Login| Sign Up| Help| Contact|

Patent Searching and Data


Title:
HYDROPHILIC METAL COMPLEXES
Document Type and Number:
WIPO Patent Application WO/1996/003410
Kind Code:
A1
Abstract:
The present invention concerns novel hydrophilic metal complexes and the use thereof as luminescent marker groups in immunoassays.

Inventors:
Herrmann
Rupert, Josel
Hans-peter, Pappert
Gunter, V�gtle
Fritz, Frommberger
Bruno, Issberner
J�rg
Application Number:
PCT/EP1995/002923
Publication Date:
February 08, 1996
Filing Date:
July 24, 1995
Export Citation:
Click for automatic bibliography generation   Help
Assignee:
BOEHRINGER MANNHEIM GMBH HERRMANN
Rupert, Josel
Hans-peter, Pappert
Gunter, V�gtle
Fritz, Frommberger
Bruno, Issberner
J�rg
International Classes:
C07D213/68; C07F11/00; C07F13/00; C07F15/00; C07F19/00; C07K14/16; C07K14/18; C12Q1/68; G01N33/533; G01N33/543; G01N33/58; G01N33/68; G01N33/92; (IPC1-7): C07F15/00; C12Q1/68; G01N33/58; C07F19/00
Domestic Patent References:
WO1992014139A11992-08-20
WO1987006706A11987-11-05
WO1986002734A11986-05-09
Other References:
SEILER, M. ET AL.: "PHOTOINDUCED ELECTRON TRANSFER IN SUPRAMOLECULAR ASSEMBLIES COMPOSED OF DIALKOXYBENZENE-TETHERED RUTHENIUM(II) TRISBIPYRIDINE AND BIPYRIDINIUM SALTS", JOURNAL OF THE AMERICAN CHEMICAL SOCIETY, vol. 116, no. 8, 20 April 1994 (1994-04-20), pages 3399 - 3404
CHEMICAL ABSTRACTS, vol. 98, no. 22, 30 May 1983, Columbus, Ohio, US; abstract no. 188896x, MARKOVITSI, D. ET AL.: "ANNELIDES. VI. PHOTOCHEMICAL PROPERTIES OF MICELLAR PHASES OF METAL ION COMPLEXES" page 587;
Download PDF:
Claims:
P a t e n t a n s p r ü c h e
1. Metallkomplexe mit der allgemeinen Formel ( I ) : [M (LL2L3) ] n X. Ä ( I ) worin M ein zwei oder dreiwertiges Metallkation ausgewählt aus Seltenerde oder Übergangmetallionen ist, Llf L2 und L3 gleich oder verschieden sind und Ligan¬ den mit mindestens zwei stickstoffhaltigen Hetero¬ cyclen bedeuten, wobei L_, L2 und L3 über Stickstoff atome an das Metallkation gebunden sind, X eine reaktive oder aktivierbare funktioneile Gruppe ist, die an mindestens einen der Liganden L., L2, L3 kovalent gebunden ist, n eine ganze Zahl von 1 bis 10 ist, m eine ganze Zahl von 1 bis 6 ist und A eine oder mehrere zum Ladungsausgleich erforderli¬ che, negativ geladene Gruppen bedeutet, dadurch gekennzeichnet, daß der Komplex mindestens eine hydrophile Gruppe ausge¬ wählt aus C2C3AlkylenoxyEinheiten, C2C3Alkylenthio Einheiten, C2C3AlkylenaminoEinheiten oder/und Poly¬ hydroxyEinheiten enthält.
2. Komplex nach Anspruch 1, dadurch gekennzeichnet, daß das Metallkation M ein Ruthenium, Rhenium, Osmium, Chrom¬ oder Iridiumion ist.
3. Komplex nach Anspruch 1 oder 2, dadurch gekennzeichnet, daß das Metallkation M ein Rutheniumion ist.
4. Komplex nach einem der Ansprüche 1 bis 3, dadurch ge¬ kennzeichnet, daß die Liganden Lx, L2, L3 Bipyridin oder/und PhenanthrolinRingsysteme enthalten.
5. Komplex nach einem der Ansprüche 1 bis 4, dadurch ge¬ kennzeichnet, daß die reaktive oder aktivierbare funk tionelle Gruppe X ein Carbonsäurehalogenid, ein Carbon¬ säureanhydrid, ein Aktivester, ein Maleimid, ein Amin, eine Carbonsäure, ein Thiol, ein Halogenid, eine Hydro¬ xylgruppe oder eine photoaktivierbare Gruppe ist.
6. Komplex nach einem der Ansprüche 1 bis 5, dadurch ge¬ kennzeichnet, daß die negativ geladenen Gruppen A Hexa fluorophosphat, Trifluoracetat, Tetrafluoroborat Gruppen oder Halogenidionen sind.
7. Komplex nach einem der Ansprüche 1 bis 6, dadurch ge¬ kennzeichnet, daß die PolyhydroxyEinheiten aus Gruppen der Formeln (Ha) oder (Ilb) ausgewählt sind: NRW (Ha) OW (Ilb) worin W einen organischen Rest mit mindestens 2 Hydroxy¬ gruppen und R Wasserstoff oder CiC3Alkyl bedeutet.
8. Komplex nach Anspruch 7, dadurch gekennzeichnet, daß die PolyhydroxyEinheiten die Formel NRC(CH2OH)3 aufweisen.
9. Komplex nach einem der Ansprüche 1 bis 8, dadurch ge¬ kennzeichnet, daß die C2C3Alkylenoxy, C2C3Alkylenthio bzw. C2C3AlkylenaminoEinheiten Ethylenoxy, Ethylen thio, bzw. EthylenaminoEinheiten sind.
10. Komplex nach einem der Ansprüche 1 bis 9, dadurch ge¬ kennzeichnet, daß 1 bis 30 C2C3AlkylenoxyC2C3Alky lenthio bzw. C2C3AlkylenaminoEinheiten pro Metall¬ kation vorhanden sind.
11. Komplex nach einem der Ansprüche 1 bis 10 mit der all¬ gemeinen Formel (III) : worin M, X und A wie in Anspruch 1 definiert sind, R_, R2, R3, R4, R5 und R6 gleich oder verschieden sind und jeweils einen oder mehrere Substituenten bedeuten, unter der Voraussetzung, daß X über einen der Substituenten R1( R2, R3, R4, R5 oder R6 an einen der Liganden gebunden ist und daß mindestens einer der Substituenten Rx, R2, R3, R4, R5 oder R6 mindestens eine hydrophile Gruppe, ausgewählt aus C2C3Alkylenoxy, C2C3Alkylenthio und C2C3AlkylenaminoEinheiten enthält.
12. Komplex nach Anspruch 11 mit der allgemeinen Formel (lila) : worin M, X und A wie in Anspruch 1 definiert sind, Rx, R2, R3, R4 und R5 wie in Anspruch 11 definiert sind, s eine ganze Zahl von 0 bis 6 ist und Y eine hydrophile Gruppe mit 1 bis 10 hydrophilen Einheiten bedeutet, ausgewählt aus C2C3Alkylenoxy, C2C3Alkylenthio und C2C3AlkylenaminoEinheiten.
13. Komplex nach Anspruch 11 mit der allgemeinen Formel (Illb) : worin M, X und A wie in Anspruch 1 definiert sind, Rl t R2, R3, R4 und R5 wie in Anspruch 11 definiert sind und s eine ganze Zahl von 0 bis 6 ist, unter der Voraus¬ setzung, daß R1# R2, R3, R4 oder/und R5 eine hydrophile Substituentengruppe enthalten, die jeweils 1 bis 10 C2 C3Alkylenoxy, C2C3Alkylenthio oder/und C2C3Alkylen aminoEinheiten umfaßt.
14. Komplex nach einem der Ansprüche 1 bis 10 mit der all¬ gemeinen Formel (IV) : worin M, X, n und A wie in Anspruch 1 definiert sind, Rlf R2 und R3 gleich oder verschieden sind und jeweils einen oder mehrere Substituenten bedeuten und Y jeweils eine hydrophile Linkergruppe bedeutet, die 1 bis 10 hydrophile Einheiten, ausgewählt aus C2C3Alkylenoxy, C2C3Alkylenthio und C2C3AlkylenaminoEinheiten um¬ faßt.
15. Komplex nach einem der Ansprüche 1 bis 10 mit der all¬ gemeinen Formel (V) : worin M, X und A wie in Anspruch 1 definiert sind, Z eine Linkergruppe bedeutet, R'x, R'2, R'3, R'4 oder/und R'5 gleich oder verschieden sind und jeweils einen oder mehrere Substituenten bedeuten, unter der Voraussetzung, daß R'1# R'2, R'3 oder/und R'4 mindestens eine hydrophile Substituentengruppe enthält, die eine PolyhydroxyEin heit umfaßt.
16. Komplex nach Anspruch 15, dadurch gekennzeichnet, daß die OHGruppen der PolyhydroxyEinheiten durch weitere hydrophile Gruppen substituiert sind.
17. Komplex nach Anspruch 16, dadurch gekennzeichnet, daß die weiteren hydrophilen Gruppen ein Dendrimer bzw. ein dendrimeres Bauelement der Formel (Via) oder (VIb) umfassen: A.NRWi (A2NRW2)n. (Via) A10W1(A20W2)n. (VIb) worin Ai und A2 gleich oder verschieden sind und Linkergrup¬ pen bedeuten, Wx und W2 gleich oder verschieden sind und einen orga¬ nischen Rest mit mindestens 2 Hydroxygruppen bedeu¬ ten, R Wasserstoff oder einen C^CsAlkylrest bedeutet und n' 0 ist oder der Zahl der Hydroxygruppen von Vl1 entspricht.
18. Konjugat, umfassend eine biologische Substanz, an die mindestens ein Metallkomplex nach einem der Ansprüche 1 bis 17 gekoppelt ist.
19. Konjugat nach Anspruch 18, dadurch gekennzeichnet, daß die biologische Substanz Biotin, ein Antikörper oder Antikorperfragment, eine Nukleinsäure, ein Polypeptidan tigen, ein immunologisch reaktives Peptid oder ein Hapten ist.
20. Verwendung von Metallkomplexen nach einem der Ansprüche 1 bis 17 oder Konjugaten nach Anspruch 18 oder 19 in einem immunologischen Nachweisverfahren.
21. Verwendung nach Anspruch 20 in einem Elektrochemilumi neszenzverfahren.
22. Verwendung nach Anspruch 21, dadurch gekennzeichnet, daß man die ElektrochemilumineszenzMessung in Gegenwart eines Reduktionsmittels für den Metallkomplex durch¬ führt .
23. Verwendung nach Anspruch 22, dadurch gekennzeichnet, daß das Reduktionsmittel in die Ligandensphare des Komplexes integriert ist .
Description:
Hydrophile Metallkomplexe

B e s c h r e i b u n g

Die vorliegende Erfindung betrifft neue hydrophile Metallkom¬ plexe und deren Verwendung als lumineszierende Markierungs- gruppen im Immunoassays.

Lumineszierende Metallkomplexe sind aus dem Stand der Technik bekannt. EP-A-0 178 450 offenbart Rutheniumkomplexe, die an ein immunologisch aktives Material gekoppelt sind, wobei die Rutheniumkomplexe drei gleiche oder verschiedene bi- oder polycyclische Liganden mit mindestens zwei stickstoffhaltigen Heterocyclen enthalten, wobei mindestens einer dieser Ligan¬ den mit mindestens einer wasserlöslich machenden Gruppe, wie -S0 3 H oder -C00H substituiert ist, und wobei mindestens einer dieser Liganden mit mindestens einer reaktiven Gruppe wie -COOH direkt oder über eine Spacergruppe substituiert ist und wobei die Liganden über Stickstoffatome an das Ruthenium gebunden sind.

EP-A-0 580 979 offenbart die Verwendung von Osmium- oder Rutheniumkomplexen als Markierungsgruppen für die Elektro- chemilumineszenz. Als Liganden für diese Komplexe werden stickstofhaltige Heterocyclen, beispielsweise Bipyridine, genannt. WO 87/06706 offenbart weitere Metallkomplexe, die sich als Markierungsgruppen für Elektrochemilumineszenzmes- sungen eignen.

Die Nachteile der aus dem Stand der Technik bekannten Metall- komplexe bestehen in einer schlechten Quantenausbeute bei Elektrochemilumineszenzmessungen durch Sauerstoff-Quenching und Photodissoziation oder/und in einer hohen unspezifischen Bindung an Proteine.

Die der vorliegenden Erfindung zugrundeliegende Aufgabe bestand somit darin, die Nachteile des Standes der Technik mindestens teilweise zu beseitigen.

Überraschenderweise wurde festgestellt, daß die Einführung von C 2 -C 3 -Alkylenoxy-, C 2 -C 3 -Alkylenthio- oder/und C 2 -C 3 -Alky- lenamino-Einheiten und insbesondere von Ethylenglycol- oder/und Propylenglycol-Einheiten in lumineszierende Metall- komplexe die Adsorption von Konjugaten dieser Komplexe mit einer immunologisch reaktiven Substanz verringert und damit auch die Stabilität und Wiederfindnung der Konjugate in Immunoassays verbessert. Überdies kann eine erhöhte Quanten¬ ausbeute erzielt werden.

Weiterhin wurde festgestellt, daß die Eigenschaften von Metallkomplexen auch durch Einführung von Polyhydroxy-Ein¬ heiten verbessert werden können. Diese Polyhydroxy-Einheiten können zu dendrimerartigen Strukturen mit mehreren Generatio¬ nen ausgebaut werden. Außerdem kann durch Einbau von Poly- amin-Strukturen der für Elektrochemilumineszenzmessungen benötigte Elektronendonor direkt in die Ligandensphäre des Komplexes integriert werden.

Eine weitere erfindungsgemäße Verbesserung betrifft Metall¬ komplexe in Form eines Käfigs oder Halbkäfigs, in dem die Liganden einfach oder mehrfach, vorzugsweise über hydrophile Spacer, miteinander verknüpft sind. Auch dies führt zu einer wesentlichen Verbesserung der Photostabilität und zu einer Verringerung des Sauerstoff-Quenchings.

Ein Gegenstand der vorliegenden Erfindung ist somit ein Metallkomplex mit der allgemeinen Formel (I) :

[M<L.L 2 L 3 )] n - X-, A (I)

worin M ein zwei- oder dreiwertiges Metallkation ausgewählt aus Seltenerde- oder Übergangmetallionen ist, L 1# L 2 und L 3

gleich oder verschieden sind und Liganden mit mindestens zwei stickstoffhaltigen Heterocyclen bedeuten, wobei L 1# L 2 und L 3 über Stickstoffatome an das Metallkation gebunden sind, X eine reaktive oder aktivierbare funktioneile Gruppe ist, die an mindestens einen der Liganden L 1# L 2 , L 3 kovalent gebunden ist, n eine ganze Zahl von 1 bis 10 ist, m eine ganze Zahl von 1 bis 6 und vorzugsweise von 1 bis 3 ist und A eine oder mehrere zum Ladungsausgleich erforderliche, negativ geladene Gruppen bedeutet, wobei der Komplex mindestens eine hydro¬ phile Gruppe ausgewählt aus C 2 -C 3 -Alkylenoxy-Einheiten, C 2 -C 3 - Alkylenthio-Einheiten, C 2 -C 3 -Alkylenamino-Einheiten und Poly¬ hydroxy-Einheiten enthält.

Der Metallkomplex ist vorzugsweise ein lumineszierender Metallkomplex, d.h. ein Metallkomplex, der eine nachweisbare Lumineszenzreaktion erzeugen kann. Der Nachweis dieser Lumi¬ neszenzreaktion kann beispielsweise durch Fluoreszenz- oder durch Elektrochemilumineszenzmessung erfolgen. Das Metall- kation in diesem Komplex ist beispielsweise ein Übergangs¬ metall oder ein Seltenerdenmetall. Vorzugsweise ist das Metall Ruthenium, Osmium, Rhenium, Iridium, Rhodium, Platin, Indium, Palladium, Molybdän, Techneticum, Kupfer, Chrom oder Wolfram. Besonders bevorzugt sind Ruthenium, Iridium, Rhenium, Chrom und Osmium. Am meisten bevorzugt ist Ruthe¬ nium.

Die Liganden L l f L 2 und L 3 sind Liganden mit mindestens zwei stickstoffhaltigen Heterocyclen. Bevorzugt sind aromatische Heterocyclen wie z.B. Bipyridyl, Bipyrazyl, Terpyridyl und Phenanthrolyl. Besonders bevorzugt werden die Liganden L 17 L 2 und L 3 aus Bipyridin- und Phenanthrolin-Ringsystemen ausge¬ wählt.

Die reaktive oder aktivierbare funktioneile Gruppe X des Komplexes ist eine reaktive Gruppe, die mit einer immunolo¬ gisch aktiven Substanz gekoppelt werden kann, oder eine aktivierbare Gruppe, die auf einfache Weise in eine solche

reaktive Gruppe überführt werden kann. Vorzugsweise ist die Gruppe X eine aktivierte Carbonsäuregruppe wie etwa ein Carbonsäurehalogenid, ein Carbonsäureanhydrid oder ein Aktiv¬ ester, z.B. ein N-Hydroxysuccinimid-, ein p-Nitrophenyl- Pentafluorphenyl-, Imidazolyl- oder N-Hydroxybenzotriazolyl- ester, ein Maleimid, ein Amin, eine Carbonsäure, ein Thiol, ein Halogenid, ein Hydroxyl oder eine photoaktivierbare Gruppe.

Weiterhin enthält der Komplex eine oder mehrere zum Ladungs- ausgleich erforderliche, negativ geladene Gruppen A. Bei¬ spiele für geeignete negativ geladene Gruppen sind Halogeni¬ de, OH", Carbonat, Alkylcarboxylat, z.B. Trifluoracetat, Sulfat, Hexafluorophosphat- und Tetrafluoroborat-Gruppen. Hexafluorophosphat-, Trifluoracetat und Tetrafluoroborat- Gruppen sind besonders bevorzugt.

Der erfindungsgemäße Metallkomplex unterscheidet sich von den aus dem Stand der Technik bekannten Metallkomplexen dadurch, daß er mindestens eine hydrophile Gruppe ausgewählt aus C 2 -C 3 - Alkylenoxy-Einheiten, C 2 -C 3 -Alkylenthio-Einheiten, C 2 -C 3 -Alky- lenamino-Einheiten und Polyhydroxy-Einheiten enthält.

Die Polyhydroxy-Einheiten werden vorzugsweise aus Gruppen der Formeln (Ha) oder (Ilb) ausgewählt:

-NR-W (Ha) -0-W (Ilb)

worin W einen organischen Rest mit mindestens zwei Hydroxy- gruppen und R Wasserstoff oder Ci-C 3 -Alkyl, vorzugsweise Wasserstoff oder C 1 -C 3 -Alkyl bedeutet. Der organische Rest W enthält vorzugsweise 2 bis 6 und besonders bevorzugt 2 bis 4 Hydroxygruppen. Weiterhin sollte W günstigerweise 2 bis 10 und insbesondere 3-6 Kohlenstoffato e enthalten. Spezifische Beispiele für geeignete Polyhydroxy-Einheiten sind Reste von Polyalkoholen wie etwa Glycerin oder Aminopolyalkoholen. Ein bevorzugter Aminopolyalkohol ist Tris (2-Amino-2- (hydroxy-

methyl) -1,3-propantriol) . In diesem Fall weist die Polyhy- droxy-Einheit die Formel NR-C(CH 2 OH) 3 auf. Die Polyalkohole bzw. Aminopolyalkohole sind an dem Metallkomplex vorzugsweise in Form von Estern bzw. Amiden gekoppelt.

Die C 2 -C 3 -Alkylenoxy-, C 2 -C 3 -Alkylenthio- und C 2 -C 3 -Alkylen- amino-Einheiten des erfindungsgemäßen Metallkomplexes sind vorzugsweise C 2 -Einheiten und insbesondere Ethylenoxy-Ein- heiten. Der Komplex enthält pro Metallkation vorzugsweise 1 bis 30 und besonders bevorzugt 2 bis 20 C 2 -C 3 -Alkylen-oxy-, C 2 -C 3 -Alkylenthio- bzw. C 2 -C 3 -Alkylenamino-Einheiten. Diese Einheiten sind Bestandteile von Substituenten der hetero- cyclischen Liganden des Metallkomplexes. Sie können in einem Linker zwischen einem der Liganden und der reaktiven oder aktivierbaren funktioneilen Gruppe X oder/und in einfachen Substituenten vorliegen. Die Alkylenoxy-, Alkylenthio-bzw. Alkylenamino-Einheiten können auch über einen Brückenkopf miteinander verknüpft sein, der gegebenenfalls eine funktio¬ neile Gruppe X tragen kann. Andererseits können über den Brückenkopf auch mehrere Komplex-Einheiten miteinander ver¬ knüpft sein. Beispiele für bevorzugte Ausführungsformen der erfindungsgemäßen Metallkomplexe sind im folgenden angegeben.

In einer ersten bevorzugten Ausführungsform der vorliegenden Erfindung besitzt der erfindungsgemäße Metallkomplex die allgemeine Formel (III) :

] - X (III)

worin M, X und A wie vorstehend definiert sind, R x , R 2 , R 3 , R 4 , R 5 und R β gleich oder verschieden sind und jeweils einen oder mehrere Substituenten bedeuten, unter der Voraussetzung, daß X über einen der Substituenten R lf R 2 , R 3 , R 4 , R 5 oder R 6 an einen der Liganden gebunden ist und daß mindestens einer der Substituenten R 17 R 2 , R 3 , R 4 , R 5 oder R 6 mindestens eine hydro¬ phile Gruppe, ausgewählt aus C 2 -C 3 -Alkylenoxy-, C 2 -C 3 -Alkylenthio und C 2 -C 3 -Alkylenamino-Einheiten enthält.

Die Liganden des Komplexes sind je nach Anwesenheit bzw. Abwesenheit der durch gebrochene Linien bezeichneten Gruppen, gegebenenfalls substituierte Phenanthrolin- bzw. Bipyridinsy- steme.

Die Substituenten R l t R 2 , R 3 , R 4 , R 5 und R β an den Liganden sind - sofern sie keine hydrophile Gruppe enthalten - vor¬ zugsweise Wasserstoff, Ci-C 3 -Alkyl, insbesondere C 1 -C 3 -Alkyl. Insgesamt enthalten die hydrophilen Gruppen vorzugsweise 1 bis 30 und besonders bevorzugt 2 bis 20 Alkylenoxy-, Alky- lenthio- oder/und Alkylenamino-Einheiten, insbesondere Ethy- lenoxy-Einheiten.

Die hydrophile Gruppe kann Bestandteil eines Linkers zwischen der funktioneilen, kopplungsfähigen Gruppe X und einem der Liganden sein. In diesem Fall besitzen die Metallkomplexe vorzugsweise die allgemeine Formel (lila) :

worin M, X und A wie vorstehend definiert sind, R l t R 2 , R 3 , R 4 und R 5 wie vorstehend definiert sind, s eine ganze Zahl von 0 bis 6 vorzugsweise von 1 bis 4 ist und Y eine hydrophile

Linkergruppe mit 1 bis 10, vorzugsweise mit 2 bis 6 hydro¬ phile Einheiten bedeutet, ausgewählt aus C 2 -C 3 -Alkylenoxy-, C 2 -C 3 -Alkylenthio und C 2 -C 3 -Alkylenamino-Einheiten, insbeson¬ dere Ethylenoxy-Einheiten.

Die funktioneile Gruppe X muß jedoch nicht über einen hydro¬ philen Linker mit dem Liganden verknüpft sein. In diesem Fall besitzt der erfindungsgemäße Metallkomplex vorzugsweise die allgemeine Formel (Illb) :

worin M, X und A wie vorstehend definiert sind, R l t R 2 , R 3 , R 4 und R 5 wie vorstehend definiert sind, unter der Vorausset¬ zung, daß R 1 , R 2 , R 3 , R 4 oder/und R 5 eine hydrophile Substi- tuentengruppe enthält, die jeweils 1 bis 10 vorzugsweise 2 bis 6 C 2 -C 3 -Alkylenoxy-, C 2 -C 3 -Alkylenthio oder/und C 2 -C 3 - Alkylenamino-Einheiten, insbesondere Ethylenoxy-Einheiten umfaßt.

Ein Beispiel für eine Verbindung der Formel (lila) ist in Abb. la und lb gezeigt. Diese Verbindungen enthalten die Hydrophilie nur im Linker zwischen der Gruppe X - einem Maleimid (Abb. la) bzw. einem N-Hydroxysuccinimidester (Abb. lb) - und einem Liganden. Ebenso können aber auch die anderen Liganden hydrophile Substituenten aufweisen. Ein Beispiel für eine Verbindung der Formel (Illb) ist in Abb. lb gezeigt. Hier ist die Gruppe X ein N-Hydroxysuccinimidester.

Die Liganden des erfindungsgemäßen Metallkomplexes können auch miteinander verknüpft sein, so daß der Metallkomplex in Form eines Halbkäfigs bzw. Käfigs vorliegt. Eine bevorzugte

Ausführungsform eines erfindungsgemäßen Metallkomplexes in Form eines Halbkäfigs oder Käfigs besitzt die allgemeine Formel (IV) :

worin M, X, n und A wie vorstehend definiert sind, R l t R 2 und R 3 gleich oder verschieden sind und jeweils einen oder meh¬ rere Substituenten - wie vorstehend definiert - an dem Bi- pyridin- oder Phenanthrolin-Liganden bedeuten und Y jeweils eine hydrophile Linkergruppe bedeutet, die 1 bis 10 hydro¬ phile Einheiten, ausgewählt aus C 2 -C 3 -Alkylenoxy-, C 2 -C 3 -Alky- lenthio- und C 2 -C 3 -Alkylenamino-Einheiten, insbesondere Ethy¬ lenoxy-Einheiten umfaßt.

Wenn die Substituenten R^ R 2 und R 3 in Formel (IV) und gege¬ benenfalls über hydrophile Linkergruppen kovalent miteinander verknüpft sind, dann besitzt der Komplex der Formel (IV) die Form eines Käfigs.

Beispiele für halbkäfigförmige Komplexe der Formel (IV) sind in Abb. 2 und 3a gezeigt. Ein Beispiel für einen käfigförmi- gen Komplex ist in Abb. 3b gezeigt. Die Gruppe X in Abb. 2 ist ein Carboxylrest. Das Metallkation und die Anionen sind in Abb. 3a und 3b nicht dargestellt.

Der Komplex der Formel (IV) kann nicht nur als Monomer, sondern als Oligomer aus vorzugsweise bis zu 5 einzelnen Metallkomplexen vorliegen. Hierzu kann die funktioneile

kopplungsfähige Gruppe X beispielsweise ein Substituent an einem aromatischen Kern, z.B. einem Phenylkern sein, wobei zwei oder mehr der restlichen Substituentenpositionen des aromatischen Kerns durch einen halbkäfig- bzw. käfigförmigen Metallkomplex substituiert sein können.

Beispiele für oligomere Metallkomplexe der Formel (IV) sind in Abb. 4 und 5 gezeigt. Die Metallionen und die Anionen sind in diesen Abbildungen nicht dargestellt.

In einer weiteren bevorzugten Ausführungsform der vorliegen¬ den Erfindung ist der Metallkomplex mit Polyhydroxy-Einheiten substituiert und besitzt die allgemeine Formel (V) :

worin M, X und A wie vorstehend definiert sind, Z eine Lin¬ kergruppe bedeutet, R' lf R' 2 , R' 3 , R' 4 und R' s gleich oder verschieden sind und jeweils einen oder mehrere Substituen¬ ten, z.B. Wasserstoff oder Ci-Cg-, insbesondere C 1 -C 3 -Alkyl, bedeuten und s eine ganze Zahl von 0 bis 6, vorzugsweise von 1 bis 4 ist, unter der Voraussetzung, daß R' lf R' 2 , R' 3 oder/und R' 4 eine hydrophile Substituentengruppe enthält, die eine Polyhydroxy-Einheit umfaßt.

Der Ligand X des Metallkomplexes (V) kann mit dem Liganden über einen hydrophilen Linker, z.B. einen Linker gemäß Formel (lila) , aber auch über einen Linker gemäß Formel (Illb) gekoppelt sein. Der Substituent R' 5 ist vorzugsweise Wasser¬ stoff oder eine Ci-Cj-, insbesondere eine C 1 -C 3 -Alkylgruppe.

Ein Beispiel für eine Verbindung der Formel (V) ist in Abb.6 gezeigt . Die Gruppe X ist ein Carboxylrest .

Die OH-Gruppen der Polyhydroxy-Einheiten von Metallkomplexen der allgemeinen Formel (V) sind gegebenenfalls durch hydro¬ phile Gruppen substituiert, z.B. durch C 2 -C 3 -Alkylenoxy; C 2 -C 3 -Alkylenthio- oder/und C 2 -C 3 -Alkylenamino-Einheiten.

In einer spezifischen Ausführungsform der vorliegenden Erfin¬ dung sind die hydrophilen Substituentengruppen der OH-Gruppen der Polyhydroxy-Einheiten Dendrimere der allgemeinen Formel (Via) oder (VIb) :

-Ai-NR-Wi (A 2 -NH-W 2 ) n , (Via)

-Ai-O-W- (A 2 -0-W 2 ) n , (VIb)

worin

A x und A 2 gleich oder verschieden sind und Linkergruppen bedeuten,

W x und W 2 gleich oder verschieden sind und einen organi¬ schen Rest mit mindestens 2 Hydroxygruppen bedeuten, R Wasserstoff oder C 1 -C 5 -Alkyl und vorzugsweise Wasser¬ stoff oder C 1 -C 3 -Alkyl bedeutet und n' 0 ist oder der Zahl der Hydroxygruppen von W x ent¬ spricht.

Die Linkergruppen A x und A 2 sind vorzugsweise Gruppen der Formel (CH 2 ) m 'C (=0)-, worin m' 1 bis 5 und insbesondere 1 bis 3 ist.

Die Gruppen V! 1 und W 2 sind vorzugsweise Polyhydroxy-Einheiten, die entsprechend den Gruppen der Formeln (Ha) , (Ilb) defi¬ niert sind. Wenn n' 0 ist, liegt ein Dendrimer der ersten Generation vor. Wenn n' der Zahl der Hydroxygruppen von W- ^ entspricht, liegt ein Dendrimer der zweiten Generation vor. Die Hydroxy-Endgruppen der Dendrimere können gegebenenfalls substituiert sein, z.B. durch eine Linkergruppe mit der

Formel A 3 -R' , wobei A 3 wie die Linkergruppen A λ und A 2 defi¬ niert ist, und R' vorzugsweise C 1 -C 3 -Alkyl bedeutet.

Die Herstellung der erfindungsgemäßen Metallkomplexe erfolgt durch Reaktion eines Metallsalzes, z.B. eines Metallhaloge- nids mit den entsprechenden Liganden und ggf. anschließenden Austausch des Halogenidions durch Hexafluorophosphat- oder Tetrafluoroborat-Anionen. Derartige Verfahren sind im Stand der Technik, z.B. in EP-B-0 178 450 und EP-B-0 255 534 be¬ schrieben. Auf diese Offenbarung wird hiermit Bezug genommen.

Die Herstellung hydrophiler N-heterocyclischer Liganden kann auf einfache Weise durch Substitution am aromatischen Ligan¬ den, z.B. über ein Tosylat erfolgen. Auf entsprechende Weise kann auch eine Kopplung des hydrophilen Linkers, der die funktioneile Gruppe X trägt, erfolgen.

Die Herstellung von Metallkomplexen der Formel (IV) mit Halbkäfig- oder Käfigstruktur kann beispielsweise erfolgen durch Anfügen von Alkylenoxy-, Alkylenthio- oder/und Alkylen- amino-Einheiten an die Bipyridin- oder Phenanthrolin-Liganden und Knüpfung dieser Einheiten an einen Brückenkopf über Ether oder Amidbindung. Bei Verwendung von zwei Brückenköpfen können Käfigstrukturen erhalten werden. Bevorzugt ist die Knüpfung von 3 Liganden an einen trivalenten Brückenkopf, z.B. Tris. Der Komplex selbst wird durch Umsetzung mit Me¬ tallsalzen, wie zuvor beschrieben, hergestellt.

Die Herstellung von halbkäfig- und käfigförmigen Metallkom¬ plexen kann gemäß Reaktionsschema III (Abb. 9a und 9b) erfol¬ gen.

Die Herstellung von Metallkomplexen mit der allgemeinen Formel (V) erfolgt beispielsweise durch eine Reaktion gemäß Schema I (Abb. 7) , indem ein entsprechend substituierter Ligand mit einem Aminopolyalkohol oder einem partiell ge¬ schützten Polyalkohol umgesetzt wird, wobei hydrophile Grup-

pen der Formeln (Ha) oder (Ilb) an den Liganden angelagert werden.

Die Herstellung von dendritischen Metallkomplexen kann ent¬ sprechend dem Reaktionsschema II (Abb. 8) erfolgen.

Ein weiterer Gegenstand der vorliegenden Erfindung ist ein Konjugat, umfassend eine biologische Substanz, an die minde¬ stens ein erfindungsgemäßer Metallkomplex gekoppelt ist. Beispiele für geeignete biologische Substanzen sind Zellen, Viren, subzelluläre Teilchen, Proteine, Lipoproteine, Glyco- proteine, Peptide, Polypeptide, Nukleinsäuren, Oligosacc- haride, Polysaccharide, Lipopolysaccharide, zelluläre Metabo- liten, Haptene, Hormone, pharmakologische Wirkstoffe, Alka- loide, Steroide, Vitamine, Aminosäuren und Zucker.

Die Kopplung des Metallkomplexes mit der biologisch aktiven Substanz erfolgt vorzugsweise über die reaktive oder akti¬ vierbare funktioneile Gruppe des Metallkomplexes, die mit einer funktioneilen Gruppe der biologischen Substanz kovalent kuppeln kann. Wenn die funktioneile Gruppe ein Aktivester ist, kann beispielweise eine Kopplung mit freien Aminogruppen der biologischen Substanz erfolgen. Wenn die funktioneile Gruppe ein Maleimidrest ist, kann eine Kopplung mit freien SH-Gruppen der biologischen Substanz erfolgen. Auf analoge Weise kann auch eine Aktivierung von funktioneilen Gruppen der biologischen Substanz erfolgen, die anschließend bei¬ spielsweise mit einer freien Carbonsäure-, Amino- oder Thiol- funktion des Metallkomplexes reagieren können.

Bei einer besonders bevorzugten Ausführungsform der vorlie¬ genden Erfindung werden die Metallkomplexe an ein Peptid gekoppelt, das vorzugsweise eine Länge von maximal 50 Amino¬ säuren und besonders bevorzugt von maximal 30 Aminosäuren aufweist. Die Herstellung dieser Metallkomplex-markierten Peptide erfolgt vorzugsweise dadurch, daß man ein Peptid mit der gewünschten Aminosäuresequenz an einer Festphase syn-

thetisiert, wobei man a) nach der Synthese einen aktivierten Metallkomplex, vorzugsweise ein Metallkomplex-Aktivesterderi¬ vat an die N-terminale Aminogruppe des Peptids koppelt oder/und b) während der Synthese an mindestens einer Position des Peptids ein Aminosäurederivat einführt, das kovalent mit einem Metallkomplex gekoppelt ist. Die Kopplung des Metall¬ komplexes an die N-terminale Aminosäure des Peptids erfolgt vorzugsweise vor Abspaltung des Peptids von der Festphase und vor einer Abspaltung von Schutzgruppen an reaktiven Seiten¬ gruppen der zur Peptidsynthese verwendeten Aminosäurederiva¬ te.

Die Peptide enthalten vorzugsweise einen immunologisch reak¬ tiven Epitopbereich und einen Spacerbereich, wobei mindesens eine Metallkomplex-Markierungsgruppe an den Spacerbereich gekoppelt wird. Der Spacerbereich weist vorzugsweise eine Länge von 1 bis 10 Aminosäuren auf und ist am Amino- oder/und Carboxyterminus des Peptids angeordnet.

Der Spacerbereich enthält vorzugsweise Aminosäuren, die Ladungen aufweisen oder/und Wasserstoffbrücken ausbilden können. Die Aminosäuren des Spacerbereichs werden vorzugs¬ weise gebildet aus der Gruppe bestehend aus Glycin, ß-Alanin, γ-Aminobuttersäure, e-Aminocapronsäure, Lysin und Verbindun¬ gen der Strukturformel NH 2 - [ (CH 2 ) y O] x -CH 2 -CH 2 -COOH, worin y 2 oder 3 ist und x 1 bis 10 ist.

Die Epitopbereiche der Peptide stammen vorzugsweise aus pathogenen Organismen, z.B. Bakterien, Viren, und Protozoen, oder aus Autoimmun-Antigenen. Besonders bevorzugt stammt der Eptitopbereich aus viralen Antigenen, z.B. den Aminosäurese¬ quenzen von HIVI, HIVII oder Hepatitis C-Virus (HCV) .

Weitere bevorzugte Beispiele für biologische Substanzen sind Biotin, Nukleinsäuren, Antikörper oder Antikörperfragmente, Polypeptidantigene, d.h. immunologisch reaktive Polypeptide, oder Haptene, d.h. organische Moleküle mit einem Molekularge-

wicht von 150 bis 2000, insbesondere Moleküle mit einem Steroidgrundgerüst, wie etwa Cardenolide, Cardenolid-Glyco- side (z.B. Digoxin, Digoxigenin) , Steroid-Alkaloide, Sexual¬ hormone (z.B. Progesteron), Glucocorticoide etc. Weitere Beispiele für Haptene sind Prostaglandine, Leuco-En-diine, Thromboxane, pharmakologische Wirkstoffe etc.

Noch ein weiterer Gegenstand der vorliegenden Erfindung ist die Verwendung der erfindungsgemäßen Metallkomplexe, bzw. der erfindungsgemäßen Konjugate in einem immunologischen Nach¬ weisverfahren.

Dabei wird der Metallkomplex als Markierungsgruppe verwendet, mit deren Hilfe die qualitative oder/und quantitative Bestim¬ mung eines Analyten in einer Probelösung möglich ist. Der Nachweis des Metallkomplexes erfolgt vorzugsweise durch Elektrochemilumineszenz, wobei lumineszierende Spezies elek¬ trochemisch an der Oberfläche einer Elektrode erzeugt werden. Beispiele zur Durchführung von Lumineszenz-Assays mit Metall- komplexen des Standes der Technik finden sich in EP-A-0 580 979, WO 90/05301, WO 90/11511 und WO 92/14138. Auf die dort offenbarten Verfahren und Vorrichtungen für Lumineszenz- Assays wird hiermit Bezug genommen. Die Elektrochemilumines¬ zenz-Assays werden in Gegenwart einer Festphase durchgeführt, die vorzugsweise aus Mikropartikeln, insbesondere aus magne¬ tischen Mikropartikeln besteht, die mit einer reaktiven Beschichtung versehen sind, z.B. mit Streptavidin. Auf diese Weise können Immunkomplexe , die einen Metallkomplex als Markierungsgruppe enthalten, an die Festphase gebunden nach¬ gewiesen werden.

Die Elektrochemilumineszenz-Messung wird vorzugsweise in Gegenwart eines Reduktionsmittels für den Metallkomplex durchgeführt, z.B. einem Amin. Bevorzugt sind aliphatische Amine, insbesondere primäre, sekundäre und tertiäre Alkylami- ne, deren Alkylgruppen jeweils 1 bis 3 Kohlenstoffatome aufweisen. Besonders bevorzugt ist Tripropylamin. Das Amin

kann jedoch auch ein aromatisches Amin, wie Anilin oder ein heterocyclisches Amin sein. Das Reduktionsmittel kann bereits in der Ligandensphare des Komplexes integriert sein. Derarti¬ ge Systeme sind insbesondere zur Bestimmung von Analyten ge¬ eignet, die in hochkonzentrierter Form vorliegen.

Weiterhin kann ggf. Verstärker ein nichtionisches oberflä¬ chenaktives Mittel, z.B. ein ethoxyliertes Phenol vorhanden sein. Derartige Substanzen sind beispielsweise kommerziell unter den Bezeichnungen Triton X100 oder Triton N401 erhält¬ lich.

Andererseits kann der Nachweis des lumineszierenden Metall- komplexes auch durch Fluoreszenz erfolgen, wobei das Metall- chelat durch Bestrahlung mit einem Licht der geeigneten Wellenlänge angeregt und die daraus resultierende Fluores¬ zenzstrahlung gemessen wird. Beispiele zur Durchführung von Fluoreszenz-Assays finden sich in EP-A-0 178 450 und EP-A-0 255 534. Auf diese Offenbarung wird hiermit Bezug genommen.

Weiterhin wird die vorliegende Erfindung durch nachfolgende Beispiele und Abbildungen erläutert. Es zeigen:

Abb . la einen Metallkomplex der Formel (lila) ,

Abb . lb einen Metallkomplex der Formel (lila) ,

Abb . lc einen Metallkomplex der Formel (Illb) ,

Abb . 2 einen Metallkomplex der Formel (IV) ,

Abb . 3a einen Metallkomplex der Formel (IV) ,

Abb . 3b einen Metallkomplex der Formel (IV) ,

Abb . 4 einen Metallkomplex der Formel (IV) ,

Abb . 5 einen Metallkomplex der Formel (IV) ,

Abb . 6 einen Metallkomplex der Formel (V) ,

Abb . 7 ein Reaktionsschema zur Herstellung von Metallkom¬ plexen der Formel (V) , Abb. 8 ein weiteres Reaktionsschema zur Herstellung von Metallkomplexen der Formel (V) ,

Abb . 9a und 9b ein Reaktionschema zur Herstellung von Metallkom¬ plexen der Formel (IV) und Abb. 10 ein Metallkomplex-Progesteron-Konjugat.

Beispiel 1

Herstellung eines hydrophilen Bipyridin-Liganden (4,4'-

Bis(methoxy-ethoxy-ethoxy) -bipyridin)

50 ml einer Lösung von Lithiumdiisopropylamid in einem Ge¬ misch aus Cyclohexan, Ethylbenzol und THF werden auf -78°C abgekühlt. Es werden 350 ml einer Lösung von 50 mmol Bipyri¬ din in THF zugetropft. Man läßt zwei Stunden rühren und tropft dann eine Lösung von 100 mmol Methoxy-ethoxy-ethoxy- tosylat in THF hinzu. Nach einer Stunde bei -78°C läßt man das Reaktionsgemisch über Nacht bei Raumtemperatur stehen. Dann wird eine wäßrige Natriumchloridlösung zugegeben. An¬ schließend wird das THF mit einem Rotationsverdampfer ent¬ fernt und der Rückstand mit Essigester extrahiert.

Das Produkt wird chromatographisch über Kieselgel gereinigt. Eluens: Essigester-Methanol-Ammoniak 95/4/1 bzw. Amino-Kie- selgel mit Essigester-Petrolether als Eluens.

H-NMR(CDC1 3 ) : 3,6 ppm (m.CH 2 CH 2 ) = 16 H

7,12-8,5 ppm (bpy) = 6 H

Beispiel 2

Herstellung eines Bis(bisethylenglycol-bipyridin) -dichloro-

Ruthenium-Komplexes

Rutheniumtrichlorid wird mit einem doppelten molaren Über¬ schuß des in Beispiel 1 hergestellten Liganden und einem 7 bis 8 fachen Überschuß an Lithiumchlorid in DMF gelöst und sechs Stunden unter Rückfluß gekocht. Man entfernt das Lö¬ sungsmittel, löst den Rückstand in Wasser und extrahiert mit Essigester und anschließend mit Chloroform. Die Chloroform-

phasen wurden vereinigt, getrocknet, filtriert und am Rota¬ tionsverdampfer eingeengt.

Das Produkt wird dünnschichtchromatographisch über Amino- Kieselgel mit Acetonitril/H 2 0 10/1 gereinigt (Rf = 0,58) .

Beispiel 3

Synthese von Bis (bisethylenglycol-bipyridin) -4 (4 (4' -methyl-

2,2'bipyridyl) ) -butansäure

3,0 g des in Beispiel 2 hergestellten Ruthenium-Komplexes wurden in 240 ml eines Ethanol-Wasser-Gemisches unter Argon gelöst. Es werden 0,82 g Bipyridyl-butansäure-Derivat hin¬ zugefügt und drei Stunden unter Rückfluß erhitzt. Die Lösung wird eingeengt, mit Essigester gewaschen und mit Chloroform extrahiert . Man rotiert ein und reinigt den Rückstand über SP-Sephadex (Eluens: NaCl/HCl in Wasser) .

Ausbeute: 500 mg, Reinheit (HPLC) : 93 % MS (PosLIMS) : 1455,5 = Ru 2+ Komplex PF 6 "

Beispiel 4

Herstellung eines hydrophilen Metallkomplex-Aktivesterderi- vats

260 mg des in Beispiel 3 hergestellten Komplexes wurden in Methylenchlorid gelöst und mit equimolaren Mengen an Dicyc- lohexylcarbodiimid/N-Hydroxysuccinimidester versetzt. Man läßt zwölf Stunden rühren, filtriert DCH ab und rotiert ein. Das Rohprodukt wird über präparative HPLC gereinigt. Die Ausbeute ist 85 %.

Beispiel 5

Herstellung eines hydrophilen Metallkomplex-Maleimid-Derivats

150 mg des Metallkomplexes Ru (bipyridin) 2 (bipyridin-CO-N- hydroxysuccinimidester) gemäß EP-A-0 580 979 werden zusammen mit 100 mg Maleimido-Amino-Dioxaoctan (MADOO) und Triethyl- amin in Methylenchlorid ca. 12 h umgesetzt. Das Reaktions¬ gemisch wird 3 mal mit Wasser ausgeschüttelt und der Rück¬ stand aus der organischen Phase über eine Sephadex-LH20-Säule mit Methylenchlorid/Methanol gereinigt. Man erhält die in Abb. la dargestellte Verbindung Ru (bpy) 2 (bpy-CO-MADOO) . MS: M + = 1025,3 (entspricht Ru 2+ PF 6 ' -Komplex)

Beispiel 6

Herstellung eines hydrophilen Metallkomplex-Aktivester-Deri¬ vats

0,5 mmol des in Beispiel 5 als Ausgangsmaterial verwendeten Rutheniumkomplexes in 20 ml Dichlormethan werden mit 0,5 mmol Mono-Boc-Diaminodioxaoctan in 20 ml Dichlormethan und einem Äquivalent an Triethylamin umgesetzt. Die Aufreinigung er¬ folgt wie in Beispiel 5 beschrieben. Die Boc-Schutzgruppe wird nach Standardmethoden (Trifluoressigsäure/Methylenchlo- rid) abgespalten.

Das resultierende Produkt wird mit einer aquimolaren Menge an Korksäure-bis-N-hydroxysuccinimidester in Dirnethylformamid für 2 h bei Raumtemperatur umgesetzt . Das Lösungsmittel wird entfernt, der Rückstand in Wasser aufgenommen und lyophili- siert. Das resultierende Produkt ist in Abb. lb dargestellt. H-NMR: 7,2 - 8,9 ppm : Bipyridin (22H) ; 2,8 ppm NHS-Ester (4H) .

Beispiel 7

Synthese eines Metallkomplex-Hapten-Konjugates

10 mg des N-Hydroxysuccinimidesters aus Beispiel 4 werden mit 3,2 mg Progesteron-3-carboxymethyl-oxim-diamondioxyoctan in 2 ml Methylenchlorid gelöst, 1,2 μl Triethylamin hinzugefügt und zwölf Stunden bei Raumtemperatur gerührt. Das Lösungs¬ mittel wird entfernt und der Rückstand über Sephadex gerei¬ nigt. Das resultierende Konjugat ist in Abb. 10 dargestellt.

MS (posLIMS) : M+ = 1923,0 (Ruthenium-Komplex-Progesteron-

Konjugat 2+ Trifluoracetat

Beispiel 8

Herstellung von Metallchelat-markierten Peptiden

Die Metallchelat-markierten Peptide wurden mittels Fluor- enylmethyloxycarbonyl- (Fmoc) -Festphasenpeptidsynthese an einem Batch-Peptidsynthesizer, z.B. von Applied Biosystems A431 oder A433, hergestellt. Dazu wurden jeweils 4.0 Äquiva¬ lente der in Tabelle 1 dargestellten Aminosäurederivate verwendet:

Tabelle 1

Bei der Variante (a) - Einführung der Markierung nach Beendi¬ gung der Festphasensynthese - wurde ein aktivierter hydrophi¬ ler Ruthenium(bipyridyl) 3 -Komplex (BPRu) an die N-terminale Aminosäure des Peptids gekoppel . Das Lysin-Derivat Kl wurde

für den Spacerbereich und das Lysin-Derivat K2 für den Epi- topbereich verwendet .

Gemäß Variante (b) erfolgte die Einführung von Metallchelat- gruppen in die Peptidsequenz durch direkten Einbau von Me¬ tallchelat-gekoppelten Aminosäurederivaten, z.B. innerhalb der Sequenz über einen mit Metallchelat-Aktivester e-deriva- tisierten Lysinrest, z.B. das Lysin-Derivat K3 oder N-termi- nal durch Verwendung eines α-derivatisierten Aminosäurerests .

Die Aminosäuren oder Aminosäurederivate wurden in N-Methyl- pyrrolidon gelöst. Das Peptid wurde an 400-500 mg 4-(2',4'- Dimethoxyphenyl-Fmoc-Aminomethyl) -Phenoxy-Harz (Tetrahedron Letters 28 (1987) , 2107) mit einer Beladung von 0,4-0,7 mmol/g aufgebaut (JACS 95 (1973) , 1328) . Die Kupplungsreak¬ tionen wurden bezüglich des Fmoc-Aminosäurederivats mit 4 Äquivalenten Dicyclohexylcarbodiimid und 4 Äquivalenten N- Hydroxybenzotriazol in Dirnethylformamid als Reaktionsmedium während 20 min durchgeführt. Nach jedem Syntheseschritt wurde die Fmoc-Gruppe mit 20%igem Piperidin in Dimethylformamid in 20 min abgespalten.

Bei Anwesenheit von Cysteinresten in der Peptidsequenz er¬ folgte unmittelbar nach Beendigung der Synthese eine Oxida- tion an der Festphase mit Jod in Hexafluorisopropanol/Di- chlormethan.

Die Freisetzung des Peptids vom Träger und die Abspaltung der säurelabilen Schutzgruppen erfolgte mit 20 ml Trifluoressig- säure, 0, 5 ml Ethandithiol, 1 ml Thioanisol, 1,5 g Phenol und 1 ml Wasser in 40 min bei Raumtemperatur. Die Reaktionslösung wurde anschließend mit 300 ml gekühltem Diisopropylether versetzt und zur vollständigen Fällung des Peptids 40 min bei 0°C gehalten. Der Niederschlag wurde abfiltriert, mit Diiso¬ propylether nachgewaschen, mit wenig 50 %-iger Essigsäure gelöst und lyophilisiert. Das erhaltene Rohmaterial wurde mittels präparativer HPLC an Delta- PAK RP C18-Material (Säule

50 x 300 mm, 100 Ä, 15 μ) über einen entsprechenden Gradien¬ ten (Eluent A: Wasser, 0,1% Trifluoressigsäure, Eluent B: Acetonitril, 0,1% Trifluoressigsäure) in ca. 120 min. aufge¬ reinigt. Die Identität des eluierten Materials wurde mittels Ionenspray-Massenspektrometrie geprüft.

Die Einführung der Metallchelat-Markierung erfolgte gemäß Variante (a) über entsprechende Aktivester-Derivate an die freie N-terminale Aminogruppe des trägergebundenen Peptids. Hierzu wurden 4 Äquivalente hydrophiler Ruthenium(bipyri¬ dyl) 3 -Komplexe (BPRu) pro freie primäre Aminofunktion, akti¬ viert mit N-Hydroxybenzotriazol/Dicyclohexylcarbodiimid und in wenig DMSO gelöst, zugetropft und bei Raumtemperatur gerührt. Der Umsatz wurde über analytische HPLC verfolgt. Nach Abspaltung vom Träger wurde das Produkt mittels präpara- tiver HPLC aufgereinigt. Die Identität des eluierten Materi¬ als wurde mittels Ionenspray-Massenspektrometrie geprüft.

Die Herstellung der Peptide erfolgte auch durch eine Kom¬ bination von Variante (a) und (b) , d.h. Einbau von Metall¬ chelat-gekoppelten Aminosäurederivaten innerhalb der Sequenz, Abspaltung der N-terminalen Fmoc-Gruppe und Reaktion der freien H-terminalen Aminogruppe mit einem Metallchelat- Aktivesterderivat.

Bei einem ausschließlich direkten Einbau der Metallchelat- gekoppelten Aminosäurederivate während der Festphasensynthese gemäß Variante (b) war eine nachträgliche Einführung von Metallchelat-Aktivestern nicht mehr erforderlich.

Aus den Bereichen gpl20, gp41 und gp32 von HIVI bzw. HIVII wurden die in Tabelle 2 dargestellten Peptid-Metallkomplex- Konjugate hergestellt.

Tabelle 2: Ruthenylierte lineare Peptide

gpl20 BPRu-UZU-NNTRKSISIGPGRAFYT BPRu-UZ-NTTRSISIGPGRAFY BPRu-UZ-NTTRSISIGPGRAFY NNTRKSISIGPGRAFYT-K(BPRu) BPRu-UZU-IDIQEERRMRIGPGMAWYS gp4i/ι BPRu-UZU-AVERYLKDQQLLGIW BPRu-UGGG-QARILAVERYLKDQQLLGIWGASG BPRu-GGGG-QA ILAVERYLKDQQLLGIWGASG BPRu-UZU-WGIRQLRARLLALETLLQN gp4l/2 BPRu-UZU-LGIWGCSGKLICTTAV BPRu-UGGG-GCSGKLICTTAVPWNASWS (GCSGKLICTTAVPWNASWS) K- (BPRu) gp l/3 BPRu-UZU-KDQQLLGIWGSSGKL gp4l/4 BPRu-UZU-ALETLLQNQLLSLW gp32 BPRu-UZU-NSWGCAFRQVCHTT

BPRu-GGG-QAQLNSWGCAFRQVCHTTVPWPNDSLT

Aus dem NS5-Bereich, dem NS4-Bereich und dem Core-Bereich von HCV wurden die in der folgenden Tabelle 3 dargestellten Peptide synthetisiert.

Tabelle 3 : Ruthenylierte lineare Peptide

Corel BPRu-GGGG-KNKRNTNRR

Corel+2 BPRu-UZU-KNKRNTNRRPQDVKFPGGGQIVGGV

NS4/1+2 BPRu-UZ-SQHLPYIEQG-NleNle-LAEQFKQQALGLLQT

NS4/3m BPRU-UZ-SRGNHVSPTHYVPESDAA

NS5/1 BPRu-UZ-SRRFAQALPVWARPD

Corel+2+3 BPRu-UZ-KNKRNTNRRPQDVKFPGGGQIVGGVLLPRR

Corelm BPRu-UZ-NPKPQKKNKRNTNRR

Core3m BPRU-UZ-GQIVGGVYLLPRRGPRLG

Core2m BPRu-UZ-PQDVKFPGGGQIVGGV

NS4/3m-I BPRu-UZU-SRGNHVSPTHYVPΞSDAA

NS4/1 BPRu-UZU-SQHLPYIEQ

Die Herstellung Biotin-markierter Peptide erfolgte entweder N-terminal durch eine Derivatisierung am Harz (Biotin-Aktiv- ester) oder in die Sequenz über einen mit Biotinaktivester-e derivatisierten Lysinrest (Fmoc-Lys (Biotin) -OH) .

Beispiel 9

Herstellung von Diethyl-α,α,α' ,α' -tetrakis (ethoxycarbonyl) - 2,2' -bipyridin-4,4' -diyl-dipropionat (entsprechend Verbindung (1) in Abb. 7)

Zu einer Mischung aus 6,85 g( 29,5 mmol) Triethyl-methan- tricarboxylat und 4,1 g (29,7 mmol) Kaliumcarbonat in 50 ml Toluol/DMF (3/2) tropft man 2,00 g (5,8 mmol) 4,4' -Bis (brom- methyl) -2,2, ' -bipyridin in 40 ml Toluol/DMF (3/2) bei 50°C unter gutem Rühren zu. Man rührt weitere 4 Tage bei 65°C filtriert und entfernt anschließend das Lösungsmittel im

Vakuum. Der ölige Rückstand wird in 100 ml Toluol aufgenommen und nacheinander 3 mal mit Wasser, 3 mal mit 7 % Natronlauge und 3 mal mit Wasser ausgeschüttelt. Die organische Phase wird gesammelt und über Natriumsulfat getrocknet. Nach Ent¬ fernen der flüchtigen Bestandteile im Vakuum wird der Rück¬ stand aus Cyclohexan umkristallisiert. Zur vollständigen Entfernung von Verunreinigungen wird säulenchromatographisch getrennt (Si0 2 , CHCl 3 /MeOH (10:1) erste Bande) . Farblose Kristalle (Cyclohexan)

Ausbeute: 2,95 g (79 %) Schmp. : 116 °C

X H-NMR (250 MHz, CDCl 3 , 25 °C) : δ = l,21 (t, 18H, 3 J=7,2 Hz) , 3,57 (s, 4H) , 4,22 (q, 12H, 3 J=7,2 Hz) , 7,25 (dd, 2H, 3 J=5,1 Hz, 4 J=1,2 Hz) , 8,29 (d, 2H, 4 J=1,2 Hz) , 8,51 (dd, 2H, 3 J=5,1 Hz, 4 J=1,2 Hz)

13 C-NMR (75 MHz, CDCl 3 , 25 °C) : δ = 13,96 (CH 3 ) , 38,1 (CH 2 ) , 62,6 (H 2 CO) , 66,5 (CCO) , 123,4, 123,6, 145,9, 149,0, 155 (Pyridin- C, CH) , 166,5 (C=0) .

IR (KBr/fest) [cm "1 ] : 556, 610, 863, 1026, 1186, 1258, 1305, 1594, 1737 vs . 2988

MS-50: (180 °C, 70 eV, 300 μA, m/e) : gef. : 644,2585

C 32 H 40 N 2 O 12 (644,682!

Beispiel 10

Herstellung von N,N' -Bis (2-hydroxy-l, 1-bis (hydroxymethyl) - ethyl) -y,Qf-bishydroxy-2, 2' -bipyridin-4, 4' -diyldipropionamid (entsprechend Verbindung (2) in Abb. 7)

Zu einer Lösung aus 752,7 mg(1,17 mmol) des Hexaesters (1) aus Beispiel 7 und 848,6 mg (7,00 mmol) a, a,α-Tris- (hydroxy-

methyl) -methylamin in 10 ml über CaH 2 getrocknetem DMSO gibt man unter Rühren 967,5 mg (7,00 mmol) Kaliumcarbonat . Nach Zugabe der Base wird die Mischung leicht gelblich. Nach weiterem 10 stündigen Rühren bei 25°C wird die Suspension zentrifugiert und die Lösung vom festen Kaliumcarbonat ab¬ dekantiert. Das Lösungsmittel wird im Vakuum (0,001 mbar) bei 30 °C entfernt. Der gelbliche, ölige Rückstand wird in wenig Wasser suspendiert und das Produkt durch langsame Zugabe von trockenem Aceton (über P 4 O 10 destilliert) ausgefällt. In der Kälte erfolgt die vollständige Ausfällung. Man dekantiert die Lösung ab und trocknet den Rückstand mehrere Tage über P 4 O 10 . Zurück bleibt ein hygroskopischer farbloser Feststoff, der ohne weitere Reinigung eingesetzt wird.

Ausbeute: 0,652 g (67 %)

X H-NMR (250 MHz, DMSO-d 6 , 25 °C) : δ=3,08 (d, 4H) , 3,22 (s, 8H) , 3,47 (d, 8H, J=10,8 Hz) , 3,55 (d, 8H, 2 J=11,1 Hz) , 3,69 (t, 2H) , 4,6-5,1 (bs, OH) , 7,27 (d, 2H, Pyridyl-H, 3 J=4, 8 Hz), 7,4-7,7 (s, NH) , 8,23 (s, 2H, Pyridyl-H), 8,51 (d, 2H, Pyridyl-H, 3 J=4, 8 Hz)

13 C-NMR (75 MHz, DMSO-d 6 , 25 °C) : δ=30,7 (CH 2 ) , 59,7 (CH 2 OH) , 61,7 (CR 4 ) , 63,34 (CR 4 ) , 78,5 (CCO) , 122,8, 126,0, 146,0, 148,7, 155,0 (Pyridin-C,CH 2 ) , 170,2 (CONH)

IR: (Kbr/fest) [cm "1 ] : 3336, 2936, 2880, 1675, 1597, 1559, 1533, 1465, 1363, 1051 (vs)

FAB"-MS (m-NBA, m/e) : 833,3, 855,3, 871,3, 965,2 (M+H)φ, (M+Na)', (M+K) β , (M+Cs)'

C 34 H 52 N 6 0 16 ( 832 , 3 )

Beispiel 11

Herstellung von halbkäfig- bzw. käfigförmigen hydrophilen

Liganden gemäß Reaktionsschema III (Abb. 9a und b)

Ansatz: 2,6 g (10 mmol) Bipyridin-methylbromid 80 ml 2-Methoxyethylamin 10 g Kaliumcarbonat

Durchführung:

Das Bromid wurde unter Rühren zu einer Suspension von gepul¬ vertem Kaliumcarbonat in 2-Methoxyethylamin gegeben. Die Suspension wurde dann 12 h bei Raumtemperatur gerührt. An¬ schließend filtrierte man ab, destillierte das überschüssige 2-Methoxyethylamin ab und trocknete den Rückstand im Vakuum. Der Rückstand wurde chromatographiert (Si0 2 ; CH 2 C1 2 /CH 3 0H/NH 3 , 100:10:1) . Man erhielt ein hellgelbes Öl. Ausbeute: 1,06 g (3,85 mmol) 38 %

X H-NMR (250 MHz, CDCl 3 ) : 1,95 (s, 1H, NH) ; 2,26 (s, 3H, Pyri¬ dyl-CH 3 ) , 2,7 (t, 3 J = 5,28 Hz, 2H, OCH 2 ) ; 3,24 (s, 3H, OCH 3 ) ; 3,41 (t, 3 J = 5,28 Hz, 2H, NCH 2 ) ; 3,76 (s, 2H, Pyridyl-CH 2 ) , 7,5 (dd, 3 J = 8,35 Hz, 4 J = 2,17 Hz, 1H, Pyridyl H) ; 7,69 (dd, 3 J = 8,19 Hz, 4 J = 2,24 Hz, 1 H) , Pyridyl H) ; 8,17 (d, 3 J = 8,02 Hz, 1H, Pyridyl-H) ; 8,22 (d, 3 J = 8,24 Hz, 1 H, Pyridyl- H) ; 8,39 (d 4 J = 1,84 Hz, 1H, Pyridyl H) ; 8,85 (d, 4 J = 1,85 Hz, 1 H, Pyridyl H) ppm.

Ansatz: 2,26 (10 mmol) Tri-alkohol 6,67 (35 mmol) Tosylchlorid

Durchführung:

Eine Lösung des Tri-alkohols in 20 ml Pyridin wurde langsam mit einer Lösung von Tosylchlorid in 20 ml Pyridin unter Kühlen, Schutzgas und Rühren versetzt, so daß die Temperatur der Reaktionsmischung 10 °C nicht überschritt. Dann wurd enoch 24 h bei Raumtemperatur gerührt. Anschließend goß man vorsichtig auf eine Mischung von 10 ml Wasser, 20 ml Methanol und 8 ml konz. Salzsäure. Ds ausgefallene Produkt bzw. abge¬ schiedene Öl wurde abfiltriert bzw. abgetrennt und chromato¬ graphisch gereinigt (Si0 2 ; CH 2 Cl 2 /CH 3 OH/NH 3 , 100:10:1). Man erhielt farblose Kristalle.

Smp. : 57 - 59 °C

X H-NMR (250 MHz, CD 2 Cl 2 ) : 2,4 (s, 9H, Ar-CH 3 ) ; 3,25 (s, 2H, CH 2 ) ; 3,88 (s, 6H, CH 2 ) ; 4,22 (s, 2H, CH 2 ) ; 7,02-7,1 (m, 2H, Ar-H) ; 7,25-7,3 (m, 3H, Ar-H) ; 7,31 (d, 3 J = 6,46 Hz, 6H, Ar-H) ; 7,31 (d, 3 J = 6,46 Hz, 6H, Ar-H) ; 7,67 (d, 3 J = 6,46 Hz, Ar-H) ppm

13 C-NMR u. DEPT-135 (62,8 MHz, CDC1 3 ) ; 145,36; 137,20; 131,75; 43,82 (C q ) ; 130,05; 128,39; 128,33; 127,92; 127,75; 127,23 (CH) ; 73,28, 66,71; 66,31 (CH 2 ) ; 21,67 (CH 3 ) ppm

Beispiel 13

Anwendung hydrophiler Metallkomplexe in immunologischen Tests

Es wurde ein Doppel-Antigen-Brückentest zum Nachweis spezifi¬ scher Antikörper gegen Hepatitis C-Virus (HCV) durchgeführt. Hierbei wurde die Probeflüssigkeit mit einem Ruthenium-mar¬ kierten Antigen und einem biotinylierten Antigen gegen den zu bestimmenden Antikörper in Gegenwart einer Streptavidin-be- schichteten Festphase inkubiert. Das Vorhandensein von Anti- HCV-Antikörpern in der Probeflüssigkeit wurde durch Bestim¬ mung der Markierung in der Festphase durch Elektrochemilumi¬ neszenz nach dem Flash-System bestimmt.

Als Antigen wurde ein HCV-Polypeptid, welches die Aminosäuren 1207-1488 von HCV enthält, verwendet. Die Aminosäuresequenz und Herstellung eines derartigen Polypeptids ist in DE-A-44 28 705.4 beschrieben.

Zur Derivatisierung des HCV-Polypeptids mit Succinimidester- aktivierten Rutheniumkomplexen wurde das lyophilisierte Polypeptid in einem 100 mM Natriumphosphatpuffer pH 6,5, 0,1 % SDS in einer Proteinkonzentration von 10 mg/ml gelöst. Durch Zusatz von 5 M wurde der pH-Wert auf 8,5 eingestellt und die Lösung mit Dithiothreitol auf eine Endkonzentration von 2 mM abgestoppt. Zu dieser Lösung wurde die der gewünsch¬ ten Angebotsstöchiometrie entsprechende Menge eines Succin- imidester-aktivierten Rutheniumkomplexes in DMSO zugegeben und anschließend für 60 min bei 65 °C unter Rühren inkubiert. Die Reaktion wurde durch Aufstocken des Reaktionsgemisches mit Lysin auf eine Endkonzentration von 10 mM und eine wei¬ tere Inkubation für 30 min abgestoppt. Anschließend wurde der Ansatz gegen 100 mM Natriumphosphatpuufer pH 6,5, 0,1 % SDS dialysiert. Die resultierende Proteinlösung wurde mit Sac¬ charose (Endkonzentration 6,5 % (w/v) ) versetzt und in Por¬ tionen lyophilisier .

Zur Herstellung eines mit einem Maleinimid-aktivierten Ru¬ theniumkomplex derivatisierten HCV-Polypeptids wurde das lyophilisierte Protein in 100 mM Natriumphosphatpuffer pH 6,5, 0,1 % SDS (Proteinkonzentration 10 mg/ml) aufgenommen. Zu dieser Lösung wurde eine der gewünschten Angebotsstöchio- metrie entsprechende Menge des Maleinimid-aktivierten Ru¬ theniumkomplexes in DMSO zugegeben und 60 min bei 25°C unter Rühren inkubiert. Die Reaktion wurde durch Aufstocken des Reaktionsgemisches mit Cystein auf eine Endkonzentration von 10 mM und weitere Inkubation für 30 min abgestoppt. Das Reaktionsgemisch wurde daraufhin wie oben beschrieben dialy- siert, mit Saccharose versetzt und in Portionen lyophili- siert.

Es wurden 3 Experimente durchgeführt, in denen jeweils unter¬ schiedliche ruthenylierte Antigene eingesetzt wurden. Für Experiment A (Vergleich) wurde der in den Beispielen 5 und 6 als Ausgangsmaterial verwendete Ruthenium-Komplex gemäß EP-A- 0 580 979 in einem stöchiometrischen Verhältnis von 1:3 an das Polypeptid gekoppelt. Für Experiment B wurde das Polypep- tid mit dem in Beispiel 5 hergestellten erfindungsgemäßen hydrophilen Ruthenium-Komplex in einem stöichiometrischen Verhältnis von 1:3 gekoppelt. Für Experiment C wurde das Polypeptid mit dem in Beispiel 6 hergestellten hydrophilen Ruthenium-Komplex im stöichiometrischen Verhältnis von 1:1 gekoppelt. Als biotinyliertes Antigen wurde in allen 3 Expe¬ rimenten ein Polypeptid verwendet, das im stöichiometrischen Verhältnis von 1:6 an ein Maleimid-aktiviertes Biotin gekop¬ pelt worden war. Das ruthenylierte und das biotinylierte Antigen wurden jeweils in einer Konzentration von 400 ng/ml Testflüssigkeit eingesetzt.

In Tabelle 4 ist das Ergebnis der Experimente A, B und C in ECL-Counts dargestellt. Es ist ersichtlich, daß erst die Verwendung der erfindungsgemäßen hydrophilen Metallkomplexe als Markierungsgruppen eine zuverlässige Unterscheidung zwischen einer negativen Serumprobe und einer kritischen

positiven Serumprobe erlaubt. Dies zeigt sich in einem höhe¬ ren Verhältnis positiv/negativ.

Tabelle 4

Experiment A (Ver¬ B C gleich) negative 323317 84584 44274 Probe positive 465769 346734 313185 Probe

Verhältnis 1,4 4 7 positiv/ne¬ gativ