Document |
Document Title |
WO/2024/008204A1 |
Provided is the use of MmPI in the preparation of a trypsin inhibitor. The amino acid sequence of the MmPI is as shown in SEQ ID NO. 1. In the present invention, it is confirmed that MmPI in mulberry leaves has a trypsin inhibitory activ...
|
WO/2024/010093A1 |
Provided is a chamber that can improve a fibrinogen recovery rate. This chamber 22 accommodates plasma when the plasma is being frozen and thawed to prepare a fibrinogen liquid from the plasma. The chamber 22 comprises a film section 5...
|
WO/2024/003141A1 |
The present invention relates to tangential flow filtration/chromatography systems, the use thereof, and methods of separation, particularly simultaneously separating one or more target molecules from cells, cell debris and further conta...
|
WO/2024/001484A1 |
Provided is a CCK secretion-promoting peptide QGDVVALPA targeting a calcium sensing receptor. The peptide can be artificially synthesized by adopting a chemical solid-phase synthesis method and can also be obtained after enzymolysis, sep...
|
WO/2024/000089A1 |
Disclosed in the present invention are a class of highly active polypeptides, and a preparation method therefor and the use thereof. Whitening and anti-aging activity is used as guidance, pearl powder is subjected to enzymolysis and ultr...
|
WO/2024/006793A1 |
The present invention is directed at the formation of repurposed nematocysts which can then provide a transdermal or cutaneous delivery system.
|
WO/2024/000088A1 |
Disclosed in the present invention are a pearl-derived whitening polypeptide and a use thereof. The polypeptide is a polypeptide having an amino acid sequence according to any one of SEQ ID NOs. 1-5. The molecular docking result shows th...
|
WO/2024/003416A1 |
The present invention relates to a cell line wherein the endogenous class I and/or class II HLA alleles are inactivated, the cell line further comprising (a) a polynucleotide encoding a first fluorescent marker under control of at least ...
|
WO/2024/005008A1 |
The present disclosure provides a method for determining whether or not a subject is suffering from synucleinopathy on the basis of a level of ApoA1 that is bonded to α-synuclein in a sample which has been taken from the subject.
|
WO/2023/247953A1 |
Apparatus for extracting protein from potatoes, the apparatus includes a first filtration device having a filter material with a first pore size; a second filtration device having a filter material with a second pore size; a third filtra...
|
WO/2023/247798A1 |
The present invention relates to a device for continuously purifying a biotechnological product, wherein the device has a modular structure with individual modules connected to one another, wherein the modules comprise at least one tande...
|
WO/2023/245852A1 |
Provided are a CD25 targeting polypeptide, a molecular probe and use. An amino acid sequence of the polypeptide is as follows: i) X1X2X3X4X5; or ii) an amino acid sequence formed by connecting a label at an N-terminus or a C-terminus of ...
|
WO/2023/245971A1 |
Disclosed is a method for improving adhesion force of a recombinant mussel foot protein. According to the method, by means of bioinformatics and molecular dynamics simulation, solvent accessibility of protein molecule amino acid residues...
|
WO/2023/249264A1 |
A method for producing peptides and amino acids using silkworms or insects according to the present invention, which is a technology designed to produce low molecular weight peptides, liquid amino acids, or amino acid powder by hydrolyzi...
|
WO/2023/249892A1 |
A method for improving the harvest or purification of a target protein such as a biologic or biosimilar is provided. The method improves conventional harvest/purification methodologies by adding a chromatography step, such as a mixed-mod...
|
WO/2023/248105A1 |
Nature-inspired smart materials offer numerous advantages over environment- friendliness and efficiency. Emulating the excellent adhesive properties of mussels foot proteins, where the Lysine is in close proximity with the 3, 4-dihydroxy...
|
WO/2023/241391A1 |
The present invention provides a TCR molecule binding to an SSX2 antigen and an application thereof. The TCR molecule can specifically bind to an SSX2 antigen short peptide complex AQIPEIQK-HLA A1101. Meanwhile, effector cells transducin...
|
WO/2023/243136A1 |
Provided is a method for analyzing an O-linked sugar chain that has been undergone sialic acid linkage-specific modification, the method comprising: a modification step for adding a modifier, which performs sialic acid linkage-specific m...
|
WO/2023/241675A1 |
Disclosed are a polypeptide and a design method therefor, and an application thereof in preparing a drug for inhibiting a Fusobacterium nucleatum (F. Nucleatum) product or preventing colorectal cancer, relating to the field of polypeptid...
|
WO/2023/242303A1 |
The present invention relates to a sample preparation system and a method for preparing a sample using the sample preparation system.
|
WO/2023/244765A1 |
Provided herein are methods of quantifying or identifying two or more peptides or polypeptides, methods of quantifying or identifying two or more chemically isotopic labeled peptides or polypeptides, and methods for obtaining a plurality...
|
WO/2023/245105A1 |
The present disclosure provides methods and kits for purifying an antigen binding protein comprising a VL domain using a Protein L chromatography material which includes kosmotrope salts in the buffer background.
|
WO/2023/240322A1 |
The present invention pertains to the purification of soluble complement receptor proteins and variants thereof by hydrophobic interaction chromatography (HIC) using a chromatographic material with a particle size of less than 60 µm.
|
WO/2023/243720A1 |
Provided is a method for producing a silane-containing condensed ring dipeptide compound represented by formula (A). The method comprises: (i) a step for reacting a first amino acid represented by formula (R1) with a first silane compo...
|
WO/2023/240958A1 |
The present invention relates to a use of a JWA polypeptide in preparation of a drug for resisting a neovascular ocular disease. The amino acid sequence of the polypeptide is shown as I or II: I: FPGSDRF-Z; II: X-FPGSDRF-Z, wherein an am...
|
WO/2023/242412A1 |
The present invention relates to a filter system, which can be used as a clarification filter/depth filter for cell culture clarification before chromatography and/or ultrafiltration for protein purification, as well as to a method of se...
|
WO/2023/239887A1 |
Disclosed herein are compounds having adjuvant properties, vaccines including the adjuvant compounds, and their uses in the prophylaxis or therapy for respiratory virus infection.
|
WO/2023/238097A1 |
Provided herein are methods of purifying proteins of interest using continuous counter-current downstream processing. Also provided herein are methods of purifying proteins of interest using continuous counter-current affinity nanopartic...
|
WO/2023/236797A1 |
Disclosed in the present invention are a hangtaimycin derivative, a preparation method therefor, and the use thereof. The hangtaimycin derivative is prepared by performing fermentation in an SFMR culture medium by using Streptomyces spec...
|
WO/2023/239572A1 |
A new kind of test for DNA damage, termed Enhanced Specificity Mass Tag DNA Adductomics ("ESMD") that precisely and broadly defines genotoxic exposure in a practical way, comprising certain combinations of amine-targeting mass tags with ...
|
WO/2023/237690A2 |
Provided are multivalent binding proteins comprising four polypeptide chains, wherein a first heavy chain polypeptide and a first light chain polypeptide associate to form one or more antigen binding domains and a second heavy chain poly...
|
WO/2023/238132A1 |
A microfluidic device is disclosed which comprises: (i) a first surface (20) which comprises a plurality of reaction units (28), each reaction unit having a test chamber (12) connected to at least one opening (14) via a feeding capillary...
|
WO/2023/238098A1 |
Provided herein are methods of purifying proteins of interest using asymmetric dialysis.
|
WO/2023/231364A1 |
The present invention relates to the field of multi-component recombinant food. Disclosed are hemp protein Pickering particles, and a preparation method therefor and an application thereof. The Pickering particles are prepared by an anti...
|
WO/2023/231573A1 |
An isomer of a peptide derivative of formula (I), a mixture of stereoisomers thereof, or a salt thereof, or a composition thereof, and the use thereof. The isomer of the peptide derivative of formula (I) and the composition containing th...
|
WO/2023/231236A1 |
The present application discloses a passive microfluidic microreactor (10) and a microfluidic chip. The passive microfluidic microreactor (10) comprises an inlet zone (200), a transition zone (500), a mixing zone (300), and a collection ...
|
WO/2023/231969A1 |
The present invention belongs to the field of protein engineering, and relates to a hybrid peptide formed by a chymotrypsin inhibitory peptide and insulin or an analogue thereof. The heterozygous insulin analogue can resist the degradati...
|
WO/2023/234837A1 |
The present invention relates to an insoluble support comprising distal binding sites, the support comprising a homogeneous polymeric matrix and constructs, the constructs covalently bound to the polymeric matrix, wherein the constructs ...
|
WO/2023/232662A1 |
The current invention relates to an improved microfluidic device for protein/protein complex purification, as well as an associated methodology and system. In particular it relates to systems and methods for electron microscopy, preferab...
|
WO/2023/234718A1 |
The present invention relates to a membrane for biopolymer synthesis and a biopolymer synthesis method using same. This synthesis process using the membrane can synthesize various biopolymers including peptides within a short time with h...
|
WO/2023/235790A1 |
The present disclosure relates to recombinant polypeptides and uses thereof for treating, preventing, and detecting inflammatory diseases. Specifically, the disclosure provides a recombinant polypeptide comprising an IL-2 polypeptide, a ...
|
WO/2023/100158A9 |
The application relates to fluorescence-quenched substrates of Formula (I) for an acid β-glucosidase (GCase) and their use in a method for determining GCase activity in a cell or tissue, a method for localizing GCase activity within a c...
|
WO/2023/226530A1 |
A nuclide-labeled inhibitory peptide, a preparation method therefor and the use thereof. An ASF1a peptide is labeled with 68Ga/177Lu by DOTA; and the amino acid sequence of the ASF1A peptide is YGRKKRRQRRRCASTEEKWARLARRIAGAGGVTLDGFGGCA. ...
|
WO/2023/229110A1 |
A concentration filter for selectively concentrating a sample, a method for manufacturing the concentration filter, and a sample concentration device are disclosed. The selective concentration filter of the present invention comprises: a...
|
WO/2023/230213A1 |
The present application relates to keratin protein extracts, compositions, methods and uses thereof. In some embodiments, the keratin protein extract is a beta-keratin extract. In some embodiments, the compositions are beta-keratin compo...
|
WO/2023/225741A1 |
Described herein are Mincle-binding DNA aptamers and uses thereof.
|
WO/2023/228497A1 |
Provided are: a method which is for analyzing a neurogranin-related peptide and can suppress deviations in analysis results; and a method for preparing a biological sample containing the neurogranin-related peptide used for same. A metho...
|
WO/2023/223296A1 |
Disclosed herein is an improved process for preparing abaloparatide. The process generally utilizes solid phase peptide synthesis employing an Fmoc-protection scheme. Incorporating a systematic recoupling step of a glutamine residue (Gln...
|
WO/2023/221787A1 |
Disclosed are a pichia pastoris engineering strain for a recombinant type I collagen, a construction method therefor and use thereof. A gene sequence for a type I humanized collagen α1 chain mature peptide is synthesized and inserted do...
|
WO/2023/223714A1 |
Various two-residue-extended peptides can be produced by reacting a first amino acid or peptide represented by formula (1), a halogenating agent, a tertiary amine represented by formula (3), an amino acid N-carboxy anhydride (NCA) repres...
|