNNFVGRQTWEFDPQAGSPQERAEVEEARRNFYDNRYQVKPSG DLLWR MQFLKEKNFKQTIPPVKVEDGEEITYEKSTAALRRAVHFYSALQASDGHWPAENAGPLFF LPPLVMC MYITGHLNTVFPAEHQKEILRYIYYHQNEDGGWGLHIEGHSTMFCTALSYICMRILGEGP DGGQDNAC ARARKWILDHGGVTHMPSWGKTWLSILGIFEWIGSNPMPPEFWILPSFLPMHPAKMWCYC RMVYMP MSYLYGKRFVGPITPLILQLREELYTQPYHQVNWKKVRHLCAKEDIYYPHPLIQDLLWDS LYIFTEPLLT RWPFNKLVREKALQVTMKHI HYEDENSRYITIGCVEKVLCMLACWVEDPNGDYFKKHIARIPDYIWVA EDGIKMQSFGSQEWDTGFAIQALLASNLTDEIGPTLARGHDFIKKSQVKDNPSGDFESMH RHISKGS WTFSDQDHGWQVSDCTAEGLKCCLLFSIMPPEIVGEKMEPEQLYDSVNVLLSLQSKNGGL AAWEPA GAQEWLELLNSTEFFADIVIEHEYIECTASAMQTLVLFKKLYPGHRKKEIENFIKNAAQF LQVIQMPDGS WYGNWGVCFTYGTWFALGGLAAVGKTYNNCLAVRRAVDFLLRAQRDNGGWGESYLSCPKK EYVPL EGNKSNLVHTAWAMMGLIHAGQAERDPTPLHRAAKLIINSQLEDGDFPQQEITGVFMKNC MLHYAAY KNIYPLWALAEYRKHVPLPLGKNLNQVVNCIGQSLYKKYKD

NADPH-cytochrome P450 Reduktase (CPRs):

>gi| 197209812|dbj|BAG68945.1 | cytochrome P450 reductase [Lotus japonicus] SEQ ID No 66:

MEESSSMKISPLDLMSAMIKGTLDPSNVSSTSGAGSVFLENREFVMVLTTSIAVLIG CVVVFIWRRSTG NKAKSIEPPKRVVEKLSDEAEVDDGTRKVTIFFGTQTGTAEGFAKAIAEEAKVRYEKAKF KIVDMDDYA QDDDEYEEKLKKETLALFFLATYGDGEPTDNAARFYKWFLEGDEKEEGWLRNLEYAVFGL GNRQYE HFNKVAIEVDDKLADFGGKRLVKVGLGDDDQCIEDDFTAWKEELWPALDELLRGDDDTTV STPYTAA VLEYRVVI HDPLDASVDEKKWHNVNGHAIVDAQHPVRSNVAVRKELHTPVSDRSCTHLEFDISGTGVA YETGDHVGVYCENLSETVEEAVRLLGLSPDTYFSVHTDDEDGKPLSGSSLPPTFPPCTLR TAIARYAD VLSSPKKSVLLALAAHASNPSEADRLRHLASPAGKDEYSEWVIASQRSLLEVMAEFPSAK PPIGVFFA AIAPRLQPRFYSISSSPRMAPSRIHVTCALVNDKMPTGRIHRGVCSTWMKNSVPLEKSQD CSWAPIFV RQSNFKLPADNKVPIIMIGPGTGLAPFRGFLQERLALKEDGAELGPSVLFFGCRNRQMDY IYEDELNH FVNSGALSELIVAFSREGPTKEYVQHKMMEKASDIWNMISQGAYIYVCGDAKGMARDVHR TLHTILQE QGSLDSSKAEGMVKNLQLNGRYLRDVW

>gi| 16187|emb|CAA46814.1 | NADPH-ferri he moprote in reductase [Arabidopsis thaliana] SEQ ID No 67:

MTSALYASDLFKQLKSIMGTDSLSDDWLVIATTSLALVAGFVVLLWKKTTADRSGELKPL MIPKSLMA KDEDDDLDLGSGKTRVSIFFGTQTGTAEGFAKALSEEIKARYEKAAVKVIDLDDYAADDD QYEEKLKK ETLAFFCVATYGDGEPTDNAARFSKWFTEENERDIKLQQLAYGVFALGNRQYEHFNKIGI VLDEELCK KGAKRLIEVGLGDDDQSIEDDFNAWKESLWSELDKLLKDEDDKSVATPYTAVIPEYRVVT HDPRFTTQ KSMESNVANGNTTIDIHHPCRVDVAVQKELHTHESDRSCI HLEFDISRTGITYETGDHVGVYAENHVEI VEEAGKLLGHSLDLVFSI HADKEDGSPLESAVPPPFPGPCTLGTGLARYADLLNPPRKSALVALAAYA TEPSEAEKLKHLTSPDGKDEYSQWIVASQRSLLEVMAAFPSAKPPLGVFFAAIAPRLQPR YYSISSCQ DWAPSRVHVTSALVYGPTPTGRI HKGVCSTWMKNAVPAEKSHECSGAPIFIRASNFKLPSNPSTPIVM VGPGTGLAPFRGFLQERMALKEDGEELGSSLLFFGCRNRQMDFIYEDELNNFVDQGVISE LIMAFSRE GAQKEYVQHKMMEKAAQVWDLIKEEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEA EAIVKKL QTEGRYLRDVW

>gi| 18139|emb|CAA49446.1 | NADPH-ferri he moprote in reductase [Catharanthus roseus] SEQ ID No 68:

MDSSSEKLSPFELMSAILKGAKLDGSNSSDSGVAVSPAVMAMLLENKELVMILTTSVAVL IGCVWLIW RRSSGSGKKVVEPPKLIVPKSVVEPEEIDEGKKKFTIFFGTQTGTAEGFAKALAEEAKAR YEKAVIKVID IDDYAADDEEYEEKFRKETLAFFILATYGDGEPTDNAARFYKWFVEGNDRGDWLKNLQYG VFGLGNR QYEHFNKIAKVVDEKVAEQGGKRIVPLVLGDDDQCIEDDFAAWRENVWPELDNLLRDEDD TTVSTTY TAAIPEYRVVFPDKSDSLISEANGHANGYANGNTVYDAQHPCRSNVAVRKELHTPASDRS CTHLDFDI AGTGLSYGTGDHVGVYCDNLSETVEEAERLLNLPPETYFSLHADKEDGTPLAGSSLPPPF PPCTLRTA LTRYADLLNTPKKSALLALAAYASDPNEADRLKYLASPAGKDEYAQSLVANQRSLLEVMA EFPSAKPP LGVFFAAIAPRLQPRFYSISSSPRMAPSRIHVTCALVYEKTPGGRI HKGVCSTWMKNAIPLEESRDCS WAPIFVRQSNFKLPADPKVPVIMIGPGTGLAPFRGFLQERLALKEEGAELGTAVFFFGCR NRKMDYIY EDELNHFLEIGALSELLVAFSREGPTKQYVQHKMAEKASDIWRMISDGAYVYVCGDAKGM ARDVHRT LHTIAQEQGSMDSTQAEGFVKNLQMTGRYLRDVW

>gi|357465233|ref|XP_003602898.1 | NADPH cytochrome P450 reductase [Medicago truncatula] SEQ ID No 69:

MTSSNSDLVRTIESVLGVSLGDSVSDSVVLIVTTSAAVIIGLLVFLWKKSSDRSKELKPV IVPKSLVKEED DDADIADGKTKVTVFFGTQTGTAEGFAKALAEEIKARYEKAFVKVVDMDDYAADDDQYEE KLKKETLA FFMLATYGDGEPTDNAARFYKWFTEGKDERGTWLQQLTYGVFGLGNRQYEHFNKIGKVVD DDLSEQ GAKRLVPLGMGDDDQSIEDDFNAWKESLWPELDQLLRDEDDVNTVSTPYTAAISEYRVVF HDPTVTP SYENHFNAANGGAVFDIHHPCRANVAVRRELHKPQSDRSCIHLEFDVSGTGVTYETGDHV GVYADN CDETVKEAGKLLGQDLDLLFSLHTDNEDGTSLGGSLLPPFPGPCTVRTALARYADLLNPP RKAALIALA AHASEPSEAERLKFLSSPQGKDEYSKWWGSHRTLLEVMADFPSAKPPLGVFFAAIAPRLQ PRYYSIS SSPRFAPQRVHVTCALVEGPTPTGRIHKGVCSTWMKNAIPSEESRDCSWAPIFIRPSNFK LPADPSIPII MVGPGTGLAPFRGFLQERFALKEDGVQLGPALLFFGCRNRQMDFIYEEELNNFVEQGSLS ELIVAFSR EGPEKEYVQHKMMDKASYFWSLISQGGYLYVCGDAKGMARDVHRTLHTIVQQQENADSSK AEATVK KLQMDGRYLRDVW

>gi|6321832|ref|NP_011908.11 Ncp1 p [Saccharomyces cerevisiae S288c] SEQ ID No 70:

MPFGIDNTDFTVLAGLVLAVLLYVKRNSIKELLMSDDGDITAVSSGNRDIAQVVTEN NKNYLVLYASQT GTAEDYAKKFSKELVAKFNLNVMCADVENYDFESLNDVPVIVSIFISTYGEGDFPDGAVN FEDFICNAE AGALSNLRYNMFGLGNSTYEFFNGAAKKAEKHLSAAGAIRLGKLGEADDGAGTTDEDYMA WKDSILE VLKDELHLDEQEAKFTSQFQYTVLNEITDSMSLGEPSAHYLPSHQLNRNADGIQLGPFDL SQPYIAPIV KSRELFSSNDRNCIHSEFDLSGSNIKYSTGDHLAVWPSNPLEKVEQFLSIFNLDPETIFD LKPLDPTVKV PFPTPTTIGAAIKHYLEITGPVSRQLFSSLIQFAPNADVKEKLTLLSKDKDQFAVEITSK YFNIADALKYLS DGAKWDTVPMQFLVESVPQMTPRYYSISSSSLSEKQTVHVTSIVENFPNPELPDAPPVVG VTTNLLRN IQLAQNNVNIAETNLPVHYDLNGPRKLFANYKLPVHVRRSNFRLPSNPSTPVIMIGPGTG VAPFRGFIR ERVAFLESQKKGGNNVSLGKHILFYGSRNTDDFLYQDEWPEYAKKLDGSFEMWAHSRLPN TKKVYV QDKLKDYEDQVFEMINNGAFIYVCGDAKGMAKGVSTALVGILSRGKSITTDEATELIKML KTSGRYQED

W

>gi| 16189|emb|CAA46815.1 | NADPH-ferri he moprote in reductase [Arabidopsis thaliana] SEQ ID No 71 :

MSSSSSSSTSMIDLMAAIIKGEPVIVSDPANASAYESVAAELSSMLIENRQFAMIVTTSI AVLIGCIVMLV WRRSGSGNSKRVEPLKPLVIKPREEEIDDGRKKVTIFFGTQTGTAEGFAKALGEEAKARY EKTRFKIV DLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARFYKWFTEGNDRGEWLKNLKY GVFGLG NRQYEHFNKVAKVVDDILVEQGAQRLVQVGLGDDDQCIEDDFTAWREALWPELDTILREE GDTAVAT PYTAAVLEYRVSIHDSEDAKFNDITLANGNGYTVFDAQHPYKANVAVKRELHTPESDRSC IHLEFDIAG SGLTMKLGDHVGVLCDNLSETVDEALRLLDMSPDTYFSLHAEKEDGTPISSSLPPPFPPC NLRTALTR YACLLSSPKKSALVALAAHASDPTEAERLKHLASPAGKDEYSKWWESQRSLLEVMAEFPS AKPPLG VFFAGVAPRLQPRFYSISSSPKIAETRIHVTCALVYEKMPTGRIHKGVCSTWMKNAVPYE KSEKLFLGR PIFVRQSNFKLPSDSKVPIIMIGPGTGLAPFRGFLQERLALVESGVELGPSVLFFGCRNR RMDFIYEEEL QRFVESGALAELSVAFSREGPTKEYVQHKMMDKASDIWNMISQGAYLYVCGDAKGMARDV HRSLHT IAQEQGSMDSTKAEGFVKNLQTSGRYLRDVW

>gi|397771304|gb|AFO64618.11 cytochrome P450 reductase [Artemisia annua] SEQ ID No 72:

MQSTTSVKLSPFDLMTALLNGKVSFDTSNTSDTNIPLAVFMENRELLMILTTSVAVL IGCVVVLVWRRS SSAAKRAAESPVIVVPKKVTEDEVDDGRKKVTVFFGTQTGTAEGFAKALVEEAKARYEKA VFKVIDLD DYAAEDDEYEEKLKKESLAFFFLATYGDGEPTDNAARFYKWFTEGEEKGEWLEKLQYAVF GLGNRQ YEHFNKIAKVVDEKLTEQGAKRLVPVGMGDDDQCIEDDFTAWKELVWPELDQLLRDEDDT SVATPYT AAVAEYRVVFHDKPETYDQDQLTNGHAVHDAQHPCRSNVAVKKELHSPLSDRSCTHLEFD ISNTGLS YETGDHVGVYVENLSEVVDEAEKLIGLPPHTYFSIHADNEDGTPLGGASLPPPFPPCTLR KALASYAD VLSSPKKSALLALAAHATDSTEADRLKFLASPAGKDEYAQWIVASHRSLLEVMEAFPSAK PPLGVFFA SVAPRLQPRYYSISSSPKFAPNRIHVTCALVYEQTPSGRVHKGVCSTWMKNAVPMTESQD CSWAPIY VRTSNFRLPSDPKVPVIMIGPGTGLAPFRGFLQERLAQKEAGTELGTAILFFGCRNRKVD FIYEDELNN FVETGALSELVTAFSREGATKEYVQHKMTQKTSDIWNLLSEGAYLYVCGDAKGMAKDVHR TLHTIVQ EQGSLDSSKAELYVKNLQMAGRYLRDVW

>gi| 1 15499487|gb|ABI98819.11 cytochrome P450 reductase [Artemisia annua] SEQ ID No 73:

MQSTTSVKLSPFDLMTALLNGKVSFDTSNTSDTNIPLAVFMENRELLMILTTSVAVLIGC VVVLVWRRS SSAAKKAAESPVIVVPKKVTEDEVDDGRKKVTVFFGTQTGTAEGFAKALVEEAKARYEKA VFKVIDLD DYAAEDDEYEEKLKKESLAFFFLATYGDGEPTDNAARFYKWFTEGEEKGEWLDKLQYAVF GLGNRQ YEHFNKIAKVVDEKLVEQGAKRLVPVGMGDDDQCIEDDFTAWKELVWPELDQLLRDEDDT SVATPYT AAVAEYRVVFHDKPETYDQDQLTNGHAVHDAQHPCRSNVAVKKELHSPLSDRSCTHLEFD ISNTGLS YETGDHVGVYVENLSEVVDEAEKLIGLPPHTYFSVHADNEDGTPLGGASLPPPFPPCTLR KALASYAD VLSSPKKSALLALAAHATDSTEADRLKFLASPAGKDEYAQWIVASHRSLLEVMEAFPSAK PPLGVFFA SVAPRLQPRYYSISSSPRFAPNRIHVTCALVYEQTPSGRVHKGVCSTWMKNAVPMTESQD CSWAPIY VRTSNFRLPSDPKVPVIMIGPGTGLAPFRGFLQERLAQKEAGTELGTAILFFGCRNRKVD FIYEDELNN FVETGALSELVTAFSREGATKEYVQHKMTQKASDIWNLLSEGAYLYVCGDAKGMAKDVHR TLHTIVQ EQGSLDSSKAELYVKNLQMAGRYLRDVW

>gi|83854017|gb|ABC47946.1 | cytochrome P450 reductase [Artemisia annua] SEQ ID No 74: MQSTTSVKLSPFDLMTALLNGKVSFDTSNTSDTNIPLAVFMENRELLMILTTSVAVLIGC VVVL WRRS SSAAKKAAESPVIVVPKKVTEDEVDDGRKKVTVFFGTQTGTAEGFAKALVEEAKARYEKA VFKVIDLD DYAAEDDEYEEKLKKESLAFFFLATYGDGEPTDNAARFYKWFTEGEEKGEWLDKLQYAVF GLGNRQ YEHFNKIAKVVDEKLVEQGAKRLVPVGMGDDDQCIEDDFTAWKELVWPELDQLLRDEDDT SVATPYT AAVGEYRVVFHDKPETYDQDQLTNGHAVHDAQHPCRSNVAVKKELHSPLSDRSCTHLEFD ISNTGLS YETGDHVGVYVENLSEVVDEAEKLIGLPPHTYFSVHTDNEDGTPLGGASLPPPFPPCTLR KALASYAD VLSSPKKSALLALAAHATDSTEADRLKFFASPAGKDEYAQWIVASHRSLLEVMEAFPSAK PPLGVFFA SVAPRLQPRYYSISSSPKFAPNRI HVTCALVYEQTPSGRVHKGVCSTWMKNAVPMTESQDCSWAPIY VRTSNFRLPSDPKVPVIMIGPGTGLAPFRGFLQERLAQKEAGTELGTAILFFGCRNRKVD FIYEDELNN FVETGALSELVTAFSREGATKEYVQHKMTQKASDIWNLLSEGAYLYVCGDAKGMAKDVHR TLHTIVQ EQGSLDSSKAELYVKNLQMAGRYLRDVW

>gi| 13183562|gb|AAK15259.1 |AF302496_1 NADPH-cytochrome P450 oxydoreductase isoform 1 [Populus trichocarpa x Populus deltoides] SEQ ID No 75:

MSSGGSNLARFVQSVLGISFGDSLSDSWVIITTSFAALVGLVVLVLKRSSDRSKDVKPLV VPKSLSIKD EEDESEALGGKTKVTIFYGTQTGTAEGFAKALAEEVKARYEKAAVKVFDLDDYAMEDDQY EEKLKKET LALFMVATYGDGEPTDNAARFYKWFTEGNERGIWLQQLSYGVFGLGNRQYEHFNKIAKVL DDLLYEQ GGKRLVPVGLGDDDQCIEDDFSAWKEFLWPELDQLLRDEDDVNAPSTPYTAAIPEYRLVI HDPSIISVE DKFSNLANGNVSFDI HHPCRVNVAVQKELHKAESDRSCI HLEFDITGTGITYETGDHLGVYAENSDETV EEAGKLLDKPLDLLFSIHADNEDGTAIGSSLPPPFPGPCTLHTALACYADLLSPPKKAAL LALAAHASEP SEADRLKFLSSPQGKNEYSHWVMASQRSLLEVMAEFPSSKPPLGIFFAAVAPRLQPRYYS ISSSPRYT PNRVHVTCALVYGPTPTGRIHKGVCSTWMKNAVPLEKSYECSWAPIFTRTSNFKLPADPS TPIIMVGP GTGLAPFRGFLQERIALKEDGVKLGPALLFFGCRNRRMDFIYEDELNNFVEQGVISELIV AFSREGPQK EYVQHKMVDRAAEIWTIISQGGYFYVCGDAKGMARDVHRTLHTIVQEQGGLDSSKTESMV KKLQME GRYLRDVW

>gi| 13183564|gb|AAK15260.1 |AF302497_1 NADPH-cytochrome P450 oxydoreductase isoform 2 [Populus trichocarpa x Populus deltoides] SEQ ID No 76:

MQSSSSSMKVSPLELMQAIIKGKVDPTNVSSESGGSAAEMATLIRENREFVIILTTSIAV LIGYVVVLIWR

RSSGYQKPKVPVPPKPLIVKDLEPEVDDGKKKVTIFFGTQTGTAEGFAKALAEEAKA RYEKAIFKTVDL

DDYAEDDDEYEEKLKKESLAIFFLATYGDGEPTDNAARFYKWFTDGNERGEWLKELP YAVFGLGNRQ YEHFNKIAIVVDKILGNQGGKQLVPVGLGDDDQCMEDDFAAWRELLWPELDQLLLDGDDP TGVSTPY TAAVAEYRVVLHDPEDAPLEDDNWSNANGHAIYDAQHPCRANVTVRRELHTPASDRSCTH LEFDISG TGLVYGTGDHVGVYCENLSEIVEEALQLLGLSPDIYFTIHTDNEDGTPLSGSALPPPFPS STLRTALTRY ADLLSSPKKSALMALAAHATNPTEADRLRHLASPAGKDEYAQWIVANHRSLLEVMAEFPS AKPPLGVF FASVAPRLLPRYYSISSSPSMAPSRIHVTCALVLEKTPAGRIHKGVCSTWMKNAVPLEKS HDCSWAPI FVRQSNFKLPADTKVPIIMIGPGTGLAPFRGFLQERLAQKEAGAELGSSVLFFGCRNRQM DFIYEDEL NNFVESGALSELSVAFSREGPTKEYVQHKMMQKASDIWNMISQGGYLYVCGDAKGMAKDV HRTLHT IVQEQGSLDNSKTESFVKGLQMNGRYLRDVW

>gi| 13183566|gb|AAK15261 .1 |AF302498_1 NADPH-cytochrome P450 oxydoreductase isoform 3 [Populus trichocarpa x Populus deltoides] SEQ ID No 77:

MESSSSSIKVSPLDLMQAIIKGKVDPANVSSESGGSVAEVATLILENREFVMILTTS IAVLIGCVVVLIWR RSSGYQRPKVPVPPKPLIVKDLEPEVDDGKKKVTIFFGTQTGTAEGFAKALAEEAKARYD KATFKTVD MDDYAGDDDEYEEKLKKEDLVIFFLATYGDGEPTDNAARFYKWFTEGNERGEWLKDLPYA VFGLGN RQYEHFNKIAIVVDKIFADQGGKRLAPVGLGDDDQCMEDDFAAWRELLWPEMDQLLLDGD DPTAVST PYAATVSEYRVVFHSPEDAPLEDDNWSNANGHAVYDAQHPCRANVAVRRELHTPASDRSC THLEFEI SGTGLAYGTGDHVGVYCENLSETVEEALQLLGLSPDTYFSIHNDNEDGTPLSGGALPPPF PPSTLKTA LARYADLLSLPKKSALMALAAHATDPTEADRLRHLASPAGKDEYAQLLVANQRSLLEVMA EFPSAKPP LGVFFASVAPRLQPRYYSISSSPRMAPSRI HVTCALVLEKTLGGRI HKGVCSTWMKNAVPLEKSHDCS WAPVFVRQSNFKLPADAKVPIIMIGPGTGLAPFRGFLQERLALKEAGSELGSSVLFFGCR NRKMDFIY EDELNNFVESGALSELVVAFSREGPTKEYVQHKMMQKASDIWNMISQGGYLYVCGDAKGM AKDVHR ALHTIVQEQGSLDNSKTESFVKSLQMNGRYLRDVW

>gi|295448|gb|AAA34240.1 | NADPH cytochrome P450 [Vigna radiata] SEQ ID No 78:

MASNSDLVRAVESFLGVSLGDSVSDSLLLIATTSAAVWGLLVFLWKKSSDRSKEVKP VVVPRDLMME EEEEVDVAAGKTKVTIFFGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDDYAADDDLY EEKLKKESL VFFMLATYGDGEPIDNAARFYKWFTEGKDERGIWLQKLTYGVFGLGNRQYEHFNKIGKWD EELAEQ GAKRLVAVGLGDDDQSIEDDFSAWKESLWSELDQLLRDEDDANTVSTPYTAAILEYRVVI HDPTAAST YDNHSTVANGNTEFDIHHPCRVNVAVQKELHKPESDRSCI HLEFDISGTSITYDTGDHVGVYAENCNE TVEETGKLLGQNLDLFFSLHTDKDDGTSLGGSLLPPFPGPCSLRTALARYADLLNPPRKA ALLALATHA SEPSDERLKFLSSPQGKDEYSKWWGSQRSLVEVMAEFPSAKPPLGVFFAAIAPRLQPRYY SISSSPR FAPQRVHVTCALVYGPTPTGRIHKGVCSTWMKNAIPSEKSQDCSSAPIFIRPSNFKLPVD HSIPIIMVGP GTGLAPFRGFLQERYALKEDGVQLGPALLFFGCRNRQMDFIYEDELKSFVEQGSLSELIV AFSREGAE KEYVQHKMMDKAAHLWSLISQGGYLYVCGDAKGMARDVHRTLHSIVQEQENVDSTKAEAI VKKLQM DGRYLRDVW

>gi|2809387|gb|AAB97737.1 | NADPH cytochrome P450 reductase [Petroselinum crispum] SEQ ID No 79:

MQSESMEVSPVDLLASILKIDSVESMTLLLENRDVLMLLTTSFAVLIGLGLVMMWRRSTT MTKSAKKLE

PAKIVIPKFEMEEEVDDGKKKVTIFYGTQTGTAEGFAKALAEEAKARYQDAIFKTID LDDYAGDDDEYE

TKLKKESMVFFFLATYGDGEPTDNAARFYKWFCEGKERGEWLNNLQYGVFGLGNRQY EHFNKIAVV VDDGLVEQGAKRLVPVGMGDDDQCIEDDFTAWREL WPELDQLLLDEESKAAATPYTAAVLEYRVQ FYNQTDTSSPLVRSMSKLNGHAVYDAQHPCRANVAVRRELHTPASDRSCTHLEFDISSTG LAYETGD HVGVYTENLIEIVEEAERLIDISPDTYFSIHTENEDGTPLSGGSLPPPFPPCSFRTALTR YADLLSTPKKS ALVALAAHASDPSEAERLRFLASPVGKDEYAQWLVASQRSLLEVLAAFPSAKPPLGVFFA SVAPRLQP RYYSISSSPRMAPSRIHVTCALVHETTPAGRIHKGLCSTWMKNAVSLEDAHVSSWAPIFV RQSNFRLP TDSKVPIIMIGPGTGLAPFRGFMQERLALKESGAELGSAVLYFGCRNRKLDFIYEDELNH FVETGAISE MVVAFSREGPAKEYVQHKMSQKASEIWDMISHGAYIYVCGDAKGMARDVHRMLHTIAQEQ GALDSS HAESLVKNLHMSGRYLRD W

>gi|2809385|gb|AAB97736.1 | NADPH cytochrome P450 reductase [Petroselinum crispum] SEQ ID No 80:

MGGESLATSLPATLLENRDLLMLLTTSIAVLIGCAVVLVWRRSSLRSVKSVEPPKLI VPKVEIEDEVDDG KKKVTVFFGTQTGTAEGFAKAFAEEAKARYEKAKFRVVDLDDYAAEDEEYEAKFKKESFA FFFLATYG DGEPTDNAARFYKWFSEGEEKGDWLNKLQYGVFGLGNRQYEHFNKIAKVVDDGLADQGAK RIVEVG MGDDDQCIEDDFTAWREL WPELDKLLLDEDDTSAATPYTAAVLEYRVVVYDQLDTATLDRSLSTQN GHTVHDAQHPCRSSVAAKKELHKPASDRSCIHLEFDISHTGLAYETGDHVGVYCENLVEI VEEAEKLL GMQPNTYFSVHIDDEDGTPLTGGSLPPPFPPCTVRSALAKYADLLSSPKKSALLALAAHA SDPTEADR LRLLASPAGKDEYAQWVVASHRSLLEVLAEFPSAKPPLGVFFASVAPRLQPRYYSISSSP RMVPSRIH VTCALVYEKTPTGRIHKGVCST MKNAVSLEESHDCSWAPIFVRQSNFKLPSDTKVPIIMIGPGTGLAP FRGFLQERQALKDAGAELGTAVLYFGCRNRNLDFIYEDELNKFVESGSISELIVAFSREG PTKEYVQHK MLQKASEIWNLISEGAYIYVCGDAKGMARDVHRMLHTIAQEQGALDSSKAESWVKNLQMT GRYLRDV

W

>gi|224551850|gb|ACN54323.1 | NADPH:cytochrome P450 reductase [Gossypium hirsutum] SEQ ID No 81 :

MSSSSDLVGFVESVLGVSLEGSVTDSMIVIATTSLAVILGLLVFFWKKSGSERSRDVKPL VAPKPVSLK DEEDDDAVIAAGKTKVTIFYGTQTGTAEGFAKALAEEIKARYEKAAVKWDLDDYAMDDEQ YEEKLKK ETLAFFMVATYGDGEPTDNAARFYKWFTEGNERLPWLQQLTYGVFGLGNRQYEHFNKIAK VLDEQLS EQGAKRLIEVGLGDDDQCIEDDFTAWRELLWPELDQLLRDEDDENATSTPYTAAIPEYRV VVHDPAV MHVEENYSNKANGNATYDLHHPCRVNVAVQRELHKPESDRSCIHLEFDISGTGITYETGD HVGVYAD NCVETVEEAARLLGQPLDLLFSIHTDNEDGTSAGSSLPPPFASPCTLRMALARYADLLNP PRKAALIAL AAHATEPSEAEKLKFLSSPQGKDEYSQWWASQRSLLEVMAEFPSAKPPLGVFFAAVAPRL QPRYYS ISSSPRFVPARVHVTCALVYGPTPTGRIHRGVCSTWMKNAVPLEKSNDCSWAPIFIRQSN FKLPADPS VPIIMVGPGTGLAPFRGFLQERLVLKEDGAELGSSLLFFGCRNRRMDFIYEDELNNFVEQ GALSELW AFSREGPQKEYVQHKMMDKAADIWNLISKGGYLYVCGDAKGMARDVHRTLHTIIQEQENV DSSKAES MVKKLQMDG RYLRDVW

>gi|224551852|gb|ACN54324.1 | NADPH:cytochrome P450 reductase [Gossypium hirsutum] SEQ ID No 82:

MDSSSSSSSSGPSPLDLMSALVKAKMDPSNASSDSAAQVTTVLFENREFVMILTTSIAVL IGCVVILIW RRSASQKPKQIQLPLKPSIIKEPELEVDDGKKKVTILFGTQTGTAEGFAKALVEEAKARY EKATFNIVDL DDYAADDEEYEEKMKKDNLAFFFLATYGDGEPTDNAARFYKWFTEGKERGEWLQNMKYGI FGLGNK QYEHFNKVAKVVDELLTEQGAKRIVPLGLGDDDQCIEDDFTAWRELVWPELDQLLRDEDD ATVSTPY TAAVLEYRVVFYDPADAPLEDKNWSNANGHATYDAQHPCRSNVAVRKELHAPESDRSCTH LEFDIAG TGLSYETGDHVGVYCENLDEVVDEALSLLGLSPDTYFSVHTDKEDGTPLGGSSLPSSFPP CTLRTALA RYADLLSSPKKAALLALAAHASDPTEADRLRHLASPAGKDEYAQWIVANQRSLLEVMAEF PSAKPPLG VFFAAVAPRLQPRYYSISSSPRLAPSRIHVTCALVYEKTPTGRIHKGVCSTWMKNAVSSG KSDDCGW APIFVRQSNFKLPSDTKVPIIMIGPGTGLAPFRGFLQERLALKEAGAELGPSVLFFGCRN RKMDFIYED ELNNFVNSGALSELVVAFSREGPTKEYVQHKMMEKAKDIWDMISQGGYLYVCGDAKGMAR DVHRAL HTIFQEQGSLDSSKAESMVKNLQMSGRYLRDVW

Cytochrome P450 Monooxygenases (CYPs): >gi|326324797|dbj|BAJ84106.1 | cytochrome P450 [Vitis vinifera] SEQ ID No 83:

MEVFFLSLLLIFVLSVSIGLHLLFYKHRSHFTGPNLPPGKIGWPMVGESLEFLSTGW KGHPEKFIFDRIS KYSSEVFKTSLLGEPAAVFAGAAGNKFLFSNENKLVHAWWPSSVDKVFPSSTQTSSKEEA KKMRKLL PQFFKPEALQRYIGIMDHIAQRHFADSWDNRDEVIVFPLAKRFTFWLACRLFMSIEDPAH VAKFEKPFH VLASGLITVPIDLPGTPFHRAIKASNFIRKELRAIIKQRKIDLAEGKASQNQDILSHMLL ATDEDGCHMNE MEIADKILGLLIGGHDTASAAITFLIKYMAELPHIYEKVYEEQMEIANSKAPGELLNWDD VQNMRYSWN VACEVMRLAPPLQGAFREAITDFVFNGFSIPKGWKLYWSANSTHKSPECFPQPENFDPTR FEGNGPA PYTFVPFGGGPRMCPGKEYARLEILVFMHNVVKRFKWDKLLPDEKIIVDPMPMPAKGLPV RLHPHKP

>gi|326324799|dbj|BAJ84107.1 | Cytochrome P450 [Vitis vinifera] SEQ ID No 84:

MEVFFLSLLLISVLSVSIRLYLLLYKHRSHFTGPNLPPGKIGWPMVGESLEFLSTGW KGHPEKFIFDRIS KYSSEVFKTSLLGEPAAVFAGAAGNKFLFSNENKLVHAWWPSSVDKVFPSSTQTSSKEEA KKMRKLL PQFLKPEALQRYTGIMDHIAQRHFADSWDNRDEVIVFPLAKRFTFWLACRLFMSIEDPAH VAKFEKPF HVLASGLITIPIDLPGTPFHRAIKASNFIRKELRAIIKQRKIDLAESKASKTQDILSHML LATDEDGCHMNE MSIADKILGLLIGGHDTASSAITFLVKYMAELPHIYEKVYKEQMEIANSKAPGELLNWDD VQKMRYSWN VACEVMRLAPPLQGAFREAITDFVFNGFSIPKGWKLYWSANSTHKSLECFPQPEKFDPTR FEGAGPA PYTFVPFGGGPRMCPGKEYARLEILIFMHNLVKRFKWDKLLPDEKIIVDPMPMPAKGLPV RLHPHKP

>gi|84514135|gb|ABC59076.11 cytochrome P450 monooxygenase CYP716A12 [Medicago truncatula] SEQ ID No 85:

MEPNFYLSLLLLFVTFISLSLFFIFYKQKSPLNLPPGKMGYPIIGESLEFLSTGWKGHPE KFIFDRMRKYS SELFKTSIVGESTVVCCGAASNKFLFSNENKLVTAWWPDSVNKIFPTTSLDSNLKEESIK MRKLLPQFF KPEALQRYVGVMDVIAQRHFVTHWDNKNEITVYPLAKRYTFLLACRLFMSVEDENHVAKF SDPFQLIA AGIISLPIDLPGTPFNKAIKASNFIRKELIKIIKQRRVDLAEGTASPTQDILSHMLLTSD ENGKSMNELNIAD KILGLLIGGHDTASVACTFLVKYLGELPHIYDKVYQEQMEIAKSKPAGELLNWDDLKKMK YSWNVACE VMRLSPPLQGGFREAITDFMFNGFSIPKGWKLYWSANSTHKNAECFPMPEKFDPTRFEGN GPAPYTF VPFGGGPRMCPGKEYARLEILVFMHNLVKRFKWEKVIPDEKIIVDPFPIPAKDLPIRLYP HKA

>gi|365927744|gb|AEX07773.1 | cytochrome P450 [Catharanthus roseus] SEQ ID No 86:

MEIFYVTLLSLFVLLVSLSFHFLFYKNKSTLPGPLPPGRTGWPMVGESLQFLSAGWK GHPEKFIFDRM AKYSSNVFRSHLLGEPAAVFCGAIGNKFLFSNENKLVQAWWPDSVNKVFPSSNQTSSKEE AIKMRKM LPNFLKPEALQRYIGLMDQIAQKHFSSGWENREQVEVFPLAKNYTFWLASRLFVSVEDPI EVAKLLEPF NVLASGLISVPIDLPGTPFNRAIKASNQVRKMLISIIKQRKIDLAEGKASPTQDILSHML LTSDENGKFMH ELDIADKILGLLIGGHDTASSACTFIVKFLGELPEIYEGVYKEQMEIANSKAPGEFLNWE DIQKMKYSWN VACEVLRLAPPLQGAFREALNDFMFHGFSIPKGWKIYWSVNSTHRNPECFPDPLKFDPSR FDGSGPA PYTFVPFGGGPRMCPGKEYARLEILVFMHNLVKRFKWEKIIPNEKIWDPMPIPEKGLPVR LYPHI NA

>gi|2241 18706|ref|XP_002331427.1 | cytochrome P450 [Populus trichocarpa] SEQ ID No 87:

MELLFLSLLLALFVSSVTIPLFLIFYNHRSQNSHPNLPPGKLGLPLVGESFEFLATG WKGHPEKFIFDRIA KYSSHIFKTNILGQPAVVFCGVACNKFLFSNENKLVVSWWPDSVNKIFPSSLQTSSKEEA KKMRKLLP QFLKPEALQGYIGIMDTIAQRHFASEWEHKEQVLVFPLSKNYTFRLACRLFLSIEDPSHV AKFSDPFNL LASGIISIPIDLPGTPFNRAIKASNFIRTELLAFIRQRKKDLAEGKASPTQDILSHMLLT CDENGKCMNEL DIADKIIGLLIGGHDTASAACTFIVKYLAELPHIYEEVYKEQMEIAKSKTPGEFLNWDDI QKMKYSWKVA CEVMRISPPLQGAFREALNDFIFNGFTIPKGWKLYWSTNSTHRDPVYFPEPEKFDPRRFE GSGPAPYT FVPFGGGPRMCPGKEYARLEILVFMHNLVRRFKFDKLIQDEKIWNPLPIPDKGLPVRLHP HKA

>gi|356513241 |ref|XP_003525322.1 | : cytochrome P450 716B2-like [Glycine max] SEQ ID No 88: MDHNNLYLSLLLLFVSFVTLSLFFLFYKHRSPFVAPNLPPGATGYPVIGESLEFLSTGWK GHPEKFIFD RMIRYSSQLFKTSIFGEPAVIFCGATCNKFLFSNENKLVAAWWPNSVNKVFPSTLQSNSK EESKKMRK LLPQFLKPEALQRYVGIMDTIAQNHFASLWDNKTELTVYPLAKRYTFLLACRLFMSVEDV NHVAKFEN PFHLLASGIISVPIDLPGTPFNKAIKAANAIRKELLKIIRQRKVDLAEGKASPTQDILSH MLLTCNENGQF MNELDIADKILGLLIGGHDTASAACTFIVKYLAELPHIYDSVYQEQMEIAKSKLPGELLN WDDINRMKYS WNVACEVMRIAPPLQGGFREAI NDFIFNGFSIPKGWKLYWSANSTHKNPEYFPEPEKFDPTRFEGQG PAPFTFVPFGGGPRMCPGKEYARLEILVFMHNLVKRFKWEKLIPDEKIIVDPLPVPAKNL PIRLHPHKP

>gi|388827893|gb|AFK79029.1 | cytochrome P450 CYP716A41 [Bupleurum chinense] SEQ ID No 89: MMMYLYFSVISILVLLPCVWLFFLHSNRKSTQQSYKSLPPGETGYFLIGESLEFLSTGRK GHPEKFIFD RMTKYASKIFKSSLFGEKTIVFCGAANNKFLFSDENKLVQSWWPNSVNKLFPSSTQTSSK EEAIKMRK MLPNFFKPEALQRYVGVMDEIAQKHFDSCWENKHTVIVAPLTKRFTFWLACRLFVSLEDP TQVAKFAE PFNLLASGVFSIPIDLPGTAFNRAIKASNFIRKTLIGIIKKRKVDLEDGTASATQDILSH MLLTSDETGKFM TEADIADKILGLLIGGHDTASSACALIVKYLAELPHIYDGVYREQMEIAKSKSPGELLNW DDVQKMKYS WNVACEVLRLAPPLQGSFREVLSDFMHNGFSIPKGWKIYWSANSTHKSSEYFPEPEKFDP RRFEGS GPAPYTFVPFGGGPRMCPGKEYGRLEILVFMHHLVKRFRWQKIYPLEKITVNPMPFPDKD LPIRLFPH KA

>gi|449442637|ref|XP_004139087.11 : cytochrome P450 716B1-like [Cucumis sativus] SEQ ID No 90: MELFLISLLILLFFFLSLTLFILFHNHKSLFSYPNTPPGAIGLPILGESVEFLSSGWKGH PEKFIFDRLNKY KSDVFKTSIVGVPAAIFCGPICNKFLFSNENKLVTPWWPDSVNKIFPSTTQTSTKEEAKK LKKLLPQFLK PEALQRYIGIMDELAERHFNSFWKNREEVLVFPLAKSFTFSIACRLFMSVEDEIHVERLS GPFEHIAAGII SMPIDLPGTPFNRAIKASKFIRKEVVAIVRQRKQDLAEGKALATQDILSHMLLTCDENGV YMNESDITDK ILGLLIGGHDTASVACTFIVKFLAELPHIYDAVYTEQMEIARAKAEGETLKWEDIKKMKY SWNVACEVLR IASPLQGAFREALSDFVFNGFFIPKGWKLYWSANSTHKNPEYFPEPYKFDPGRFEGNGPL PYTFVPF GGGPRMCPGKEYAKLEILVFMHNLVKRFKWTKLLENENIIVNPMPIPQKGLPVRLFPHQP LSL

>gi|332071098|gb|AED99868.1 | cytochrome P450 [Panax notoginseng] SEQ ID No 91 :

MELFYVPLLSLFVLFISLSFHFLFYKSKSSSSVGLPLPPGKTGWPIIGESYEFLSTG WKGYPEKFIFDRM TKYSSNVFKTSIFGEPAAVFCGAXCNKFLFSNENKLVQAWWPDSVNKVFPSSTQTSSKEE AIKMRKM LPNFFKPEALQRYIGLMDQIAAKHFESGWENKDEVVVFPLAKSYTFWIACKVFVSVEEPA QVAELLEP FSAIASGIISVPIDLPGTPFNSAIKSSKIVRRKLVGIINQRKIDLGEGKASPTQDILSHM LLTSDESGKFMG EGEIADKILGLLIGGHDTASSACTFVVKFLAELPQIYXGVYQEQMEIVKSKKAGELLKWE DIQKMKYSW NVACEVLRLAPPLQGAFREALSDFTYNGFSIPKGWKLYWSANSTHRNSEVFPEPLKFDPS RFDGAGP PPFSFVPFGGGPRMCPGKEYARLEILVFMHHLVKRFKWEKVIPDEKIWNPMPIPANGLPV RLFPHKA

>gi|397741002|gb|AFO63032.1 | cytochrome P450 CYP716A52v2 [Panax ginseng] SEQ ID No 92: MELFYVPLLSLFVLFISLSFHFLFYKSKPSSSGGFPLPPGKTGWPIIGESYEFLSTGWKG YPEKFIFDRM TKYSSNVFKTSIFGEPAAVFCGAACNKFLFSNENKLVQAWWPDSVNKVFPSSTQTSSKEE AIKMRKM LPNFFKPEALQRYIGLMDQIAANHFESGWENKNEVVVFPLAKSYTFWIACKVFVSVEEPA QVAELLEP FSAIASGIISVPIDLPGTPFNSAIKSSKIVRRKLVGIIKQRKIDLGEGKASATQDILSHM LLTSDESGKFMG EGDIADKILGLLIGGHDTASSACTFVVKFLAELPQIYEGVYQEQMEIVKSKKAGELLKWE DIQKMKYSW NVACEVLRLAPPLQGAFREALSDFTYNGFSIPKGWKLYWSANSTHINSEVFPEPLKFDPS RFDGAGPP PFSFVPFGGGPRMCPGKEYARLEILVFMHHLVKRFKWEKVIPDEKIWNPMPIPANGLPVR LFPHKA

>gi 1255563874 |ref|XP_002522937.11 cytochrome P450, putative [Ricinus communis] SEQ ID No 93: MDHFYLTLLFLFVSFITFSIFIIFYKHKSQYNYPSLPPGKPGLPFVGESLEFLSSGWKGH PEKFVFDRTS KYSSEIFKTNLLGQPAAVFCGASANKFLFSNENKLVQAWWPDSVNKIFPSSLQTSSKEEA IKMRKLLP QFMKPEALQRYIGIMDTIAQRHFASGWEKKNEWVFPLAKNYTFWLACRLFVSLEDPDHIA KFADPFQ ELASGIISVPIDLPGTPFRRAIKASNFIRKELISIIKQRKIDLAEGKASGTQDILSHMLL TSDEDGKFMNEM DIADKILGLLIGGHDTASAACTFIIKYLAELPQIYDAVYKEQMEIAKSKGEGELLNWEDI QKMKYSWNVA CEVMRVAPPLQGAFREAINDFIFNGFYIPKGWKLYWSANSTHKSATYFEEPEKFDPSRFE GKGPAPYT FVPFGGGPRMCPGKEYARLEILVFMHNLVKRFNFQKIIPDENIIVNPLPIPAKGLPVRLL PHQI

>gi| 147784145|emb|CAN72302.1 | hypothetical protein VITISV_041935 [Vitis vinifera] SEQ ID No 94: MEVFFLSLLLICVLSVSIRLYLLLYKHRSHFTGPNLPPGKIGWPMVGESLEFLSTGWKGH PEKFIFDRIS KYSSEVFKTSLLGEPAAVFAGAAGNKFLFSNENKLVHAWWPSSVDKVFPSSTQTSSKEEA KKMRKLL PQFLKPEALQRYTGIMDHIAQRHFADSWDNRDEVIVFPLAKRFTFWLACRLFMSIEDPAH VAKFEKPF HVLASGLITIPIDLPGTPFHRAIKASNFIRKELRAIIKQRKIDLAESKASKTQDILSHML LATDEDGCHMNE MXIADKILGLLIGGHDTASSAITFLVKYMAELPHIYEKVYKEQMEIANSKAPGELLNWDD VQKMRYSWN VACEVMRLAPPLQGAFREAITDFVFNGFSIPKGWKLYWSANSTHKSLECFPQPEKFDPTR FEGAGPA PYTFVPFGGGPRMCPGKEYARLEILIFMHNLVKRFKWDKLLPDEKIIVDPMPMPAKGLPV RLHPHKP

>gi|225460666|ref|XP_002266024.1 | : beta-amyrin 28-oxidase [Vitis vinifera] SEQ ID No 95:

MEVFFLSLLLICVLSVSIGLQFLFYKHRSHFTGPNLPPGRIGWPMVGESLEFLSTGW KGHPEKFIFDRIS KYSSEVFKTSLLGEPAAVFAGAAGNKFLFSNENKLVHAWWPSSVDKVFPSSTQTSSKEEA KKMRKLL PRFLKPEALQRYIGIMDHIAQRHFADSWDNRDEVIVFPLSKRFTFWLACRLFMSIEDPDH IAKFEKPFH VLASGLITVPIDLPGTPFHRAIKASNFIRKELRAIIKQRKIDLAEGKASPTQDILSDLLL ATDEDGRHMNEI NIADKILGLLIGGHDTASSAITFIVKYMAELPHMYEKVYEEQMEIANSKAPGELLNWDDV QKMRYSWNV ACEVMRLAPPLQGAFREAITDFVFNGFSIPKGWKLYWSTSSTHKSPKCFPEPEKFDPTRF EGAGPAP YTFVPFGGGPRMCPGKEYARLEILVFMHNVVKRFKWDKLLPDEKIIIDPMRMPAKGLPVR LRLHKP

>gi 1255574173 |ref|XP_002528002.11 cytochrome P450, putative [Ricinus communis] SEQ ID No 96: MFPFAVLLIALSISYLIFKHKSNASSRKNLPPGNTGWPLIGESIEFLSTGRKGHPEKFIF DRMEKFSSKVF KTSLLLEPAAVFCGAAGNKFLFSNENKLVTAWWPNSVNKIFPSSLQTSSQEESKRMRKLL PQFLKPEA LQRYISIMDVIAQRHFAFGWNNKQQVTVFPLAKMYTFWLACRLFLSMEDREEVEKFAKPF DVLASGIIS IPIDFPGTPFNRGIKASNEVRRELIKMIEQRKIDLAENKASPTQDILSHMLTTADEYMNE MDIADKILGLLI GGHDTASAAITFVVKYLAEMPQVYNKVLEEQMEIAKAKAAGELLNWEDIQKMRYSWNVAC EVMRLAP

PLQGAFREAMTDFTYAGFTIPKGWKLYWGANSTHRNPECFPEPEKFDPSRFEGKGPA PYTFVPFGG

GPRMCPGKEYARLEILVFMHNIVKKFRWEKLLPEEKIIVDPLPIPAKGLPLRLHPHT S

>gi|356523805|ref|XP_003530525.1 | : cytochrome P450 716B2 [Glycine max] SEQ ID No 97:

MEDNNLHLSLLLLFVSIVTLSLFVLFYKHRSAFAAPNLPPGATGYPVIGESLEFLST GWKGHPEKFIFDR MIRYSSQLFKTSILGEPAVIFCGATCNKFLFSNENKLVAAWWPNSVNKVFPTTLLSNSKQ ESKKMRKLL PQFLKPEALQRYVGIMDTIARNHFASLWDNKTELTVYPLAKRYTFLLACRLFMSIEDVNH VAKFENPFH LLASGIISVPIDLPGTPFNKAIKAANAIRKELLKIIRQRKVDLAEGKASPTQDILSHMLL TCDEKGQFMNEL DIADKILGLLIGGHDTASAAITFIVKYLAELPHIYDRVYQEQMEIAKLKSPGELLNWDDV NRMQYSWNVA CEVMRIAPPLQGGFREAINDFIFDGFSIPKGWKLYWSANSTHKSPEYFPEPEKFDPTRFE GQGPAPYT FVPFGGGPRMCPGKEYARLEILVFMHNLVKRFKWQKLIPDEKIIVDPLPIPAKNLPIRLH PHKP

>gi|255641079|gb|ACU20818.11 unknown, partial [Glycine max] SEQ ID No 98:

MEDNNLHLSLLLLFVSIVTLSLFVLFYKHRSAFAAPNLPPGATGYPVIGESLEFLSTGWK GHPEKFIFDR MIRYSSQLFKTSILGEPAVIFCGATCNKFLFSNENKLVAAWWPNSVNKVFPTTLLSNSKQ ESKKMRKLL PQFLKPEALQRYVGIMDTIARNHFASLWDNKTELTVYPLAKRYTFLLACRLFMSIEDVNH VAKFENPFH LLASGIISVPIDLPGTPFNKAIKAANAIRKELLKIIRQRKVDLAEGKASPTQDILSHMLL TCDEKGQFMNEL DIADKILGLLIGGHDTASAAITFIVKYLAELPHIYDRVYQEQMEIAKLKSPGELLNWDDV NRMQYSWNVA CEVMRIAPPLQGGFREAINDFIFDGFSIPKGWKLYWSANSTHKSPEYFPEPEKFDPTRFE GQGPAPYT FVPFGGGPRMCPGKEYARLEILVFMYN

>gi|225429866|ref|XP_002280969.11 : beta-amyrin 28-oxidase [Vitis vinifera] SEQ ID No 99:

MELSLLHILPWATLFTTLSLSFLIYKLMIISHGTPRNLPSGNTGLPYIGESIQFLSNGRK GHPEKFISERM LKFSSKVFKTSLFGETAAVFCGSAGNKFLFSNENKLVTAWWPSSVNKIFPSSLQTSSQEE SKKMRKLL PGFLKPEALQRYISIMDVIAQRHFESSWNNKEEVTVFPLAKMFTFWLACRLFLSVEDPDH VEKLAEPF NELAAGIIALPIDLPGTSFNKGIKASNLVRKELHAIIKKRKMNLADNKASTTQDILSHML LTCDENGEYMN EEDIADKILGLLVGGHDTASATITFIVKFLAELPHVYDEVFKEQMEIAKSKAPGELLNWE DIPKMRYSWN VACEVMRLAPPVQGAFREAMNDFIFEGFSIPKGWKLYWSTHSTHRNPEFFPKPEKFDPSR FDGKGPA PYTYVPFGGGPRMCPGKEYARLEVLVFMHNLVRRFKWEKLLPDEKIIVDPMPIPAKGLPI RLHHHQP

>gi|224090683|ref|XP_002309057.1 | hypothetical protein POPTR_0006s08560g [Populus trichocarpa] SEQ ID No 100:

MELPFISLLPYGILFIISAVSLSYLINKHKYYLSSLNNLPPGNTGLPLIGESLEFLT TGQKGQPEKFILDRM AKFSSKVFKTSLFCEPTAVFCGAAGNKFLFSNENKLVTAWWPDSVNKIFPSSQQTSSQEE SKKMRKL FPLFFKPESLQRYISVMDVIAQRHLASDWEGKQEVSVFPLAKTYTFWLACRLFLSMEDPE EVQKFAKP FNDLAAGIISIPIDLPWTPFNRGVKASNVVHKELLKIIKQRKIDLAENKASPTQDILSHM LTTADDNGQCM KKIDIADKILGLLVGGHDTASAAITFIVKYLAELPHVYNKLLEEQREIAKTKTPGELLNW EDIQRMRYSW NVACEVMRVAPPLQGAFREAMTEFNYAGFTIPKGWKLYWSANTTHKNPECFPEPENFDPS RFEGNG PAPYTFVPFGGGPRMCPGKEYARLEILVFLHNLVKKFRWEKLLPKERIIVDPMPIPSKGL PIRLHPHEAA

>gi|217072174|gb|ACJ84447.11 unknown [Medicago truncatula] SEQ ID No 101 :

MEPNFYLSLLLLFVTFISLSLFFIFYKQKSPLNLPPGKMGYPIIGESLEFLSTGWKG HPEKFIFDRMRKYS SELFKTSIVGESTVVCCGAASNKFLFSNENKLVTAWWPDSVNKIFPTTSLDSNLKEESIK MRKLLPQFF KPEALQRYVGVMDVIAQRHFVTHWDNKNETTVYPLAKRYTFLLACRLFMSVEDENHVAKF SDPFQLIA AGIISLPIDLPGTPFNKAIKASNFIRKELIKIIKQRRVDLAEGTASPTQDILSHMLLTSD ENGKSMNELNIAD KILGLLTGGHDTASVACTFLVKYLGELPHIYDKVYQEQMEIAKSKPAGELLNWDDLKKMK YSWNVACE VMRLSPPLQGGFREAITDFMFNGFSIPKGWKLYWSANSTHKNAECFPMPEKFDPTRFEGN GPAPYTF VPFGGGPRMCPGKEYARLEILVFMHNLAKRFKWEKVIPDEKIIVDPFPIPAKDLPIRLYP HKA

>gi 12555442421 ref|XP_002513183.11 cytochrome P450, putative [Ricinus communis] SEQ ID No 102: MELFFLIALTLFIILVTLPILAVLYRPNIINLPPGKTGLPYIGESLEFLSTGRKGHPEKF LSDRMEKFSRQVF RTSILGEQTAVVCGAQGNKFLFSNENKLVTAWWPKSILRLFPSSNQSTILAEGMRMRKML PHFLKPEA LQRYIGVMDHMAQVHFQDSWENKQEVTVYPLAKMYTFSVACKVFLSMDDPKEVAKFAAPF NDMASG IISIPINFPGTSFNRGLKASKIIRNEMLRMIKQRRKDLAENKATPMQDILSHMLVATDEE GQRLGEVGIAD KIISLLIGGHDTASATITFVVKFLAELPDIYDQVLKEQLEIAKSKEPGELLTWEDIQKMK YSWNVACEVM RLAPPLQGSFREALHDFDYAGFSIPKGWKLYWSTHTTHKNPEYFSDPEKFDPSRFEGSGP APYTFVP FGGGPRMCPGKEYARLEILVFMHNIAKRFKWNKVIPDEKIVVDPMPIPAKGLPVHLYPQK HE

>gi|731408064|ref|XP_002264643.3| : beta-amyrin 28-oxidase-like [Vitis vinifera] SEQ ID No 103: MVSFDLLYSNLIFCLLFSAIASIQMIMQQSDMELLLLSFLLLMALSLSFWIRFFVHKLEK SSGINLPPGKM GFPFIGESLEFLRMGRKGTPERFIQDRMAKYSTQIFKTCLLGEPTAVVCGAAGNKLLFSN ENKLVTSW WPRSVEKIFPSSLQTSTKEESMKTRKLLPAFLKPEALQKYVGIMDSIAKWHLDNHWDLNE TVTVFPLA KQYTFMVACRLFLSIDDPKHIAKFANPFHILAAGVMSIPINFPGTPFNRAIKAADSVRKE LRAIIKQRKIQV LAGKSSSSKHDILSHMLTTTDENGQFLNEMDIADKILGLLIGGHDTASAVITFIIKYLAE LPQVYNEVLKE QMEVAAGKKSGEMLDWEDIQKMKYSWNVANEVMRLAPPLQGSFREAITDFTYAGFSIPKG WKLYWS TNATHKNPDYFPDPEKFDPSRFEGNGPIPYTYVPFGGGPRMCPGKEYARLEILVFIHNVV RRFSWYKL HPNEDVIVDPMPMPAKGLPIRLRHH

>gi|224142653|ref|XP_002324669.1 | hypothetical protein POPTR_0018s 13390g [Populus trichocarpa] SEQ ID No 104:

METLYFILLLFVPIILSLVAIIYKHRYQDKLQNVPPGNLGLPFVGESLDFLSKGWKGCPE NFIFDRIRKYS SEIFKTNLFLQPVVMLNGVAGNKFLFSNENRLVETWWPDFVNRIFPSAVETSPKEEAKRM RRLFPRFL KPEALQRYIGTMDMVTKRHFALEWGNKAEVVVFPLAKSYTFELACRLFLSIEDPSHIARF SHPFNQITS GIFTIPIDFPGTPFNRAIKASKLIRIELLAIIRQRKKDLAEGKASPTQDILSHMLLSNDA DGKYMNEVQISD KILALLMGGHESTAASCTFIVKYLAELPHIYEAVYKEQAEIIKSKAPGELLNWDDIQKMK YSWNVACETL RLSPPLIGNFKEAIKDFTFNGFSIPKGWKASHFLTLYWSASSTHKNPEYFSEPEKFDPSR FEGKGPAP YTFIPFGGGPRMCPGNEYARLEILVFMHNLVKRFKFERLILDEKIVFDPTPKPEMGLPVR LLPHKA

>gi|356526487|ref|XP_003531849.11 : cytochrome P450 716B2 isoform X1 [Glycine max] SEQ ID No 105:

MEQLYYLTLVLLFVSFVSVSFFIIFYRHRSPFSVPNLPPGKAGFPVIGESLEFLSAGRKG LPEKFFSDRM TEYSSKVFKTSILGEPTVIFCGAACNKFLFSNENKHVISWWPENVKKLFPTNIQTNSKEE AKKLRNILPQ FLSAKAIQRYVGIMDTVAQRHFALEWENNTQVTVLPLAKRYTFGVASRVFMSIDDLNQVA KLAEPLNQ VNAGIISMPINFPGTVFNRGIKASKFIRRELLRIVKQRKVELANGMSTPTQDILSHMLIY CDENGQYLAE HDIVNKILGLLIGSHETTSTVCTFVVKYLAELPQNIYENVYQEQMAIAKSKAPGELLNWD DIQKMKYSW NVACEVIRLNPPAQGAFREAI NDFIFDGFSIPKGWKLYWSANSTHKNPEYFPEPEKFDPSRFEGTGPA PYTYVPFGGGPSMCPGKEYARMELLVFMHNLVKRFKCETLFPNGNVTYNPTPIPAKGLPV RLIPHR

Die Erfindung umfasst daher die Anwendung von Nukleinsäuresequenzen, sowie Hefestämme, die solche Sequenzen umfassen, welche für Proteine kodieren, wobei die Proteine eine ausreichende Sequenzidentität zu den oben genannten Sequenzen (SEQ ID No 54 bis 105) aufweisen, um zu einer solchen funktionsanalog zu sein. Dabei ist eine Sequenzidentität von mindestens 70%, bevorzugt 75% oder 80%, besonders bevorzugt 85%, 90% oder 95%

Sequenzidentität vorteilhaft. Im Sinne der Erfindung heißt, um zu den genannten

Aminosäuresequenzen funktionsanalog zu sein, dass die Sequenzvariante effektiv die gewünschte Produktion von den pentazyklischen Triterpenoiden in den gleichen oder ähnlichen Mengen hervorrufen kann. Funktionsanaloge Sequenzen im Sinne der Erfindung sind alle Sequenzen, die der Fachmann durch Routineversuche als gleichwirkend identifizieren kann. Die Sequenzidentität zwischen zwei Sequenzen kann durch übliche Methoden analysiert werden, z. B. mit NCBI Blast oder Clustal.

Beispiele

Im Folgenden soll die Erfindung anhand von einigen Beispielen und Figuren erläutert werden, ohne dabei jedoch auf diese beschränkt zu sein.

In Figur 1 zeigt die Biosynthese von Triterpenoiden in S. cerevisiae. Enzyme wurden bereits in Hefe exprimiert und Verbindungen detektiert (Moses et al., 2013.). Die Abbildung zeigt eine Übersicht über den Prä- und Postsqualenbiosyntheseweg sowie die Erweiterung des

Stoffwechselweges zur Etablierung der Synthese von pentazyklischen Triterpenoiden in der Hefe Saccharomyces cerevisiae am Beispiel der Betuli nsäure dargestellt. Der Abbildung ist zu entnehmen, dass für die Synthese von pentazyklischen Triterpenoiden 1 , 2 oder 3 Gene in den Stoffwechsel der Hefe etabliert wurden. Die entsprechenden Enzyme werden als Oxidosqualenzyklase (OSC), NADPH-Cytochrom P450 Reduktase (CPR) und Cytochrom P450 Monooxygenase (CYP) bezeichnet. In einem 1 . Schritt wird 2,3-Oxidosqualen mittels einer multi- beziehungsweise monofunktionalen OSC zyklisiert. In einem 2. Schritt wird das Zwischenprodukt mittels einer CYP und CPR 3fach-oxidiert, um zum Endprodukt zu gelangen.

Figur 2 zeigt den Prä- und Postsqualenbiosyntheseweg in der Hefe S. cerevisiae sowie die Erweiterung des Stoffwechselweges zur Etablierung der Synthese von pentazyklischen

Triterpenoiden am Beispiel der Betuli nsäure. Die zu exprimierenden heterologen Gene für die Synthese sind in der Abbildung rot dargestellt und werden als Oxidosqualenzyklase (OSC), NADPH-Cytochrom P450 Reduktase (CPR) und Cytochrom P450 Monooxygenase (CYP) bezeichnet.

Um hohe Umsatzraten der heterologen Gene beziehungsweise der gebildeten Enzyme und somit auch hohe Titer an pentazyklischen Triterpenoiden zu gewährleisten, wurden mehrerer Gene für jede heterologe Enzymreaktion in verschiedenen Kombinationen zur Ermittlung der optimalen Gene und Kombination derselben mit hoher Produktivität getestet.

Die zyklischen Triterpenoide wurden aus Hefe extrahiert und mittels GC-MS untersucht.

Stammkonstruktion

Die Konstruktion der Stämme basiert auf dem Stamm CEN.PK1 1 1-61 A (MATalpha; ura3-52; Ieu2-3_1 12; TRP1 ; his3delta1 ; MAL2-8C; SUC2) sowie auf dem Stamm AH22tH3ura8

(Polakowski et al., 1998).

Tabelle 4: Übersicht der verwendeten Plasmide für die Stammkonstruktion

pTT2-LjCP l-Bl LEU2 LjCPRl (Lj) Predicted: XM_004139039 cytochrome P450

716Bl-like (Cs)

PTT2-ATR1-AL1 LEU2 - ATR1 (At) CYP716AL1 (Cr) JN565975 pTT2-ATRl-A15 LEU2 - ATR1 (At) CYP716A15 (Vv) AB619802 pTT2-ATRl-A17 LEU2 - ATR1 (At) CYP716A17 (Vv) AB619803 pTT2-ATRl-A9 LEU2 - ATR1 (At) CYP716A9 (Pt) XM_002331391 pTT2-ATRl-B2 LEU2 ATR1 (At) Predicted: XM_003525274

Cytochrome

P450 716B2-Iike

(LOC100801007)

(Gm)

pTT2-CrCPR-ALl LEU2 - CrCPR (Cr) CYP716AL1 (Cr) JN565975 pTT2-CrCPR-A15 LEU2 - CrCPR (Cr) CYP716A15 (Vv) AB619802 pTT2-CrCPR-A17 LEU2 - CrCPR (Cr) CYP716A17 (Vv) AB619803 pTT2-CrCPR-A9 LEU2 - CrCPR (Cr) CYP716A9 (Pt) XM_002331391 pTT2-CrCPR-B2 LEU2 CrCPR (Cr) Predicted: XM_003525274

Cytochrome

P450 716B2-Iike

(LOC100801007)

(Gm)

pTT2-MTR-A15 LEU2 - MTR_3gl00160 (Mt) CYP716A15 (Vv) AB619802 pTT2-MTR-A17 LEU2 - MTR_3gl00160 (Mt) CYP716A17 (Vv) AB619803 pTT2-MTR-A9 LEU2 - MTR_3gl00160 (Mt) CYP716A9 (Pt) XM_002331391 pTT2-MTR-B2 LEU2 MTR_3gl00160 (Mt) Predicted: XM_003525274

Cytochrome

P450 716B2-Iike

(LOC100801007)

(Gm)

pTT2-MTR-A12 LEU2 - MTR_3gl00160 (Mt) CYP716A12 (Mt) DQ335781 pTT2-NCPl-A15 LEU2 - NCP1 (Sc) CYP716A15 (Vv) AB619802 pTT2-NCPl-A17 LEU2 - NCP1 (Sc) CYP716A17 (Vv) AB619803 pTT2-NCPl-A9 LEU2 - NCP1 (Sc) CYP716A9 (Pt) XM_002331391 pTT2-NCPl-B2 LEU2 NCP1 (Sc) Predicted: XM_003525274

Cytochrome

P450 716B2-Iike

(LOC100801007)

(Gm)

Gu, Glycyrrhiza uralensis; Oe, Olea europaea; Rc Ricinus communis; Lj, Lotus japonicas; Cr, Catharanthus roseus; Vv, Vitis vinifera; Pt, Populus trichocarpa; Gm, Glycine max; Bc, Bupleurum chinense, Cs, Cucumis sativus; Mt, Medicago truncatula; At, Arabidopsis thaliana; Sc,

Saccharomyces cerevisiae

Tabelle 5: Übersicht der Basisstämme für die Stammkonstruktion

Name | Genotyp CEN.PK1 1 1-61A MATalpha; ura3-52; leu2-3 112; TRP1 ; his3delta1 ;

MAL2-8C; SUC2

CEN.PK2U CEN.PK1 1 1-61A ura3::tHMG1

AH22tH3ura8 MATa; Ieu2-3, 1 12; Acanl ; ura3::tHMG1

Beispiel 1 : Überexpression des Gens tHMG1 im Genlocus URA3

Das tHMG1-lntegrationsmodul (cADH1 r-tHMG1-TRP1t-loxP-kanMX-loxP) wurde von GeneArt synthetisiert und in einen pMK-Vektor über die Restriktionsschnittstellen Asel und Pacl kloniert. Das tHMG1-Ger\ (t = truncated, verkürzt) kodiert für eine verkürzte HMG-CoA-Reduktase, welche nur noch aus der katalytischen Untereinheit des Proteins besteht und somit nicht mehr der Feedback-Hemmung durch Sterolintermediate unterliegt. Es wurde ein pMK-Vektor mit einer Kanamycinresistenz verwendet. Für die genomische Integration wurde das tHMG1 -Modul aus dem pMK-Plasmid über PCR mit folgenden Primern amplifiziert:

U RA3_tH M G 1 _fw:

S ' ATGTCGAAAGCTACATATAAGGAACGTGCTGCTACTCATCCAGTCAGGCACCGT GTATGAA ATC

U RA3_tH M G 1 _rev:

5TTAGTTTTGCTGGCCGCATCTTCTCAAATATGCTTCCCAGGGATCTGATATCACCTAAT AAC TTC

Das 4,5 kbp-Fragment beinhaltet den KanMX-Marker (für die Resistent von Geneticin G418 bei Hefen) flankiert mit ΙοχΡ-Seiten (für die Rückgewinnung des Markers), das tHMG1-Gen unter der Kontrolle eines konstitutiven /ADH7-Promotors und TRP1 -Terminators sowie homologe

Sequenzen zum URA3 Genlocus (die ersten und letzten 40 bp zu der kodieren Region vom URA3). Der Stamm Saccharomyces cerevisiae CEN.PK1 1 1-61 A wurde für die Transformation über homologe Rekombination am Genlocus URA3 verwendet. Nach der Transformation mittels der Lithium-Acetat-Methode gemäß Gietz et al. (1992) wurde der Stamm zur Selektion auf YE- Agarplatten mit Geneticin 418 ausplattiert. Der Stamm CEN.PK2U ist damit konstruiert.

YE-Medium: 0,5% Hefeextrakt; 2% Glucose; pH 6,3. Für Agarplatten wurde 1 ,5 % Agar zum Medium hinzugegeben. Die Glucose wird als 40% Glucose-Lösung hergestellt und separat autoklaviert. Nach dem Autoklavieren werden dem Medium 25 ml Glucose-Lösung

hinzugegeben.

Beispiel 2: Expression des Gens GuLUPI für die Produktion von zyklischen Triterpenen (z.B. Lupeol)

Das Gen GuLUPI wurde von GenScript codon optimiert für die Hefe synthetisiert und in einen pUC57-Vektor über die Restriktionsschnittstelle EcoRV kloniert. Der pUC57-Vektor beinhaltet ein Ampicillin-Resistenzgen und ein origin of replication pMB1 für die Replikation in E. coli. Für die Klonierung wurde das Gen GuLUPI aus dem pUC57-Plasmid über PCR mit folgenden Primern amplifiziert:

GuLUP_Sacl_fw:

S ' GACTGACTGAGCTCAAAAATGTGGAAATTAAAAATCGGTGAAGGTGGTGC

GuLUP Notl rev: 5 ' GACTGACTGCGGCCGCCTATTAGTAAGAATGGGCGCACAAGACTTGTC Das amplifizierte Fragment hat eine Größe von 2,277 kbp.

Parallel dazu wurde eine Genkassette von GeneArt synthetisiert und in einen pMA-Vektor über die Schnittstelle Kpnl kloniert. Diese Genkassette beinhaltet eine CEN/ARS-Sequenz für eine autonome Replikation in Hefe, den URA3 Selektionsmarker für Hefe, MR-Seq Uenzen (URA3- Rückgewinnung über die Selektion auf Agarplatten mit 5-FOA) und flankierte Regionen, die homolog zum Integrations-Locus 5 ' YHRCdelta14 sind und die genomische Integration der Genkassette in den Integrations-Locus 5 ' YHRCdelta14 ermöglichen. Der pMA-Vektor beinhaltet ein Ampicillin-Resistenzgen als Selektionsmarker für E. coli und ein origin of replication Col E1 für die Replikation in E. coli.

Das amplifizierte Fragment (Gen: GuLUPI ) wurde über die Restriktionsschnittstellen Sacl und Notl in den pMA-Vektor unter der Kontrolle eines EN01 -Promotors und EN01-Terminators kloniert. Das resultierende Plasmid wird pTT1-GuLUP1 bezeichnet.

Das Plasmid wurde in kompetente E. co//-Zellen transformiert. Die Selektion erfolgte über Ampicillin-Resistenz auf LB-Agarplatten.

LB-Medium: 1 % Casein Pepton; 0,5% Hefeextrakt; 1 % NaCI; pH 7,0. Für Agarplatten wurde 1 ,5 % Agar zum Medium hinzugegeben.

Antibiotika: Ampicillin (Boehringer, Mannheim) 100 μg/ml

Der Stamm Saccharomyces cerevisiae CEN.PK2U aus Beispiel 1 und der Stamm AH22tH3ura8 wurden für die episomale Transformation verwendet. Nach der Transformation mittels der Lithium-Acetat-Methode gemäß Gietz et al. (1992) wurden die Stämme zur Selektion auf WMVIII- Agarplatten ohne Uracil ausplattiert.

Beispiel 3: Kultivierunqsbedinqunqen für die Evaluierung der Stämme

Standardkultivierung der Hefe S. cerevisiae

1. Vorkultur: 20 ml WMVIII Medium: (Lang und Looman, 1995) in einem 100 ml

Erlenmeyerkolben wurden 0,1 % (v:v) aus einem Glycerolstock angeimpft. Die Hefen wurden bei 28°C und 150 rpm 72 h auf einem Rundschüttler angezogen.

2. Hauptkultur: 50ml WMVIII Medium in einem 250 ml Schikanekolben wurden aus der Vorkultur auf einen Start-Wert von OD600 = 0,5 angeimpft. Die Hefen wurden bei 28°C und 150 rpm 72 h auf einem Rundschüttler angezogen.

Stämme mit dem genetischen Hintergrund von CEN.PK1 1 1-61 A und CEN.PK2U sind auxotroph für Uracil, Histidin und Leucin. Daher wurde das Medium mit Uracil (100 mg/l), Histidin (100 mg/l) und mit Leucin (400 mg/l) supplementiert. Um einen Selektionsdruck auf ein transformiertes Plasmid auszuüben, wurde das entsprechende Supplement im Medium ausgelassen.

Stämme mit dem genetischen Hintergrund von AH22tH3ura8 sind auxotroph für Uracil und Leucin. Daher wurde das Medium mit Uracil (100 mg/l) und mit Leucin (400 mg/l) supplementiert. Um einen Selektionsdruck auf ein transformiertes Plasmid auszuüben, wurde das entsprechende Supplement im Medium ausgelassen. Bestandteile von WMVIII Medium für 1 Liter gemäß Lang und Looman, 1995: 250 mg

NH 4 H 2 P0 4 ; 2,8 g NH 4 CI; 250 mg MgCI 2 x 6H 2 0; 100 mg CaCI 2 x 2H 2 0; 2 g KH 2 P0 4 ; 550 mg MgS0 4 x 7H 2 0; 75 mg meso-lnositol; 10 g Na-Glutamat mit folgender Änderung: 50 g Glucose statt Saccharose werden als 40% Glucose-Lösung hergestellt und separat autoklaviert.

Nach dem Autoklavieren werden dem Medium 125 ml Glucose-Lösung, 1 ml steril filtrierte Spurenelemente und 4 ml steril filtrierte Vitamine hinzugegeben.

Spurenelemente: 1000x konzentriert: 1 ,75 g ZnS0 4 x 7H 2 0; 0,5 g FeS0 4 x 7 H 2 0; 0,1 g CuS0 4 x 5 H 2 0; 0,1 g MnCI 2 x 4 H 2 0; 0,1 g NaMo0 4 x 2 H 2 0 für 1 einen Liter.

Vitaminlösung: 250x konzentriert: 2,5 g Nicotinsäure; 6,25 g Pyridoxin; 2,5 g Thiamin; 0,625 g Biotin; 12,5 g Ca-Pantothenat für 1 Liter.

Für Agarplatten wurde 1 ,5 % Agar zum Medium hinzugegeben.

Mediensupplemente: Leucin (400 mg/l); Histidin (100 mg/l); Uracil (100 mg/l) Die Stocklösungen werden mit einer Konzentration von 20 mg/ml hergestellt und steril filtriert.

Beispiel 4: Wachstums- und Produktivitätsanalvse (Identifizierung und Quantifizierung von zyklischen Triterpenen)

Die Kultivierung wird gemäß Beispiel 3 durchgeführt.

Bestimmung der Biotrockensubstanz (BTS)

Zur Bestimmung der Biotrockensubstanz wurden 2 mal 2 ml Kulturvolumen in vorher konditionierte und ausgewogene 2 ml Reaktionsgefäße überführt. Die Zellen wurden bei 18620 x g für 5 min abzentrifugiert und mit 1 ml Wasser gewaschen. Anschließend wurde das Zellpellet in einem Trockenschrank für 24 Stunden bei 80°C getrocknet. Die Proben kühlten im Exsikkator für 30 min. ab, bevor die Wägung erfolgte.

P ro benvo rbereit u ng

a) Hefestämme transformiert mit den Genen für eine OSC, CPR und CYP auf einem pTT1- und pTT2-Plasmid:

In ein 2 ml Reaktionsgefäß werden in einer Doppelbestimmung 800 μΙ Kulturbrühe einer Hauptkultur überführt. Es kann direkt mit der Extraktion fortgefahren werden oder die Proben können auch bei -20 °C eingefroren und zu einem späteren Zeitpunkt extrahiert werden. b) Hefestämme transformiert mit dem Gen für eine OSC auf einem pTT1-Plasmid:

In ein 1 ,5 ml Reaktionsgefäß werden in einer Doppelbestimmung 250 μΙ Kulturbrühe einer

Hauptkultur überführt. Es kann direkt mit der Extraktion fortgefahren werden oder die Proben können auch bei -20 °C eingefroren und zu einem späteren Zeitpunkt extrahiert werden.

Extraktion

Hefestämme transformiert mit den Genen für eine OSC, CPR und CYP auf einem pTT1- und pTT2-Plasmid Das Extraktionsmittel Chloroform/Methanol (4+1 ) wird mit Stigmasterol zu einer Konzentration von 50 μg/ml versetzt. Im ersten Schritt werden 800 μΙ Kulturbrühe mit 80 μΙ 1 M HCl, 250 μΙ Glas- Beads (0,4-0,6 mm) und 800 μΙ Extraktionsmittel versetzt und anschließend 20 min lang im TissueLyser II bei 30Hz geschüttelt. Nach anschließender Zentrifugation von 5 min. bei 18 000 x g wird die organische Phase in ein neues 1 ,5 ml-Reaktionsgefäß überführt. Die abgenommene organische Phase wird unter Vakuum eingedampft (SpeedVac; 35 °C; 0,1 mbar; 30 min). Die eingedampften Proben werden in 100 μΙ N-Methyl-N-trimethylsilyltrifluoracetamid (MSTFA, Sigma) gelöst und in mit Glaseinsätzen versehene braune GC-Vials überführt. Die Proben werden 1 h bei 80°C derivatisiert. Die fertigen Proben und somit die Identifizierung und die Quantifizierung von zyklischen Triterpenen wurden mittels GC-MS durchgeführt.

Hefestämme transformiert mit dem Gen für eine OSC auf einem pTT1 -Plasmid

Das Extraktionsmittel Chloroform/Methanol (4+1 ) wird mit Stigmasterol zu einer Konzentration von 50 μg/ml versetzt. Im ersten Schritt werden250 μΙ Kulturbrühe mit 25 μΙ 1 M HCl, 250 μΙ Glas- Beads und 400 μΙ Extraktionsmittel versetzt und anschließend 20 min lang im TissueLyser I I bei 30Hz geschüttelt. Nach anschließender Zentrifugation von 5 min. bei 18 000 x g werden 250μΙ organische Phase in ein neues 1 ,5 ml-Reaktionsgefäß überführt. Die abgenommene organische Phase wird unter Vakuum eingedampft (SpeedVac; 35 °C; 0,1 mbar; 30 min). Die eingedampften Proben werden in 250 μΙ Chloroform gelöst und 100 μΙ werden in mit Glaseinsätzen versehene braune GC-Vials überführt. Die fertigen Proben und somit die Identifizierung und die

Quantifizierung von zyklischen Triterpenen wurden mittels GC-MS durchgeführt.

Herstellung der externen Standards (ESTD)

Zur quantitativen Bestimmung von pentazyklischen Triterpenen wie z.B. Lupeol und Betulinsäure durch Gaschromatographie wird eine Verdünnungsreihe mit den jeweiligen Substanzen hergestellt. Die ESTDs enthalten zusätzlich, ebenso wie die Proben, als internen Standard Stigmasterol in einer Konzentration von 50 μg/ml. Die ESTDs werden in Chloroform hergestellt. Die ESTDs werden analog zu den Proben in einem braunen GC-Vial mit MSTFA 1 h bei 80°C derivatisiert oder underivatisiert mittels GC-MS vermessen.

Bedingungen für die Gaschromatographie (GC)

Die GC-Analytik wurde mit einem Agilent 6890N Gaschromatographen (Agilent, Waldbronn), ausgestattet mit einem Autosampier Agilent 7683B, durchgeführt. Als Detektor wurde ein Agilent 5975 VL Massenspektrometer verwendet. Es wurden folgende Bedingungen gewählt: Als Säule diente eine 30m lange HP-5MS Säule (Agilent) mit einem Innendurchmesser von 0,25 mm und einer Filmdicke von 0,25μιη. Helium diente als mobile Phase. Das GC/MS System wurde mit einem Temperaturprogramm (150°C 0,5 min, 40°C/min bis 280°C, 2°C/min bis 310°C, 40°C/min bis 340°C, 340°C für 2,5min) im Splitless-Modus gefahren. Die Injektortemperatur betrug 280°C, die des Detektors (MS-Quadrupol) 150°C. Das Injektionsvolumen der Proben betrug 1 μΙ.

Beispiel 5: Stammabhänqiqe Ausbeute von pentazyklischen Triterpenen

Die gaschromatographische Analyse der pentazyklischen Triterpene ist in Tabelle 6 dargestellt. In den Tabellen sind die Biotrockensubstanz (BTS) sowie die volumetrische und spezifische Produktausbeute abgebildet. Die Stämme wurden wie in Beispiel 3 kultiviert. Die produzierten Mengen am Beispiel von Lupeol, Betulin, Betulinaldehyd und Betulinsaure sind stammabhängig. Mit der gleichen Genkombination verhalten sich CEN.PK-Stämme anders als AH22-Stämme.

Tabelle 6: Vergleich der Ausbeuten von zyklischen Triterpenen zwischen dem CEN.PK2U und AH22tH3ura8 transformiert mit den Plasmiden pTT1-OEW und pTT2-LjCPR1-B2

Tab.6 (fortgesetzt)

Beispiel 6: Einfluss der HMG-CoA Reduktase

In Tabelle 7 sind die Biotrockensubstanzen und die Lupeolproduktivitäten von CEN.PK1 1 1 -61 A und CEN.PK2U transformiert mit dem Plasmid pTT1-OEW sowie mit der deregulierten HMG-CoA Reduktase dargestellt. Die Stämme wurden wie in Beispiel 3 kultiviert, jedoch mit

unterschiedlichen Hauptkultivierungszeiten (48h, 72h beziehungsweise 93h). Die

Lupeolproduktivität des CEN.PK2U ist höher als von CEN.PK1 1 1-61 A. Dies zeigt, dass die Deregulation der HMG-CoA Reduktase einen positiven Einfluss auf die Produktion von

Triterpenoiden hat.

Tabelle 7: Vergleich der Produktivitäten von CEN.PK1 1 1-61A und CEN.PK2U transformiert mit dem Plasmid pTT1-OEW

Tabelle 8: Vergleich der Produktivitäten zwischen AH22th3ura8 und AH22th3ura8AarelAare2

AH22th3ura8

AarelAare2 GuLUPl - - Kl 10,43 60,96 5,84 11,90 90,37 7,59 11,82 96,74 8,1£

Beispiel 7: Ausbeuten von Lupeol, Betulin, Betulinaldehvd und Betulinsäure nach episomaler Expression verschiedener OSC-, CPR- und CYP-

Gene in verschiedenen Hefestämmen

Tabelle 9: Ausbeute in CEN.PK2U

Tabelle 10: Ausbeute in AH22th3ura8

: Konzentration unter der Nachweisgrenze

k.A.: keine Angaben

In Tabellen 9 und 10 sind die Biotrockensubstanzen (BTS) und die gebildeten Konzentrationen der Triterpenoide Lupeol, Betulin, Betulinaldehyd und Betulinsaure nach 72 h Kultivierung in WMVIll Medium dargestellt. Getestet wurde der Einfluss der Expression unterschiedlicher OSC-, CPR- und CYP- Gene in den Stämmen AH22th3ura8, CEN.PK2U und CEN.PK1 1 1-61 A, welche mit den Genen für die CPR- und CYP-Enyzyme auf dem pTT2-Plasmid und/oder mit dem Gen für das OSC-Enzym auf dem pTT1-Plasmid transformiert wurden.

In den Tabellen 1 1 , 12, 13 und 14 sind die bevorzugte Kombinationen von Genen und die jeweiligen Ausbeuten (unabhängig von Hefestamm) der pentazyklischen Triterpenoiden dargestellt.

Tabelle 1 1 : Lupeol Ausbeute

Tabelle 12: Betulin

Tabelle 13: Betulinaldehyd

Tabelle 14: Betulinsaure

Referenzen

WO 201 1/074766 A2,

WO 201 1/074766 A3R4

CN 102433347

WO2012/1 16783 A2

Cameron, S. I. and Smith, R. F., In Proceedings of the 29th Annual Meeting

of the Plant Growth Regulation Society of America (ed. Halifax, N. S.), Bringing 'Blue Sky Biology'

Down to Earth: Linking Natural Products Research with Commercialization, 2002, pp. 31-39

Chintharlapalli S, Papineni S, Lei P, Pathi S, Safe S. Betulinic acid inhibits colon cancer cell and tumor growth and induces proteasome-dependent and -independent downregulation of specificity proteins (Sp) transcription factors. BMC Cancer. 201 1 Aug 24; 1 1 :371. PubMed PMID: 21864401 ; PubMed Central PMCID: PMC3170653.

Fukushima EO, Seki H, Ohyama K, Ono E, Umemoto N, Mizutani M, Saito K, Muranaka T.

CYP716A Subfamily Members are M ultifunctional Oxidases in Triterpenoid Biosynthesis. Plant Cell Physiol. 201 1 Oct 28. [Epub ahead of print] PubMed PMID: 22039103.

Holanda Pinto SA, Pinto LM, Cunha GM, Chaves MH, Santos FA, Rao VS. Anti-inflammatory effect of alpha, beta-Amyrin, a pentacyclic triterpene from Protium heptaphyllum in rat model of acute Periodontitis. Inflammopharmacology. 2008 Feb;16(1 ):48-52. PubMed PMID: 18046512.

Huang et al. 2012, Molecular characterization of the pentacyclic triterpenoid biosynthetic pathway in Catharanthus roseu. Planta 2012, 236:1571-1581.

Kirby et al. Engineering triterpene production in Saccharomyces cerevisiae - beta-amyrin synthase from Artemisia annua. FEBS J. 275(8): 1852- 1859, 2008

Li J, Zhang Y. Increase of betulinic acid production in Saccharomyces cerevisiae by balancing fatty acids and betulinic acid forming pathway. Appl Microbiol Biotechnol. 2013

Muffler et al. Biotransformation of triterpenes. Process Biochem. 46(1 ): 1-15, 201 1

Madsen KM, Udatha GD, Semba S, Otero JM, Koetter P, Nielsen J, Ebizuka Y, Kushiro T, Panagiotou G. Linking genotype and phenotype of Saccharomyces cerevisiae strains reveals metabolic engineering targets and leads to triterpene hyper-producers. PLoS One. 201 1 Mar 18;6(3):e14763. PubMed PMID: 21445244; PubMed Central PMCID: PMC3060802.

McNeil et al. Plant shortage leaves campaigns against malaria at risk. New York Times 14 November, 2004

Melo CM, Morais TC, Tome AR, Brito GA, Chaves MH, Rao VS, Santos FA. Anti-inflammatory effect of α,β-amyrin, a triterpene from Protium heptaphyllum, on cerulein-induced acute pancreatitis in mice. Inflamm Res. 201 1 Jul;60(7):673-81. Epub 201 1 Mar 12. PubMed PMID: 214001 10.

Philips DR, Rasbery JM, Bartel B, Matsuda SPT. Biosynthetic diversity in plant triterpenes cyclization. Current Opinion in Plant Biology. 2006 Apr 3; 9:305-314.

Pisha et al. Discovery of betulinic acid as a selective inhibitor of human melanoma that functions by induction of apoptosis. Nat Med 1 (10):1046-1051 , 1995

Polakowski et al. Overexpression of a cytosolic hydroxymethylglutaryl-CoA reductase leads to squalene accumulation in yeast. Appl Microbiol Biotechnol. 49(1 ):66-71 , 1998

Raskin et al. Plants and human health in the twenty-first Century. Trends Biotechnol. 20(12):522- 531 , 2002

Ruzicka et al. Helv. Chim. Acta 21 ,1076-1078, 1938

Robinson et al. Betulinic acid from Arbutus menziesii. Phytochemistry 9(4):907-909, 1970

Saleem M, Murtaza I, Tarapore RS, Suh Y, Adhami VM, Johnson JJ, Siddiqui IA, Khan N, Asim M, Hafeez BB, Shekhani MT, Li B, Mukhtar H. Lupeol inhibits proliferation of human prostate Cancer cells by targeting beta-catenin signaling. Carcinogenesis. 2009 May;30(5):808-17. Epub 2009 Feb 20. PubMed PMID: 19233958.

Shanmugam MK, Rajendran P, Li F, Nema T, Vali S, Abbasi T, Kapoor S, Sharma A, Kumar AP, Ho PC, Hui KM, Sethi G. Ursolic acid inhibits multiple cell survival pathways leading to suppression of growth of prostate Cancer xenograft in nude mice. J Mol Med (Berl). 201 1 Jul;89(7):713-27. doi: 10.1007/sO0109-01 1-0746-2. Epub 201 1 Apr 5. PubMed PMID: 21465181.

Siddique HR, Saleem M. Beneficial health effects of lupeol triterpene: a review of preclinical studies. Life Sei. 201 1 Feb 14;88(7-8):285-93. Epub 2010 Nov 29. Review. PubMed PMID: 21 1 18697.

Sunder et al. Use of betulinic acid and its derivatives for inhibiting cancer growth and a method for monitoring this. US Patent 6,048,847, 2000

Suzuki H, Achnine L, Xu R, Matsuda SP, Dixon RA. A genomics approach to the early stages of triterpene saponin biosynthesis in Medicago truncatula. Plant J. 2002 Dec;32(6): 1033-48.

PubMed PMID: 12492844

Veen et al. Combined overexpression of genes of the ergosterol biosynthetic pathway leads to accumulation of sterols in Saccharomyces cerevisiae. FEMS Yeast Res. 4, 87-95, 2003

Wang Z, Guhling O, Yao R, Li F, Yeats TH, Rose JK, Jetter R. Two oxidosqualene cyclases responsible for biosynthesis of tomato fruit cuticular triterpenoids. Plant Physiol. 2011

Jan; 155(1 ):540-52. Epub 2010 Nov 8. PubMed PMID: 21059824; PubMed Central PMCID:

PMC3075788.