Title:
ＦＧＦＲ３結合分子ｌｋｏｋｏｋ
Document Type and Number:
Japanese Patent JP6840907
Kind Code:
B2
Abstract:
The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the amino acid sequence of (c), wherein the identity determination excludes amino acid position (X6) and provided that the amino acid sequences EVMSTTA (SEQ ID NO: 20) in amino acid positions 12 to 18 of SEQ ID NO: 19 and SQSPH (SEQ ID NO: 21) in amino acid positions 31 to 35 of SEQ ID NO: 19 are conserved and the amino acids Q and Yin amino acid positions 37 and 38 of SEQ ID NO: 19 are conserved.
Inventors:
Siratch Melco, Michaela
Woods, richard
Henne, Patricia
Zubler, Barbara
Lizard, elena
Grabrowski, Dragan
Barts Singer, Julian
Woods, richard
Henne, Patricia
Zubler, Barbara
Lizard, elena
Grabrowski, Dragan
Barts Singer, Julian
Application Number:
JP2019569749A
Publication Date:
March 10, 2021
Filing Date:
April 03, 2018
Export Citation:
Assignee:
Cilag GMBH International
International Classes:
C12N15/12; A61K38/17; A61K39/395; A61K45/00; A61K47/55; A61K47/68; A61K48/00; A61P1/04; A61P3/10; A61P17/06; A61P19/02; A61P21/04; A61P25/00; A61P29/00; A61P35/00; A61P37/02; A61P43/00; C07K14/47; C07K16/28; C07K19/00; C12N15/11; C12N15/13; C12N15/62
Domestic Patent References:
| JP2010500875A | ||||
| JP2012521759A | ||||
| JP2015516801A |
Attorney, Agent or Firm:
Hiroshi Kobayashi
Eiji Katayama
Junko Kobayashi
Norio Omori
Sayaka Hirakawa
Yasuhito Suzuki
Eiji Katayama
Junko Kobayashi
Norio Omori
Sayaka Hirakawa
Yasuhito Suzuki