FIELD OF THE INVENTION

The present invention relates to the field of cardiovascular diseases. In particular, immunoglobulin single variable domains directed against macrophage mannose receptor (MM ) are provided that can be used in the diagnosis, prognosis and/or monitoring of cardiovascular diseases or as therapeutics. Also, the anti-macrophage mannose receptor (MMR) immunoglobulin single variable domains of the invention are useful at different stages of cardiovascular diseases, including post-infarction cardiovascular events. Further, the anti-macrophage mannose receptor (MMR) immunoglobulin single variable domains of the invention are particularly useful for the in vivo targeting and/or imaging of vulnerable atherosclerotic plaques.

BACKGROUND

Cardiovascular disease is the leading cause of mortality and coronary heart disease alone is responsible for more than half of these deaths. The occurrence of a coronary event is due, in the vast majority of cases, to the rupture of a vulnerable or unstable coronary plaque, resulting in a sudden block of blood flow in critical arteries in the brain, the lungs or the heart. Several of these patients die suddenly of a first myocardial infarction or cardiac arrest without any symptoms or diagnosis of coronary artery disease (Naghavi et al. (2003) Circulation 108:1664-1672). Today, no general diagnostic method is available for detection or characterization of vulnerable plaques. Coronography, the reference method for the diagnosis of coronary artery disease, allows visualisation of abnormal reductions of the internal diameter of an artery, called "stenoses", but does not allow the identification of non-stenotic plaques. Nuclear imaging holds potential for molecular imaging of vulnerable atherosclerotic plaques. Many tracers of various chemical nature, including lipoproteins, peptides, oligopeptides, antibodies, sugars, antisense nucleotides and nanoparticles were evaluated experimentally for molecular imaging of atherosclerosis (Riou et al. (2009) Curr. Med. Chem. 16:1499-1511). The main evaluated targets were oxidized LDLs and their receptors, the inflammatory process via macrophage cell imaging, or imaging of receptors or enzymes expressed by this cell type, apoptotic phenomena and the phenomenon of neoangiogenesis. Among tracers targeting the inflammatory process, 99m Tc-MCP-1 for nuclear imaging via SPECT (Single Photon Emission Computed Tomography) and [18FJ-FDG for PET (Positron Emission Tomography) imaging have been used for in vivo noninvasive imaging of macrophage accumulation in experimental atherosclerotic lesions. On a clinical level, [18FJ-FDG and 99mTc-Annexin A5 allowed noninvasive imaging of the accumulation of macrophages and apoptotic cells, respectively, in carotid atherosclerotic plaques of symptomatic patients. However, none of these radiotracers is currently used in routine clinical practice, mainly because of their inability to reach sufficient ratios of lesion versus background noise level in the coronary lesions. Indeed, nuclear imaging of vulnerable plaques in the coronary arteries is particularly difficult because of the low volume of the lesions and their proximity to blood that contains circulating unbound tracer.

An ideal tracer should combine high affinity and specificity, good solubility and stability and efficient radiolabeling with small size and fast blood clearance, so that high contrast images can be obtained shortly after administration. Nanobodies constitute a promising new class of radiotracers that might adhere to these conditions. They are derived from unique heavy-chain-only antibodies that are by nature present in camelids and represent the smallest possible (10-15 kDa) functional immunoglobulin- like antigen-binding fragment. Nanobody-based tracers targeting cancer antigens epidermal growth factor receptor, carcinembryonic antigen, or human epidermal growth factor receptor 2 (HE 2) with (sub)nanomolar affinities have already proven their ability to generate highly specific contrast images for non-invasive bio-imaging of cancer cells in mouse tumor models (Huang et al. (2008) Mol. Imaging Biol. 10: 167-175; Vaneycken et al. (2010) J Nucl Med. 51:1099-1106; Vaneycken et al. (2011) FASEB J. 25:2433-2446). Recently, in hypercholesterolemic ApoE-deficient mice, representing a mouse model of atherosclerosis, it was documented that high contrast images and high lesion-to-heart and lesion-to- blood ratios could be obtained via SPECT imaging using Nanobodies targeting vascular cell adhesion molecule-1 (VCAM-1). (Broisat et al. (2012) Circ Res 110:927). However, there is still a need for novel radiotracers that are particularly suitable for the diagnosis or prognosis of cardiovascular diseases or disease manifestations associated therewith.

SUMMARY OF THE INVENTION

An ideal radiotracer for molecular imaging is characterized by a high affinity and specificity for its target, efficient radiolabeling, and a small size as well as a rapid blood clearance, so that images with high contrast can be rapidly obtained after administration of the tracer. The latter is particularly crucial in the case of the plaque because of its small size and its intravascular location. The current invention is based on the inventors' surprising findings that a set of immunoglobulin single variable domains, in particular Nanobodies, recognizing the macrophage mannose receptor (MMR or CD206) exhibited all the characteristics of an ideal molecular imaging tracer defined above and that they can be used for targeting and in vivo imaging of vulnerable atherosclerotic plaques. In particular, anti-MMR immunoglobulin single variable domains can be used as tools for detecting vulnerable atherosclerotic plaques, for determining the degree of vulnerability of atherosclerotic plaques and/or for monitoring the evolution in function of time of the degree of vulnerability of atherosclerotic plaques. The inventors have also found that the anti-MMR immunoglobulin single variable domains can be used as molecular imaging tracer at different stages of cardiovascular events, including post-infarction events.

The invention thus envisages applications making use of specific immunoglobulin single variable domains, including Nanobodies, against MMR, as tracers for molecular imaging in the context of diagnosis or prognosis of cardiovascular diseases or disease manifestations associated therewith, including myocardial infarction and ischemic stroke, as well as post-infarction events such as cardiac remodeling and cardiac failure. The anti-MMR immunoglobulin single variable domains can thus be important clinical tools for predicting disease outcome and to guide treatment decisions.

The specific anti-MMR immunoglobulin single variable domains, including Nanobodies, may also have perspectives to be used as a vector for targeted delivery of therapeutics.

Objects of the invention will be clear from the description that follows.

BRIEF DESCRIPTION OF THE DRAWINGS

Figure 1. Biodistribution of Nb MMR Cll in wild-type and MMR knockout C57bl/6 mice. Tracer uptake is expressed as injected activity per gram (%IA/g). Figure 2. Coronal and sagittal views of fused Pinhole SPECT and Micro-CT images of naive WT or MMR ^"7" mice 1 hour after injection with ^99m Tc labeled anti-MMR Nb clone 1. (A) In WT mice anti-MMR Nb shows kidney/bladder elimination and uptake in several organs. (B) In MMR ^7" mice anti-MMR Nb shows primarily kidney/bladder elimination.

Figure 3. PE-ELISA on human MMR. Summary of the selected anti-human MMR Nb clones. A clone was selected when the OD405nm was at least 3 times higher on specific antigen as compared to irrelevant milk blocking proteins.

Figure 4. PE-ELISA on human MMR. Summary of the selected anti-human/mouse MMR cross-reactive Nb clones. A clone was selected when the OD405nm was at least 3 times higher on specific antigen as compared to irrelevant milk blocking proteins. Figure 5. PE-ELISA on mouse MMR. Summary of the selected anti-human/mouse MMR cross-reactive Nb clones. A clone was selected when the OD405nm was at least 2 times higher on specific antigen as compared to irrelevant milk blocking proteins.

Figure 6. Purification of a number of selected Nb clones. A. Coomassie stained 12% SDS-PAGE gel loaded with protein fractions after IMAC purification of NbhmMMRm5.38 periplasmic extract. Lane 1, column flowthrough, lane 2, wash fraction, lane 3 and 4, elution fractions, M indicates a molecular weight ladder. B. Chromatogram of IMAC purified Nb5.38 samples run on a S75 gelfiltration column in PBS. Solid line depicts the OD 280nm, dotted line depicts conductivity, dashed line depicts pH. Only fractions in the main Nb peak around fraction 30 were withheld for further experiments. C. Coomassie stained 12% SDS-PAGE gel loaded with protein fractions after gelfiltration of NbhmMM m3.1 (lane 1), NbhmMMRml4.4 (lane 2), NbhmMMRm5.38 (lane 3), NbhmMMRm26.70 (lane 4) and NbhmMMRm3.49 (lane 5). M indicates a molecular weight ladder. All Nbs were confirmed to be >95% pure and have sizes of 13-15 kDa.

Figure 7. Surface Plasmon resonance sensograms of NbhmMMRm3.49 binding to recombinant human and mouse MMR. NbhmMMRm3.49 was injected in multiple concentrations at 30 μΙ/min over a CM5 sensorchip coated with 3500RU of recombinant human (A) or mouse (B) MMR. The sonograms depict the association and dissociation phase over a period of 800s.

Figure 8: MMR specific Nbs bind to mouse MMR expressed on ex vivo isolated macrophages. 3LL-R tumors were induced by injecting 3x10 ^s cancer cells subcutaneously in C57BI/6 mice. After 15 days of tumor growth, the tumors were isolated and single cell suspensions were prepared to be analyzed by flow cytometry. The CDllb+Ly6G- tumor associated macrophages (TAM) were further gated on MHCII expression. The histograms depict MMR expression as defined by Nb binding on MHCII ^low and MHCII ^hlgh TAMs. Shaded histograms depict binding of the negative control Nb BCII10.

Figure 9: MMR specific Nbs bind to human MMR expressed on induced dendritic cells. Anti-hMMR Nbs bind to CDllc+ subsets in human iDC single-cell suspensions. Shaded histograms depict binding of the negative control Nb BCII10.

Figure 10: Tissue distribution experiments of MMR Nbs in WT C57/bl6 mice. Anti-MMR Nbs were labelled with ^99m Tc and injected in the tail vein of C57/bl6 mice (n=3). After 3h, the mice were dissected and radioactivity was measured in the major organs. The uptake values for the negative control Nb cAbBclllO served as a measure for general aspecific Nb distribution.

Figure 11. Nb MMR ell aortic distribution in ApoE ^_/" mice. Uptake of Nb MMR ell as compared to negative control Nanobody cAb BCII10 and positive control Nanobody cAb VCAMl-5, in arterial segments from ApoE-/- mice, ranked according to the lesion-extension index. The lesion-extension index was attributed to each segment as shown in the inset: (-) no lesion (control segments), (+) lesion covering up to 50% of the arterial segment length, (++) lesions covering >50% of the arterial segment length, and (+++) lesions extending over the whole segment length. Figure 12. In vivo crossreactivity of anti-MMR nanobodies in WHHLMI rabbits. Panel A: Planar images at 60 min after injection of ^99m Tc labelled Nb MMR ell (Al), NbhmMMRm3.49 (A2) and NbhmMMRml4.4 (A3). Panel B: Radioactivity in dissected organs, expressed as percentage of injected activity per organ (Bl) or as differential uptake ratio (DUR; %ID/g/kg), calculated as (tissue activity/tissue weight)/(injected activity/animal body weight) (B2).

Figure 13. PET based in vivo imaging with anti-Macrophage Mannose Receptor Nanobodies of atherosclerotic lesions in abdominal aorta of Myocardial-infarction prone Watanabe heritable hyperlipidemic rabbits. PET images and fused PET/CT images are shown for individual rabbits injected with either 18F-labeled anti-MMR nanobody (clone 3.49; n=3; left column) or 18F-labeled control nanobody cAbBCIIlO (n=2; right column). Arrows indicate atherosclerotic lesions.

Figure 14. PET based in vivo imaging with anti-Macrophage Mannose Receptor Nanobodies of atherosclerotic lesions in carotid artery of Myocardial-infarction prone Watanabe heritable hyperlipidemic rabbits. PET images and fused PET/CT images are shown for individual rabbits injected with either 18F-labeled anti-MMR nanobody (clone 3.49; n=3; left column) or 18F-labeled control nanobody cAbBCIIlO (n=2; right column). Arrows indicate atherosclerotic lesions.

Figure 15. Longitudinal profile of 99mTc-MMR-Nb uptake after myocardial ischemia/ reperfusion injury. Ratio of the in vivo quantified mean uptake of 99mTc-MMR-Nb at the anterolateral segment of myocardium over the mean uptake of 99mTc-MMR-Nb at the inferobasal segment (control region). Repeated measures ANOVA on log-transformed data show a significant difference in mean ^99m Tc-MMR- Nb uptake in the animal group subjected to ischemia/reperfusion injury in comparison to sham operated animals from day 5 until day 16. Error bars show the standard deviation.

Figure 16. Absolute in vivo quantification of 99mTc-MMR-Nb uptake on different time points after myocardial ischemia/reperfusion injury. Data are presented as group mean ± standard deviation. The red line (block) denotes the absolute uptake of the ^99m Tc-MMR-Nb at the site of infarction (anterolateral wall), the blue depicts (dot) retention of the ^99m Tc-MMR-Nb at the anterolateral wall in sham operated animals and the green line (triangle) represents the retention profile of a control nanobody (cAbBCIIlO-Nb) at the site of infarction in animals subjected to IRI.

Figure 17. Correlation between the mean of ratios of anti-MMR-Nb uptake and total perfusion deficit on D2. The means of the ^99m Tc-MMR-Nb ratios of all available time points (MeanMMRuptake) are plotted against the corresponding total perfusion deficit (TPD D2), assessed by a ^99m Tc Tetrofosmin scan on day 2. The blue dots represent sham-operated rats whereas the red dots depicts the rats subjected to IRI. The least square regression line and its equation are also shown. Figure 18. Ex vivo immunofluorescence staining on cardiac cryo-sections after myocardial ischemia/reperfusion injury. A. Double immunofluorescence staining of CD206 (MMR, red) and CD68 (macrophage lineage marker, green) on cryosectioned cardiac tissue. The animal was sacrificed 12 days after the induction of IRI. The slice was obtained in the vicinity of the infarcted area. B. The upper panel shows double immunofluorescence staining for MMR (CD206; red) and CD68 (green). The slice is taken at the border of infarction 120 days after the induction of IRI, on guidance of the corresponding ^99m Tc-MMR-Nb acquisition. C. Transverse, coronal and sagittal fused pinhole SPECT/ microCT images of the same animal. The ^99m Tc-MMR-Nb acquisition is shown using NIH color table. ^99m Tc-Tetrofosmin uptake in the myocardium is shown as deep green. The absence of the uptake of ^99m Tc-Tetrofosmin is suggestive for myocardial infarction and allows correct interpretation of the localization of ^99m Tc-MMR- Nb retention in regard to the injured site (white arrow).

DETAILED DESCRIPTION OF THE INVENTION

Definitions

The present invention will be described with respect to particular embodiments and with reference to certain drawings but the invention is not limited thereto but only by the claims. Any reference signs in the claims shall not be construed as limiting the scope. The drawings described are only schematic and are non-limiting. In the drawings, the size of some of the elements may be exaggerated and not drawn on scale for illustrative purposes. Where the term "comprising" is used in the present description and claims, it does not exclude other elements or steps. Where an indefinite or definite article is used when referring to a singular noun e.g. "a" or "an", "the", this includes a plural of that noun unless something else is specifically stated. Furthermore, the terms first, second, third and the like in the description and in the claims, are used for distinguishing between similar elements and not necessarily for describing a sequential or chronological order. It is to be understood that the terms so used are interchangeable under appropriate circumstances and that the embodiments of the invention described herein are capable of operation in other sequences than described or illustrated herein.

Unless otherwise defined herein, scientific and technical terms and phrases used in connection with the present invention shall have the meanings that are commonly understood by those of ordinary skill in the art. Generally, nomenclatures used in connection with, and techniques of molecular and cellular biology, structural biology, biophysics, pharmacology, genetics and protein and nucleic acid chemistry described herein are those well-known and commonly used in the art. The methods and techniques of the present invention are generally performed according to conventional methods well known in the art and as described in various general and more specific references that are cited and discussed throughout the present specification unless otherwise indicated. See, for example, Sambrook et al. Molecular Cloning: A Laboratory Manual, 3th ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (2001); Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing Associates (1992, and Supplements to 2002); up, Biomolecular crystallography: principles, Practice and Applications to Structural Biology, 1 ^st edition, Garland Science, Taylor & Francis Group, LLC, an informa Business, N.Y. (2009); Limbird, Cell Surface Receptors, 3d ed., Springer (2004).

As used herein, the terms "polypeptide", "protein", "peptide" are used interchangeably herein, and refer to a polymeric form of amino acids of any length, which can include coded and non-coded amino acids, chemically or biochemically modified or derivatized amino acids, and polypeptides having modified peptide backbones.

As used herein, the terms "nucleic acid molecule", "polynucleotide", "polynucleic acid", "nucleic acid" are used interchangeably and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof. Polynucleotides may have any three- dimensional structure, and may perform any function, known or unknown. Non-limiting examples of polynucleotides include a gene, a gene fragment, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, control regions, isolated RNA of any sequence, nucleic acid probes, and primers. The nucleic acid molecule may be linear or circular.

The term "sequence identity" as used herein refers to the extent that sequences are identical on a nucleotide-by-nucleotide basis or an amino acid-by-amino acid basis over a window of comparison. Thus, a "percentage of sequence identity" is calculated by comparing two optimally aligned sequences over the window of comparison, determining the number of positions at which the identical nucleic acid base (e.g., A, T, C, G, I) or the identical amino acid residue (e.g., Ala, Pro, Ser, Thr, Gly, Val, Leu, lie, Phe, Tyr, Trp, Lys, Arg, His, Asp, Glu, Asn, Gin, Cys and Met) occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity. Determining the percentage of sequence identity can be done manually, or by making use of computer programs that are available in the art. Examples of useful algorithms are PILEUP (Higgins & Sharp, CABIOS 5:151 (1989), BLAST and BLAST 2.0 (Altschul et al. J. Mol. Biol. 215: 403 (1990). Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (http://www.ncbi.nlm.nih.gov/). A "deletion" is defined here as a change in either amino acid or nucleotide sequence in which one or more amino acid or nucleotide residues, respectively, are absent as compared to an amino acid sequence or nucleotide sequence of a parental polypeptide or nucleic acid. Within the context of a protein, a deletion can involve deletion of about 2, about 5, about 10, up to about 20, up to about 30 or up to about 50 or more amino acids. A protein or a fragment thereof may contain more than one deletion.

An "insertion" or "addition" is that change in an amino acid or nucleotide sequences which has resulted in the addition of one or more amino acid or nucleotide residues, respectively, as compared to an amino acid sequence or nucleotide sequence of a parental protein. "Insertion" generally refers to addition to one or more amino acid residues within an amino acid sequence of a polypeptide, while "addition" can be an insertion or refer to amino acid residues added at an N- or C-terminus, or both termini. Within the context of a protein or a fragment thereof, an insertion or addition is usually of about 1 , about 3, about 5, about 10, up to about 20, up to about 30 or up to about 50 or more amino acids. A protein or fragment thereof may contain more than one insertion. A "substitution", as used herein, results from the replacement of one or more amino acids or nucleotides by different amino acids or nucleotides, respectively as compared to an amino acid sequence or nucleotide sequence of a parental protein or a fragment thereof. It is understood that a protein or a fragment thereof may have conservative amino acid substitutions which have substantially no effect on the protein's activity. By conservative substitutions is intended combinations such as gly, ala; val, ile, leu, met; asp, glu; asn, gin; ser, thr; lys, arg; cys, met; and phe, tyr, trp.

As used herein, the terms "determining," "measuring," "assessing," and "assaying" are used interchangeably and include both quantitative and qualitative determinations.

Detailed description

One aspect of the present application relates to an immunoglobulin single variable domain directed against and/or specifically binding to a macrophage mannose receptor, for use in the diagnosis, prognosis, prevention and/or treatment of a cardiovascular disease, including atherosclerosis as well as post-infarction events such as cardiac remodeling and cardiac failure. More particularly, it is envisaged within this context to use an anti-macrophage mannose receptor (anti-MMR) immunoglobulin single variable domain as contrast agent in methods of medical imaging in order to visualize atherosclerotic plaques in a subject, preferably aortic atherosclerotic plaques, including coronary and carotid atherosclerotic plaques, and if appropriate, to use these anti-MMR immunoglobulin single variable domain for targeted delivery of therapeutics. Further, it is also envisaged within this context to use an anti-macrophage mannose receptor (anti-MMR) immunoglobulin single variable domain as contrast agent in methods of medical imaging in order to predict the development of a cardiovascular event after the occurrence of a myocardial infarction (thus at post-infarction stage), such as cardiac remodeling and cardiac failure. As used herein, the term "medical imaging" refers to the technique and process that is used to visualize the inside of an organism's body (or parts and/or functions thereof), for clinical purposes (e.g. disease diagnosis, prognosis or therapy monitoring) or medical science (e.g. study of anatomy and physiology). Examples of medical imaging methods include invasive techniques, such as intravascular ultrasound (IVUS), as well as non-invasive techniques, such as magnetic resonance imaging (MRI), ultrasound (US) and nuclear imaging. Examples of nuclear imaging include positron emission tomography (PET) and single photon emission computed tomography (SPECT).

The present application thus provides for a novel class of radiotracers specifically targeting a macrophage mannose receptor in view of medical applications in the field of cardiovascular diseases. In the following part, detailed description on the anti-macrophage mannose receptor (anti-MMR) immunoglobulin single variable domain as radiotracers will first be provided.

Anti-macrophage mannose receptor (anti-MMR) immunoglobulin single variable domains

Within the context of the present application, it is envisaged to specifically target a macrophage mannose receptor expressed on a cell surface by making use of immunoglobulin single variable domains. The nature of the macrophage mannose receptor is not critical to the invention. According to a specific embodiment, the targeted macrophage mannose receptor is of mammalian origin. Preferably, the targeted macrophage mannose receptor is a human macrophage mannose receptor (SEQ ID NO: 141). Alternatively, the targeted macrophage mannose receptor is a mouse macrophage mannose receptor (SEQ ID NO: 143). The targeted macrophage mannose receptor may also be a rat macrophage mannose receptor (SEQ ID NO: 147), or a rabbit macrophage mannose receptor (SEQ ID NO: 148). The present application is in its broadest sense not particularly limited to or defined by a specific antigenic determinant, epitope, part, domain, subunit or conformation of the macrophage mannose receptor, and in particular the human macrophage mannose receptor (SEQ ID NO: 141), or mouse macrophage mannose receptor (SEQ ID NO: 143), or rat macrophage mannose receptor (SEQ ID NO: 147), or rabbit macrophage mannose receptor (SEQ ID NO: 148) against which the immunoglobulin single variable domains are directed or to which the immunoglobulin single variable domains will specifically bind. As used herein, the term "macrophage mannose receptor" (MMR) refers to a type I transmembrane protein, first identified in mammalian tissue macrophages and later in dendritic cells and a variety of endothelial and epithelial cells, and is well-known in the art. Macrophages are central actors of the innate and adaptive immune responses. They are disseminated throughout most organs to protect against entry of infectious agents by internalizing and most of the time, killing them. Among the surface receptors present on macrophages, the mannose receptor recognizes a variety of molecular patterns generic to microorganisms. The MMR is composed of a single subunit with N- and O-linked glycosylations and consists of five domains: an N-terminal cysteine-rich region, which recognizes terminal sulfated sugar residues; a fibronectin type II domain with unclear function; a series of eight C- type, lectin-like carbohydrate recognition domains (CRDs) involved in Ca ²⁺ -dependent recognition of mannose, fucose, or /V-acetylglucosamine residues on the envelop of pathogens or on endogenous glycoproteins with CRDs 4-8 showing affinity for ligands comparable with that of intact MMR; a single transmembrane domain; and a 45 residue-long cytoplasmic tail that contains motifs critical for MMR- mediated endocytosis and sorting in endosomes (Chieppa et al. 2003, J Immunol 171: 4552-60). The macrophage mannose receptor as referred to in the present application includes cross-species variants of the MMR protein (e.g. from mouse, rat, rabbit, human, etc.) which are referred to herein as "homologs" of the macrophage mannose receptor. Thus, the macrophage mannose receptor as referred to in the present application includes homologues of a full length MMR protein. Non-limiting examples of homologs of MMRs include the human MMR (synonyms: Mrcl or CD206; accession number nucleotide sequence: NM_002438.2; accession number protein sequence: NP_002429.1 and as in SEQ ID NO: 141), the mouse MMR (synonyms: MRC1 or CD206; accession number nucleotide sequence: NM_008625.2; accession number protein sequence: NP_032651.2 and as in SEQ ID NO: 143), the rat MMR (synonym: MRC1; accession number nucleotide sequence: NM_001106123.1; accession number protein sequence: NP_001099593.1 and as in SEQ ID NO: 147), the rabbit MMR (synonyms: MRC1; accession number nucleotide sequence: NC_013684.1; accession number protein sequence: XP_002717402.1 and as in SEQ ID NO: 148). As an illustrative example, the deduced amino acid sequence of mouse mannose receptor has an overall 82% homology with the human mannose receptor, as can be easily measured in a BLASTp alignment (Altschul et al. 1990, Mol Biol 215: 403-10). The macrophage mannose receptor as referred to in the present invention also includes fragments of the full length MMR protein. A non-limiting example of a fragment of a full length MMR protein includes the ectodomain of a particular MMR. The "ectodomain" as used herein, refers to a fragment of a MMR containing the N-terminus that is cysteine-rich, followed by the fibronectin type II domain and eight carbohydrate recognition domains (CRDs). All of the eight CRDs are particularly well conserved, especially CRD4. For example, mouse CRD4 shows 92% homology with the equivalent region of the human protein. In particular, the ectodomain of the mouse macrophage mannose receptor is defined as the AA 19 - AA 1388 fragment (SEQ ID NO: 146) of the corresponding full length mouse MMR amino acid sequence as defined in NP_032651.2 (SEQ ID NO: 143). Or, the ectodomain of the human macrophage mannose receptor is defined as the AA 19 - AA 1383 fragment (SEQ ID NO: 145) of the corresponding full length human MMR amino acid sequence as defined in NP_002429.1 (SEQ ID NO: 141). For the sake of clarity, the ectodomain of a particular MMR does not comprise the single transmembrane domain nor the cytoplasmice tail of an MMR.

As used herein, the phrasing "anti-macrophage mannose receptor (anti-MMR) immunoglobulin single variable domain" refers to an immunoglobulin single variable domain (as defined further herein) that specifically recognizes a macrophage mannose receptor of choice. As used herein, the term "specifically recognizing" or "specifically binding to" or simply "specific for" refers to the ability of an immunoglobulin single variable domain to preferentially bind to one antigen (in this case the macrophage mannose receptor), versus a different antigen, and does not necessarily imply high affinity. In certain embodiments, a specific binding interaction will discriminate between desirable and undesirable antigens in a sample, in some embodiments more than about 10 to 100-fold or more (e.g., more than about 1000- or 10,000-fold). The terms "specifically bind", "selectively bind", "preferentially bind", and grammatical equivalents thereof, are used interchangeably herein. The term "affinity", as used herein, refers to the degree to which an immunoglobulin single variable domain binds to an antigen so as to shift the equilibrium of antigen and immunoglobulin single variable domain toward the presence of a complex formed by their binding. Thus, for example, where an antigen and antibody (fragment) are combined in relatively equal concentration, an antibody (fragment) of high affinity will bind to the available antigen so as to shift the equilibrium toward high concentration of the resulting complex. The dissociation constant is commonly used to describe the affinity between the antibody (fragment) and the antigenic target. Typically, the dissociation constant is lower than 10 ^s M. Preferably, the dissociation constant is lower than 10 ^"6 M, more preferably, lower than 10 ^"7 M. Most preferably, the dissociation constant is lower than 10 ^s M. An immunoglobulin single variable domain that can specifically bind to and/or that has affinity for a specific antigen or antigenic determinant (e.g. epitope) is said to be "against" or "directed against" said antigen or antigenic determinant. An immunoglobulin single variable domain according to the invention is said to be "cross-reactive" for two or more different antigens or antigenic determinants (such as macrophage mannose receptor from two different species of mammal, such as human MMR and mouse MMR) if it is specific for both these different antigens or antigenic determinants. It will thus be appreciated that, according to the invention, immunoglobulin single variable domains that are directed against a macrophage mannose receptor from one species may or may not show cross-reactivity with a macrophage mannose receptor from another species. For example, immunoglobulin single variable domains directed against MMR, in particular human MMR (SEQ ID NO: 141) may or may not show cross-reactivity with a MM from one or more other species of animals that are often used in animal models for diseases (for example, mouse, rat, rabbit, pig or dog). It will be clear to the skilled person that such cross-reactivity, when present, may have advantages for diagnostic and/or therapeutic development, since it allows the immunoglobulin single variable domains to be tested in such disease models. It is expected that the immunoglobulin single variable domains according to the invention will generally bind to all naturally occurring or synthetic analogs, variants, mutants, alleles of the MM s mentioned herein.

According to a specific embodiment, the immunoglobulin single variable domain specifically binds to the ectodomain of a macrophage mannose receptor, and in particular the ectodomain of the mouse macrophage mannose receptor, the ectodomain of the rat macrophage mannose receptor, the ectodomain of the rabbit macrophage mannose receptor and/or the ectodomain of the human macrophage mannose receptor (see Table 11).

As used herein, the term "immunoglobulin single variable domain" defines molecules wherein the antigen binding site is present on, and formed by, a single immunoglobulin domain (which is different from conventional immunoglobulins or their fragments, wherein typically two immunoglobulin variable domains interact to form an antigen binding site). It should however be clear that the term "immunoglobulin single variable domain" does comprise fragments of conventional immunoglobulins wherein the antigen binding site is formed by a single variable domain. Generally, an immunoglobulin single variable domain will be an amino acid sequence comprising 4 framework regions (FR1 to FR4) and 3 complementary determining regions (CDR1 to CDR3), preferably according to the following formula (1): FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 (1), or any suitable fragment thereof (which will then usually contain at least some of the amino acid residues that form at least one of the complementarity determining regions). Immunoglobulin single variable domains comprising 4 FRs and 3 CDRs are known to the person skilled in the art and have been described, as a non-limiting example, in Wesolowski et al. 2009, Med Microbiol Immunol 198, 157-174.

Typical, but non-limiting, examples of immunoglobulin single variable domains include light chain variable domain sequences (e.g. a VL domain sequence) or a suitable fragment thereof, or heavy chain variable domain sequences (e.g. a VH domain sequence or VHH domain sequence) or a suitable fragment thereof, as long as it is capable of forming a single antigen binding unit. Thus, according to a preferred embodiment, the binding domain moiety is an immunoglobulin single variable domain that is a light chain variable domain sequence (e.g. a VL domain sequence) or a heavy chain variable domain sequence (e.g. a VH domain sequence); more specifically, the immunoglobulin single variable domain is a heavy chain variable domain sequence that is derived from a conventional four-chain antibody or a heavy chain variable domain sequence that is derived from a heavy chain antibody. The immunoglobulin single variable domain may be a domain antibody, or a single domain antibody, or a "dAB" or dAb, or a Nanobody (as defined herein), or another immunoglobulin single variable domain, or any suitable fragment of any one thereof. For a general description of single domain antibodies, reference is made to the following book: "Single domain antibodies", Methods in Molecular Biology, Eds. Saerens and Muyldermans, 2012, Vol 911. The immunoglobulin single variable domains, generally comprise a single amino acid chain that can be considered to comprise 4 "framework sequences" or F 's and 3 "complementary determining regions" or CDR's (as defined hereinbefore). It should be clear that framework regions of immunoglobulin single variable domains may also contribute to the binding of their antigens (Desmyter et al 2002, J Biol Chem 277: 23645-50; Korotkov et al. 2009, Structure 17: 255-65). The delineation of the CDR sequences (and thus also the FR sequences) can be based on the IMGT unique numbering system for V-domains and V-like domains (Lefranc et al. 2003, Develop Comparat Immunol 27: 55-77). Alternatively, the delineation of the FR and CDR sequences can be done by using the Kabat numbering system as applied to VHH domains from Camelids in the article of Riechmann and Muyldermans 2000, J Immunol Methods 240: 185-195.

It should be noted that the immunoglobulin single variable domains in their broadest sense are not limited to a specific biological source or to a specific method of preparation. The term "immunoglobulin single variable domain" encompasses variable domains of different origin, comprising mouse, rat, rabbit, donkey, human, shark, camelid variable domains. According to specific embodiments, the immunoglobulin single variable domains are derived from shark antibodies (the so- called immunoglobulin new antigen receptors or IgNARs), more specifically from naturally occuring heavy chain shark antibodies, devoid of light chains, and are known as VNAR domain sequences. Preferably, the immunoglobulin single variable domains are derived from camelid antibodies. More preferably, the immunoglobulin single variable domains are derived from naturally occurring heavy chain camelid antibodies, devoid of light chains, and are known as VHH domain sequences or Nanobodies.

A preferred immunoglobulin single variable domain within the scope of the present application is a Nanobody (as defined further herein, and including but not limited to a VHH). The term "Nanobody" (Nb), as used herein, is a single domain antigen binding fragment. It particularly refers to a single variable domain derived from naturally occurring heavy chain antibodies and is known to the person skilled in the art. Nanobodies are usually derived from heavy chain only antibodies (devoid of light chains) seen in camelids (Hamers-Casterman et al. 1993, Nature 363: 446-448; Desmyter et al. 1996, Nat Struct Biol 803-811) and consequently are often referred to as VHH antibody or VHH sequence. Camelids comprise old world camelids (Camelus bactrianus and Camelus dromedarius) and new world camelids (for example Lama paccos, Lama glama, Lama guanicoe and Lama vicugna). Nanobody ^® and Nanobodies ^® are registered trademarks of Ablynx NV (Belgium). For a further description of VHH's or Nanobodies, reference is made to the book "Single domain antibodies", Methods in Molecular Biology, Eds. Saerens and Muyldermans, 2012, Vol 911, in particular to the Chapter by Vincke and Muyldermans (2012), as well as to a non-limiting list of patent applications, which are mentioned as general background art, and include: WO 94/04678, WO 95/04079, WO 96/34103 of the Vrije Universiteit Brussel; WO 94/25591, WO 99/37681, WO 00/40968, WO 00/43507, WO 00/65057, WO 01/40310, WO 01/44301, EP 1 134 231 and WO 02/48193 of Unilever; WO 97/49805, WO 01/21817, WO 03/035694, WO 03/054016 and WO 03/055527 of the Vlaams Instituut voor Biotechnologie (VIB); WO 04/041867, WO 04/041862, WO 04/041865, WO 04/041863, WO 04/062551, WO 05/044858, WO 06/40153, WO 06/079372, WO 06/122786, WO 06/122787 and WO 06/122825, by Ablynx N.V. and the further published patent applications by Ablynx N .V. As will be known by the person skilled in the art, the Nanobodies are particularly characterized by the presence of one or more Camelidae "hallmark residues" in one or more of the framework sequences (according to Kabat numbering), as described for example in WO 08/020079, on page 75, Table A-3, incorporated herein by reference). It should be noted that the Nanobodies, of the invention in their broadest sense are not limited to a specific biological source or to a specific method of preparation. For example, Nanobodies, can generally be obtained: (1) by isolating the VHH domain of a naturally occurring heavy chain antibody; (2) by expression of a nucleotide sequence encoding a naturally occurring VHH domain; (3) by "humanization" of a naturally occurring VHH domain or by expression of a nucleic acid encoding a such humanized VHH domain; (4) by "camelization" of a naturally occurring VH domain from any animal species, and in particular from a mammalian species, such as from a human being, or by expression of a nucleic acid encoding such a camelized VH domain; (5) by "camelisation" of a "domain antibody" or "Dab" as described in the art, or by expression of a nucleic acid encoding such a camelized VH domain; (6) by using synthetic or semi-synthetic techniques for preparing proteins, polypeptides or other amino acid sequences known per se; (7) by preparing a nucleic acid encoding a Nanobody using techniques for nucleic acid synthesis known per se, followed by expression of the nucleic acid thus obtained; and/or (8) by any combination of one or more of the foregoing. A further description of Nanobodies, including humanization and/or camelization of Nanobodies, can be found e.g. in WO08/101985 and WO08/142164, as well as further herein.

Within the scope of the present application, the term "immunoglobulin single variable domain" also encompasses variable domains that are "humanized" or "camelized", in particular Nanobodies that are "humanized" or "camelized". For example both "humanization" and "camelization" can be performed by providing a nucleotide sequence that encodes a naturally occurring V _H H domain or VH domain, respectively, and then changing, in a manner known per se, one or more codons in said nucleotide sequence in such a way that the new nucleotide sequence encodes a "humanized" or "camelized" immunoglobulin single variable domains of the invention, respectively. This nucleic acid can then be expressed in a manner known per se, so as to provide the desired immunoglobulin single variable domains of the invention. Alternatively, based on the amino acid sequence of a naturally occurring V _H H domain or VH domain, respectively, the amino acid sequence of the desired humanized or camelized immunoglobulin single variable domains of the invention, respectively, can be designed and then synthesized de novo using techniques for peptide synthesis known per se. Also, based on the amino acid sequence or nucleotide sequence of a naturally occurring V _H H domain or VH domain, respectively, a nucleotide sequence encoding the desired humanized or camelized immunoglobulin single variable domains of the invention, respectively, can be designed and then synthesized de novo using techniques for nucleic acid synthesis known per se, after which the nucleic acid thus obtained can be expressed in a manner known per se, so as to provide the desired immunoglobulin single variable domains of the invention. Other suitable methods and techniques for obtaining the immunoglobulin single variable domains of the invention and/or nucleic acids encoding the same, starting from naturally occurring VH sequences or preferably V _H H sequences, will be clear from the skilled person, and may for example comprise combining one or more parts of one or more naturally occurring VH sequences (such as one or more FR sequences and/or CDR sequences), one or more parts of one or more naturally occurring V _H H sequences (such as one or more FR sequences or CDR sequences), and/or one or more synthetic or semi-synthetic sequences, in a suitable manner, so as to provide a Nanobody of the invention or a nucleotide sequence or nucleic acid encoding the same.

Non-limiting examples of Nanobodies within the scope of the present application are as described herein and include anti-human, anti-mouse and cross-reactive anti-human/anti-mouse MMR Nanobodies. For example in Table 1, in particular SEQ ID NO: 1-7; in Table 10, in particular SEQ ID NOs: 8-37). In a specific embodiment, the Nanobodies of the present invention may comprise at least one of the complementarity determining regions (CDRs) as described herein, for example CDRs with an amino acid sequence selected from SEQ ID NOs: 38-69 (CDR1), SEQ ID Nos: 70-101 (CDR2), SEQ ID Nos: 102- 133 (CDR3) (see Tables 1, 10). Preferably, the Nanobodies of the present invention comprise a CDR1, a CDR2 and a CDR3 selected from the group consisting of SEQ ID NOs: 38-133 according to the above described formula (1). More specifically, the Nanobodies can be selected from the group comprising SEQ ID NOs: 1-37, or a functional fragment thereof. A "functional fragment" or a "suitable fragment", as used herein, may for example comprise one of the CDR loops. Preferably, said functional fragment comprises CDR3. More specifically, said Nanobodies consist of any of SEQ ID NO: 1-37. Also within the scope of the application are natural or synthetic analogs, mutants, variants, alleles, parts or fragments (herein collectively referred to as "variants") of the immunoglobulin single variable domains, in particular the Nanobodies, as defined herein, and in particular variants of the immunoglobulin single variable domains of SEQ ID NOs: 1-37 (see Tables 1, 10). Thus, according to one embodiment of the invention, the term "immunoglobulin single variable domain of the invention" or "Nanobody of the invention" in its broadest sense also covers such variants. Generally, in such variants, one or more amino acid residues may have been replaced, deleted and/or added, compared to the immunoglobulin single variable domains of the invention as defined herein. Such substitutions, insertions or deletions may be made in one or more of the FR's and/or in one or more of the CDR's, and in particular variants of the FR's and CDR's of the immunoglobulin single variable domains of SEQ ID NOs: 1-37 (see Tables 1, 10). Variants, as used herein, are sequences wherein each or any framework region and each or any complementarity determining region shows at least 80% identity, preferably at least 85% identity, more preferably 90% identity, even more preferably 95% identity or, still even more preferably 99% identity with the corresponding region in the reference sequence (i.e. FRl_variant versus FRl_reference, CDRl_variant versus CDRl_reference, FR2_variant versus FR2_reference, CDR2_variant versus CDR2_reference, FR3_variant versus FR3_reference, CDR3_variant versus CDR3_reference, FR4_variant versus FR4_reference), as can be measured electronically by making use of algorithms such as PILEUP and BLAST (50, 51). Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (http://www/ncbi.nlm.nih.gov/). It will be understood that for determining the degree of amino acid identity of the amino acid sequences of the CDRs of one or more sequences of the immunoglobulin single variable domains, the amino acid residues that form the framework regions are disregarded. Similarly, for determining the degree of amino acid identity of the amino acid sequences of the FRs of one or more sequences of the immunoglobulin single variable domains of the invention, the amino acid residues that form the complementarity regions are disregarded. Such variants of immunoglobulin single variable domains may be of particular advantage since they may have improved potency/affinity.

By means of non-limiting examples, a substitution may for example be a conservative substitution (as described herein) and/or an amino acid residue may be replaced by another amino acid residue that naturally occurs at the same position in another V _H H domain. Thus, any one or more substitutions, deletions or insertions, or any combination thereof, that either improve the properties of the Nanobody of the invention or that at least do not detract too much from the desired properties or from the balance or combination of desired properties of the Nanobody of the invention (i.e. to the extent that the Nanobody is no longer suited for its intended use) are included within the scope of the invention. A skilled person will generally be able to determine and select suitable substitutions, deletions or insertions, or suitable combinations of thereof, based on the disclosure herein and optionally after a limited degree of routine experimentation, which may for example involve introducing a limited number of possible substitutions and determining their influence on the properties of the Nanobodies thus obtained. According to particularly preferred embodiments, variants of the immunoglobulin single variable domains, in particular the Nanobodies of the present application may have a substitution, deletion or insertion, of 1, 2 or 3 amino acids in one, two or three of the CDRs, more specifically (i) in CDR1 or CDR2 or CDR3; (ii) in CDR1 and CDR2, or, in CDR1 and CDR3, or, in CDR2 and CDR3; (iii) in CDR1 and CDR2 and CDR3, as listed in Table 10. More preferably, variants of the immunoglobulin single variable domains, in particular the Nanobodies, of the present invention may have a conservative substitution (as defined herein) of 1, 2 or 3 amino acids in one, two or three of the CDRs, more specifically (i) in CDR1 or CDR2 or CDR3; (ii) in CDR1 and CDR2, or, in CDR1 and CDR3, or, in CDR2 and CDR3; (iii) in CDR1 and CDR2 and CDR3, as listed in Table 10.

Also encompassed within the scope of the present application are immunoglobulin single variable domains that are in a "multivalent" form and are formed by bonding, chemically or by recombinant DNA techniques, together two or more monovalent immunoglobulin single variable domains. Non- limiting examples of multivalent constructs include "bivalent" constructs, "trivalent" constructs, "tetravalent" constructs, and so on. The immunoglobulin single variable domains comprised within a multivalent construct may be identical or different. In another particular embodiment, the immunoglobulin single variable domains of the invention are in a "multispecific" form and are formed by bonding together two or more immunoglobulin single variable domains, of which at least one with a different specificity. Non-limiting examples of multi-specific constructs include "bi-specific" constructs, "tri-specific" constructs, "tetra-specific" constructs, and so on. To illustrate this further, any multivalent or multispecific (as defined herein) immunoglobulin single variable domain of the invention may be suitably directed against two or more different epitopes on the same antigen, for example against two or more different epitopes of the MMR; or may be directed against two or more different antigens, for example against an epitope of the MMR and an epitope of vascular cell adhesion molecule 1 (VCAM-1). In particular, a monovalent immunoglobulin single variable domain of the invention is such that it will bind to the target with an affinity less than 500 nM, preferably less than 200 nM, more preferably less than 10 nM, such as less than 500 pM. Multivalent or multispecific immunoglobulin single variable domains of the invention may also have (or be engineered and/or selected for) increased avidity and/or improved selectivity for the desired MMR, and/or for any other desired property or combination of desired properties that may be obtained by the use of such multivalent or multispecific immunoglobulin single variable domains. Further, and depending on the host organism used to express the immunoglobulin single variable domain, deletions and/or substitutions within the immunoglobulin single variable domain may be designed in such a way that e.g. one or more sites for post-translational modification (such as one or more glycosylation sites) are removed, as will be within the ability of the person skilled in the art. Alternatively, substitutions or insertions may be designed so as to introduce one or more sites for attachment of functional groups (as described further herein).

Screening and selection of suitable immunoglobulin single variable domains

A preferred class of immunoglobulin single variable domains is directed against and/or specifically binds to an MM (as described hereinbefore). Immunoglobulin single variable domains can be identified in several ways, and will be illustrated hereafter in a non-limiting way for VHHs. VHH sequences can generally be generated or obtained by suitably immunizing a species of Camelid with a MMR, (i.e. so as to raise an immune response and/or heavy chain antibodies directed against a MMR), by obtaining a suitable biological sample from said Camelid (such as a blood sample, or any sample of B-cells), and by generating V _H H sequences directed against a MMR, starting from said sample, using any suitable technique known per se. Such techniques will be clear to the skilled person. Alternatively, such naturally occurring V _H H domains against MMR can be obtained from naive libraries of Camelid V _H H sequences, for example by screening such a library using MMR or at least one part, fragment, antigenic determinant or epitope thereof using one or more screening techniques known per se. Such libraries and techniques are for example described in W09937681, WO0190190, WO03025020 and WO03035694. Alternatively, improved synthetic or semi-synthetic libraries derived from naive V _H H libraries may be used, such as V _H H libraries obtained from naive V _H H libraries by techniques such as random mutagenesis and/or CDR shuffling, as for example described in WO0043507. Yet another technique for obtaining V _H H sequences directed against a MMR involves suitably immunizing a transgenic mammal that is capable of expressing heavy chain antibodies (i.e. so as to raise an immune response and/or heavy chain antibodies directed against a MMR), obtaining a suitable biological sample from said transgenic mammal (such as a blood sample, or any sample of B-cells), and then generating V _H H sequences directed against a MMR starting from said sample, using any suitable technique known per se. For example, for this purpose, the heavy chain antibody-expressing mice and the further methods and techniques described in WO02085945 and in WO04049794 can be used. Accordingly, the application encompasses methods of generating immunoglobulin single variable domains according to the invention. As a non-limiting example, a method is provided of generating Nanobodies directed against or specifically binding to the macrophage mannose receptor (as described herein), comprising (i) immunizing an animal with a MM , in particular a mouse (SEQ ID NOs: 143) or human MMR (SEQ ID NOs: 141), or a fragment thereof; and

(ii) screening for Nanobodies specifically binding to said MMR.

For the immunization of an animal with a MMR, the MMR may be produced and purified using conventional methods that may employ expressing a recombinant form of the MMR in a host cell, and purifying the MMR using affinity chromatography and/or antibody-based methods. Any suitable animal, e.g., a warm-blooded animal, in particular a mammal such as a rabbit, mouse, rat, camel, sheep, cow, shark, pig, or a bird such as a chicken or turkey, may be immunized using any of the techniques well known in the art suitable for generating an immune response. The screening for Nanobodies, as a non-limiting example, specifically binding to a MMR may for example be performed by screening a set, collection or library of cells that express heavy chain antibodies on their surface (e.g. B-cells obtained from a suitably immunized Camelid), or bacteriophages that display a fusion of genlll and Nanobody at their surface, by screening of a (naive or immune) library of V _H H sequences or Nanobody sequences, or by screening of a (naive or immune) library of nucleic acid sequences that encode VHH sequences or Nanobody sequences, which may all be performed in a manner known per se, and which method may optionally further comprise one or more other suitable steps, such as, for example and without limitation, a step of affinity maturation, a step of expressing the desired amino acid sequence, a step of screening for binding and/or for activity against the desired antigen (in this case, the MMR), a step of determining the desired amino acid sequence or nucleotide sequence, a step of introducing one or more humanizing substitutions, a step of formatting in a suitable multivalent and/or multispecific format, a step of screening for the desired biological and/or physiological properties (i.e. using a suitable assay known in the art), and/or any combination of one or more of such steps, in any suitable order.

Modifications of anti-MMR immunoglobulin single variable domains

The immunoglobulin single variable domains within the scope of the application may be further modified and/or may comprise (or can be further fused to) other moieties, as described further herein. Examples of modifications, as well as examples of amino acid residues within the immunoglobulin single variable domain, preferably the Nanobody sequence, that can be modified (i.e. either on the protein backbone but preferably on a side chain), methods and techniques that can be used to introduce such modifications and the potential uses and advantages of such modifications will be clear to the skilled person. For example, such a modification may involve the introduction (e.g. by covalent linking or in another suitable manner) of one or more functional groups, residues or moieties into or onto the immunoglobulin single variable domain of the invention, and in particular of one or more functional groups, residues or moieties that confer one or more desired properties or functionalities to the immunoglobulin single variable domain of the invention. Examples of such functional groups and of techniques for introducing them will be clear to the skilled person, and can generally comprise all functional groups and techniques mentioned in the general background art cited hereinabove as well as the functional groups and techniques known per se for the modification of pharmaceutical proteins, and in particular for the modification of antibodies or antibody fragments (including ScFv's and single domain antibodies), for which reference is for example made to Remington's Pharmaceutical Sciences, 16th ed., Mack Publishing Co., Easton, PA (1980). Such functional groups may for example be linked directly (for example covalently) to a immunoglobulin single variable domain of the invention, or optionally via a suitable linker or spacer, as will again be clear to the skilled person. One of the most widely used techniques for increasing the half-life and/or reducing immunogenicity of pharmaceutical proteins comprises attachment of a suitable pharmacologically acceptable polymer, such as poly(ethyleneglycol) (PEG) or derivatives thereof (such as methoxypoly(ethyleneglycol) or mPEG). Generally, any suitable form of pegylation can be used, such as the pegylation used in the art for antibodies and antibody fragments (including but not limited to (single) domain antibodies and ScFv's); reference is made to for example Chapman, Nat. Biotechnol., 54, 531-545 (2002); by Veronese and Harris, Adv. Drug Deliv. Rev. 54, 453-456 (2003), by Harris and Chess, Nat. Rev. Drug. Discov., 2, (2003) and in WO04060965. Various reagents for pegylation of proteins are also commercially available, for example from Nektar Therapeutics, USA. Preferably, site-directed pegylation is used, in particular via a cysteine-residue (see for example Yang et al., Protein Engineering, 16, 10, 761-770 (2003). For example, for this purpose, PEG may be attached to a cysteine residue that naturally occurs in an immunoglobulin single variable domain, or the immunoglobulin single variable domain may be modified so as to suitably introduce one or more cysteine residues for attachment of PEG, or an amino acid sequence comprising one or more cysteine residues for attachment of PEG may be fused to the N- and/or C-terminus of an immunoglobulin single variable domain, all using techniques of protein engineering known per se to the skilled person. Preferably, for the immunoglobulin single variable domains of the invention, a PEG is used with a molecular weight of more than 5000, such as more than 10,000 and less than 200,000, such as less than 100,000; for example in the range of 20,000-80,000. Another, usually less preferred modification comprises N-linked or O-linked glycosylation, usually as part of co-translational and/or post-translational modification, depending on the host cell used for expressing the immunoglobulin single variable domain or polypeptide of the invention. Another technique for increasing the half-life of an immunoglobulin single variable domain may comprise the engineering into bifunctional constructs (for example, one Nanobody against the target MMR and one against a serum protein such as albumin) or into fusions of immunoglobulin single variable domains with peptides (for example, a peptide against a serum protein such as albumin). Yet another modification may comprise the introduction of one or more detectable labels or other signal-generating groups or moieties, depending on the intended use of the labelled immunoglobulin single variable domain. Suitable labels and techniques for attaching, using and detecting them will be clear to the skilled person, and for example include, but are not limited to, fluorescent labels, (such as I Dye800, VivoTag800, fluorescein, isothiocyanate, rhodamine, phycoerythrin, phycocyanin, allophycocyanin, o-phthaldehyde, and fluorescamine and fluorescent metals such as Eu or others metals from the lanthanide series), phosphorescent labels, chemiluminescent labels or bioluminescent labels (such as luminal, isoluminol, theromatic acridinium ester, imidazole, acridinium salts, oxalate ester, dioxetane or GFP and its analogs ), radio-isotopes, metals, metals chelates or metallic cations or other metals or metallic cations that are particularly suited for use in in vivo, in vitro or in situ diagnosis and imaging, as well as chromophores and enzymes (such as malate dehydrogenase, staphylococcal nuclease, delta- V- steroid isomerase, yeast alcohol dehydrogenase, alpha-glycerophosphate dehydrogenase, triose phosphate isomerase, biotinavidin peroxidase, horseradish peroxidase, alkaline phosphatase, asparaginase, glucose oxidase, beta-galactosidase, ribonuclease, urease, catalase, glucose-VI-phosphate dehydrogenase, glucoamylase and acetylcholine esterase). Other suitable labels will be clear to the skilled person, and for example include moieties that can be detected using NMR or ESR spectroscopy. Such labelled Nanobodies and polypeptides of the invention may for example be used for in vitro, in vivo or in situ assays (including immunoassays known per se such as ELISA, RIA, EIA and other "sandwich assays", etc.) as well as in vivo diagnostic and imaging purposes, depending on the choice of the specific label. As will be clear to the skilled person, another modification may involve the introduction of a chelating group, for example to chelate one of the metals or metallic cations referred to above. Suitable chelating groups for example include, without limitation, 2,2',2"-(10-(2- ((2,5-dioxopyrrolidin-l-yl)oxy)-2-oxoethyl)-l,4,7,10-tetraaz acyclododecane-l,4,7-triyl)triacetic acid (DOTA), 2,2'-(7-(2-((2,5-dioxopyrrolidin-l-yl)oxy)-2-oxoethyl)-l,4,7 -triazonane-l,4-diyl)diacetic acid (NOTA), diethyl- enetriaminepentaacetic acid (DTPA) or ethylenediaminetetraacetic acid (EDTA). Yet another modification may comprise the introduction of a functional group that is one part of a specific binding pair, such as the biotin-(strept)avidin binding pair. Such a functional group may be used to link the immunoglobulin single variable domain to another protein, polypeptide or chemical compound that is bound to the other half of the binding pair, i.e. through formation of the binding pair. For example, a Nanobody of the invention may be conjugated to biotin, and linked to another protein, polypeptide, compound or carrier conjugated to avidin or streptavidin. For example, such a conjugated Nanobody may be used as a reporter, for example in a diagnostic system where a detectable signal- producing agent is conjugated to avidin or streptavidin. Such binding pairs may for example also be used to bind the Nanobody of the invention to a carrier, including carriers suitable for pharmaceutical purposes. One non-limiting example are the liposomal formulations described by Cao and Suresh, Journal of Drug Targetting, 8, 4, 257 (2000). Such binding pairs may also be used to link a therapeutically active agent to the Nanobody of the invention.

According to a preferred embodiment, the anti-MMR immunoglobulin single variable domain as used in the present application is coupled or fused to a detectable label, either directly or through a linker. Preferably, the detectable label is a radio-isotope, in particular a radioactive tracer suitable for medical applications, such as in in vivo nuclear imaging. Examples include, without the purpose of being limitative, technetium 99m ( ^99m Tc), iodium 123 ( ¹²³ l), zirconium 89 ( ⁸⁹ Zr), iodium 125 ( ¹²⁵ l), indium 111 ( ^m ln), fluor 18 ( ¹⁸ F), copper 64 ( ⁶⁴ Cu), gallium 67 ( ⁶⁷ Ga), gallium 68 ( ⁶⁸ Ga), and any other radio-isotope which can be used in animals, in particular mouse, rabbit or human. According to a specific embodiment, the detectable label is ^99m Tc.

In another preferred embodiment, the immunoglobulin single variable domain as used in the present invention is coupled to or fused to a moiety, in particular a therapeutically active agent, either directly or through a linker. As used herein, a "therapeutically active agent" means any molecule that has or may have a therapeutic effect (i.e. curative or stabilizing effect) in the context of treatment of a cardiovascular disease, in particular of atherosclerosis, preferably vulnerable plaques, or of a postinfarction event such as cardiac remodeling or heart failure.

Preferably, a therapeutically active agent is a disease-modifying agent, which can be a cytotoxic agent, such as a toxin, or a cytotoxic drug, or an enzyme capable of converting a prodrug into a cytotoxic drug, or a radionuclide, or a cytotoxic cell, or which can be a non-cytotoxic agent. Even more preferably, a therapeutically active agent has a curative effect on the disease.

Alternatively, a therapeutically active agent is a disease-stabilizing agent, in particular a molecule that has a stabilizing effect on the evolution of a cardiovascular disease, in particular atherosclerosis, and more specifically, a stabilizing effect on vulnerable atherosclerotic plaques. Examples of stabilizing agents include anti-inflammatory agents, in particular non-steroid anti-inflammatory molecules. According to one specific embodiment, the therapeutically active agent is not a cytotoxic agent.

Linker molecules

Preferred "linker molecules" or "linkers" are peptides of 1 to 200 amino acids length, and are typically, but not necessarily, chosen or designed to be unstructured and flexible. For instance, one can choose amino acids that form no particular secondary structure. Or, amino acids can be chosen so that they do not form a stable tertiary structure. Or, the amino acid linkers may form a random coil. Such linkers include, but are not limited to, synthetic peptides rich in Gly, Ser, Thr, Gin, Glu or further amino acids that are frequently associated with unstructured regions in natural proteins (Dosztanyi, Z., Csizmok, V., Tompa, P., & Simon, I. (2005). lUPred: web server for the prediction of intrinsically unstructured regions of proteins based on estimated energy content. Bioinformatics (Oxford, England), 21(16), 3433- 4.). Non-limiting examples of suitable linker sequences include (GS) ₅ (GSGSGSGSGS; SEQ ID NO: 149), (GS) ₁₀ (GSGSGSGSGSGSGSGSGSGS; SEQ ID NO: 150), (G ₄ S) ₃ (GGGGSGGGGSGGGGS; SEQ ID NO: 151), llama lgG2 hinge (AHHSEDPSSKAPKAPMA; SEQ ID NO: 152) or human IgA hinge (SPSTPPTPSPSTPPAS; SEQ ID NO: 153) linkers. Other non-limiting examples of suitable linker sequences are also described in the Example section. Thus, according to specific embodiments, the amino acid (AA) linker sequence is a peptide of between 0 and 200 AA, between 0 and 150 AA, between 0 and 100 AA, between 0 and 90 AA, between 0 and 80 AA, between 0 and 70 AA, between 0 and 60 AA, between 0 and 50 AA, between 0 and 40 AA, between 0 and 30 amino acids, between 0 and 20 AA, between 0 and 10 amino acids, between 0 and 5 amino acids. Examples of sequences of short linkers include, but are not limited to, PPP, PP or GS. For certain applications, it may be advantageous that the linker molecule comprises or consists of one or more particular sequence motifs. For example, a proteolytic cleavage site can be introduced into the linker molecule such that detectable label or moiety can be released. Useful cleavage sites are known in the art, and include a protease cleavage site such as Factor Xa cleavage site having the sequence IEGR (SEQ ID NO: 154), the thrombin cleavage site having the sequence LVPR (SEQ ID NO: 155), the enterokinase cleaving site having the sequence DDDDK (SEQ ID NO: 156), or the PreScission cleavage site LEVLFQGP (SEQ ID NO: 157).

Alternatively, in case the immunoglobulin single variable domain is linked to a detectable label or moiety using chemoenzymatic methods for protein modification, the linker moiety may exist of different chemical entities, depending on the enzymes or the synthetic chemistry that is used to produce the covalently coupled molecule in vivo or in vitro (reviewed in: Rabuka 2010, Curr Opin Chem Biol 14: 790-796).

Diagnosis, prognosis and monitoring therapy of cardiovascular diseases

One aspect of the present application relates to an anti-MMR immunoglobulin single variable domain for use in diagnosing or prognosing a cardiovascular disease. In a preferred embodiment, the application envisages an anti-MMR immunoglobulin single variable domain for use in diagnosing or prognosing atherosclerosis or coronary heart disease. Within the context of the present invention, the term "cardiovascular disease", refers to an illness, injury, or symptoms related to an atherogenic process affecting the cardiovascular system. This includes the different stages marking the development of atherosclerotic plaques (different stages of plaques are classified according to guidelines such as those from the American Heart Association: neo- intimal, atheromatous, fibroatheromatous and collagen-rich lesions), as well as complications arising from the formation of an atherosclerotic plaque (stenosis, ischemia) and / or the rupture of an atherosclerotic plaque (thrombosis, embolism, myocardial infarction, arterial rupture, acute ischemic stroke). Cardiovascular disease refers for example to atherosclerosis, atherosclerotic plaques, especially the vulnerable plaques, coronary heart disease, thrombosis, stroke, myocardial infarction, vascular stenosis. Cardiovascular disease also refers to downstream complications of myocardial infarction or "post-infarction" complications due to ruptured plaques, including cardiac remodeling and cardiac failure.

"Atherosclerosis" herein refers to a disease affecting arterial blood vessels. Atherosclerosis can be characterized by a chronic inflammatory response in the walls of arteries, mainly due to the accumulation of macrophages and promoted by low density lipoproteins. The appearance of atherosclerotic plaques is a marker of atherosclerosis (also known as arteriosclerotic vascular disease or ASVD), which in itself is a typical cardiovascular disease and may lead to different cardiovascular complications (as described further herein). As used herein, the term "atherosclerotic plaque", refers to a deposit of fat and other substances that accumulate in the lining of the artery wall. The terms "vulnerable atherosclerotic plaque" or "instable atherosclerotic plaque" are used interchangeably herein and refer to atherosclerotic plaques with high likelihood of rapid progression and cardiovascular disease manifestations, including myocardial infarction and/or acute ischemic stroke. Unstable plaques are characterized by a large, soft lipid core that contains extracellular lipids and is covered by a thin fibrous cap, as well as an abundance of invasive inflammatory cells such as macrophages. In contrast, stable plaques have a small lipid core, thick fibrous caps, and little or no macrophage invasion with the development of fibrous tissue resulting in intimal thickening of the vessel. Atherosclerotic plaques formed by lipid accumulation in vessel lesions have a variety of characteristics, ranging from stable to unstable. Unstable plaques are prone to rupture followed by thrombus formation, vessel stenosis, and occlusion and frequently lead to acute myocardial infarction (AMI) and brain infarction. Thus, the specific diagnosis of unstable plaques would enable preventive treatments for AMI and brain infarction and represents a promising diagnostic target in clinical settings.

"Coronary heart disease" is the most common manifestation of cardiovascular disease. It is a progressive disease, due to poor irrigation of the heart muscle, and related to narrowing (stenosis) or calcification (sclerosis) of one or more coronary arteries. The complete blockage of one or more coronary arteries leads to a myocardial infarction.

The term "infarction" refers to a confined focal necrosis due to arterial obstruction. More specifically, myocardial infarction is myocardial necrosis, which usually results from acute coronary thrombosis following the rupture of a plaque (usually a vulnerable plaque), causing platelet aggregation and coronary occlusion.

The presence of a coronary plaque, especially if it is an unstable plaque, exposes the subject to a risk of myocardial infarction. The immunoglobulin single variable domains of the invention may therefore be used to detect a risk of occurrence of myocardial infarction in a patient.

"Risk of occurrence" is herein defined as the probability that an individual develops a disease.

"Acute ischemic stroke" refers to a decrease in the arterial blood supply to an area of the body. Its main causes are local thrombosis and embolism.

The term "thrombosis" refers to blood clotting in the vascular cavities (arteries, veins, capillaries and heart chambers) leading to the formation of a thrombus.

"Embolism" is the migration of an object, usually formed by a blood clot (thrombus), and its sudden stop in a vessel whose diameter is insufficient to let it pass. Local consequences of embolism are circulatory disturbances related to the vascular obstruction, most often leading to a heart attack.

The plaque can also be located at a carotid artery. These lesions lead to stroke, hemorrhagic events (aneurysm) or ischemic events (cerebral infarction). Therefore, the immunoglobulin single variable domains of the invention may be used to detect a risk of developing a stroke in a patient.

The plaque may also be located at a renal artery, the kidney being one of the target organs of atherosclerosis. Significant stenosis can lead to hypertension and/or renal failure. The atheromatous renal artery can also lead to an acute vascular event or kidney embolism. The immunoglobulin single variable domains of the invention can therefore also be used to detect a risk of occurrence of renal embolism in a patient.

Atherosclerotic plaques can also be located in the arteries of the lower limbs (risk of acute limb ischemia) or aorta (risk of aneurysm / dissection). The immunoglobulin single variable domains of the invention may be used to detect a risk of occurrence of limb ischemia or rupture of aortic aneurysm in a patient. The term "cardiac remodeling" or "ventricular remodeling" refers to the changes in size, shape, structure and physiology of the heart after injury to the myocardium. The injury is typically due to acute myocardial infarction, but may be from a number of causes that result in increased pressure or volume overload (forms of strain) on the heart. Cardiac remodeling implies a decline in function. Cardiac remodeling is generally accepted as a determinant of the clinical course of cardiac failure.

The term "heart failure" or "cardiac failure", often called congestive heart failure or congestive cardiac failure, occurs when the heart is unable to provide sufficient pump action to maintain blood flow to meet the needs of the body. Common causes of heart failure include myocardial infarction and other forms of coronary artery disease, hypertension, valvular heart disease, and cardiomyopathy. As used herein, the term "diagnosing" or grammatically equivalent wordings, means determining whether or not a subject suffers from a particular disease or disorder. As used herein, "prognosing" or grammatically equivalent wordings, means determining whether or not a subject has a risk of developing a particular disease or disorder.

Within the present context, the anti-MM immunoglobulin single variable domains as described hereinbefore are particularly useful as contrast agent in non-invasive in vivo medical imaging, in particular for the targeting and/or detection of vulnerable atherosclerotique plaques. Preferably, a nuclear imaging approach is used. According to one specific embodiment, positron emission tomography (PET) is used for in vivo imaging with labelled anti-MMR anti-MMR immunoglobulin single variable domains. Alternatively, single photon emission computed tomography (SPECT) is used as in vivo imaging approach. Thus, in one embodiment, the anti-MMR immunoglobulin single variable domains as described hereinbefore are coupled to a detectable label, preferably a radioisotope. According to one embodiment, the diagnosing and/or prognosing of a cardiovascular disease, in particular atherosclerosis, will preferably be done by detecting the presence or absence of atherosclerotic plaques, in particular vulnerable atherosclerotic plaques. It may be of additional advantage that the evolution of the degree of vulnerability of atherosclerotic plaques can be monitored in function of time. More specifically, the present invention allows to monitor progression or regression of vulnerability of atherosclerotic plaques in function of time. Hereby, different stages of plaques are classified according to guidelines such as those from the American Heart Association: neo- intimal, atheromatous, fibroatheromatous and collagen-rich lesions. A further advantage of the present invention is the possibility to assess the impact of a therapy on atherosclerosis and/or the degree of vulnerability of atherosclerotic plaques and/or the evolution in function of time of the degree of vulnerability of atherosclerotic plaques, by making use of the anti-MMR immunoglobulin single variable domains as described hereinbefore. Also provided is a method of diagnosing or prognosing a cardiovascular disease, the method comprising the steps of administering to a subject an anti-macrophage mannose receptor (anti-MM ) immunoglobulin single variable domain wherein the immunoglobulin single variable domain is labeled with a detectable label. According to particular embodiments, the method may further comprising one or more of the following steps:

a. Monitoring the degree of vulnerability of atherosclerotic plaques and/or the evolution in function of time of the degree of vulnerability of atherosclerotic plaques,

b. Assessing the impact of a therapy on the degree of vulnerability of atherosclerotic plaques and/or on the evolution in function of time of the degree of vulnerability of atherosclerotic plaques.

According to one embodiment of the above described method, the anti-macrophage mannose receptor (anti-MMR) immunoglobulin single variable domain is administered to the subject after the occurrence of a myocardial infarction, thus at the post-infarction stage.

Also envisaged is a method of in vivo imaging vulnerable atherosclerotic plaques in a subject, the method comprising the step of administering to a subject an anti-macrophage mannose receptor (anti- MMR) immunoglobulin single variable domain wherein the immunoglobulin single variable domain is labeled with a detectable label, and imaging vulnerable atherosclerotic plaques in the subject. A variety of subjects or individuals can be diagnosed or prognosed or monitored in time. Generally the "subjects" are mammals or mammalian, where these terms are used broadly to describe organisms which are within the class mammalia, including dogs, cats, mice, guinea pigs, rats, rabbits, humans, chimpanzees, monkeys, etc. In particularly preferred embodiments, the subjects will be mice, rats, rabbits. In other preferred embodiments, the subjects will be humans. Treatment of cardiovascular diseases

A particular aspect of the present application relates to an anti-macrophage mannose receptor (anti- MMR) immunoglobulin single variable domain or a pharmaceutical composition comprising the same for use in the prevention and/or treatment of a cardiovascular disease, in particular atherosclerosis.

Accordingly, also provided is a method for the prevention and/or treatment of a cardiovascular disease, in particular atherosclerosis, the method comprising the step of administering to a subject in need thereof a therapeutically effective amount of an anti-MMR immunoglobulin single variable domain or a pharmaceutical composition comprising a therapeutically effective amount of an anti- MM immunoglobulin single variable domain and at least one of pharmaceutically acceptable carrier, adjuvant or diluent. As a specific embodiment, the above method comprises administering to a subject a therapeutically effective amount of an anti-MMR immunoglobulin single variable domain coupled to a therapeutically active agent, or a pharmaceutical composition comprising a therapeutically effective amount of an anti-MMR immunoglobulin single variable domain coupled to a therapeutically active agent and at least one of pharmaceutically acceptable carrier, adjuvant or diluent.

As used herein, the terms "therapeutically effective amount", "therapeutically effective dose" and "effective amount" mean the amount needed to achieve the desired result or results. As used herein, "pharmaceutically acceptable" means a material that is not biologically or otherwise undesirable, i.e., the material may be administered to an individual along with the anti-MMR immunoglobulin single variable domain without causing any undesirable biological effects or interacting in a deleterious manner with any of the other components of the pharmaceutical composition in which it is contained.

A 'carrier', or 'adjuvant', in particular a 'pharmaceutically acceptable carrier' or 'pharmaceutically acceptable adjuvant' is any suitable excipient, diluent, carrier and/or adjuvant which, by themselves, do not induce the production of antibodies harmful to the individual receiving the composition nor do they elicit protection. So, pharmaceutically acceptable carriers are inherently non-toxic and nontherapeutic, and they are known to the person skilled in the art. Suitable carriers or adjuvantia typically comprise one or more of the compounds included in the following non- exhaustive list: large slowly metabolized macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers and inactive virus particles. Carriers or adjuvants may be, as a non-limiting example, Ringer's solution, dextrose solution or Hank's solution. Non aqueous solutions such as fixed oils and ethyl oleate may also be used. A preferred excipient is 5% dextrose in saline. The excipient may contain minor amounts of additives such as substances that enhance isotonicity and chemical stability, including buffers and preservatives. As used herein, the phrasing "preventing a disease" generally means inhibiting or reversing the onset of the disease, inhibiting or reversing the initial signs of the disease, inhibiting the appearance of clinical symptoms of the disease. As used herein, the phrasing "treating a disease" or "treating a subject or individual having a disease" generally means substantially inhibiting the disease, substantially slowing or reversing the progression of the disease, substantially ameliorating clinical symptoms of the disease or substantially preventing the appearance of clinical symptoms of the disease. A treatment is considered therapeutic if there is a decrease in mortality and/or morbidity, and may be performed prophylactically, or therapeutically. A variety of subjects or individuals are treatable. Generally the "subjects" are mammals or mammalian, where these terms are used broadly to describe organisms which are within the class mammalia, including dogs, cats, mice, guinea pigs, rats, rabbits, humans, chimpanzees, monkeys, etc. In particularly preferred embodiments, the subjects will be mice, rats, rabbits. In other preferred embodiments, the subjects will be humans.

According to specific embodiments, the disease that is targeted is a cardiovascular disease, in particular atherosclerosis, as defined hereinbefore. In particular, it includes reduction or preferably disappearance of vulnerable atherosclerotic plaques, and/or amelioration or alleviation of the symptoms of atherosclerosis.

It may be an advantage that the therapeutic method of the present invention is used in combination with another therapy or treatment regimen for cardiovascular diseases, in particular for atherosclerosis. Accordingly, combination therapy is also encompassed in the present invention. As a non-limiting example, it may be useful to combine the therapeutic method of the present invention with the administration of drugs that lower cholesterol levels and that are effective in the prevention or treatment of cardiovascular diseases. Examples include the statins or HMG-CoA reductase inhibitors, of which a number are on the market: atorvastatin (Lipitor and Torvast), fluvastatin (Lescol), lovastatin (Mevacor, Altocor, Altoprev), pitavastatin (Livalo, Pitava), pravastatin (Pravachol, Selektine, Lipostat), rosuvastatin (Crestor), simvastatin (Zocor, Lipex). Several combination preparations of a statin and another agent, such as ezetimibe/simvastatin, are also available.

Routes of administration

The anti-MM immunoglobulin single variable domain (including a pharmaceutical composition comprising the same), optionally coupled to a therapeutically active agent, may be administered by any suitable method within the knowledge of the skilled man, by way of oral, inhaled or parenteral administration, in particular by intravenous injection. The anti-MMR immunoglobulin single variable domain may be administered alone or preferably formulated as a pharmaceutical composition. An amount effective to treat a certain disease or disorder that express the antigen recognized by the immunoglobulin single variable domain depends on the usual factors such as the nature and severity of the disorder being treated, the weight of the mammal, and if applicable, the nature of the therapeutically active agent. However, a unit dose will normally be in the range of 0.01 to 50 mg, for example 0.01 to 10 mg, or 0.05 to 2 mg of immunoglobulin single variable domain or a pharmaceutically acceptable salt thereof. Unit doses will normally be administered once or more than once a day, for example 2, 3, or 4 times a day, more usually 1 to 3 times a day, such that the total daily dose is normally in the range of 0.0001 to 1 mg/kg; thus a suitable total daily dose for a 70 kg adult is 0.01 to 50 mg, for example 0.01 to 10 mg or more usually 0.05 to 10 mg. It is greatly preferred that the immunoglobulin single variable domain or a pharmaceutically acceptable salt thereof is administered in the form of a unit-dose composition, such as a unit dose oral, parenteral, or inhaled composition. Such compositions are prepared by admixture and are suitably adapted for oral, inhaled or parenteral administration, and as such may be in the form of tablets, capsules, oral liquid preparations, powders, granules, lozenges, reconstitutable powders, injectable and infusable solutions or suspensions or suppositories or aerosols. Tablets and capsules for oral administration are usually presented in a unit dose, and contain conventional excipients such as binding agents, fillers, diluents, tabletting agents, lubricants, disintegrants, colourants, flavourings, and wetting agents. The tablets may be coated according to well-known methods in the art. Suitable fillers for use include cellulose, mannitol, lactose and other similar agents. Suitable disintegrants include starch, polyvinylpyrrolidone and starch derivatives such as sodium starch glycollate. Suitable lubricants include, for example, magnesium stearate. Suitable pharmaceutically acceptable wetting agents include sodium lauryl sulphate. These solid oral compositions may be prepared by conventional methods of blending, filling, tabletting or the like. Repeated blending operations may be used to distribute the active agent throughout those compositions employing large quantities of fillers. Such operations are, of course, conventional in the art. Oral liquid preparations may be in the form of, for example, aqueous or oily suspensions, solutions, emulsions, syrups, or elixirs, or may be presented as a dry product for reconstitution with water or other suitable vehicle before use. Such liquid preparations may contain conventional additives such as suspending agents, for example sorbitol, syrup, methyl cellulose, gelatin, hydroxyethylcellulose, carboxymethyl cellulose, aluminium stearate gel or hydrogenated edible fats, emulsifying agents, for example lecithin, sorbitan monooleate, or acacia; non-aqueous vehicles (which may include edible oils), for example, almond oil, fractionated coconut oil, oily esters such as esters of glycerine, propylene glycol, or ethyl alcohol; preservatives, for example methyl or propyl p-hydroxybenzoate or sorbic acid, and if desired conventional flavouring or colouring agents. Oral formulations also include conventional sustained release formulations, such as tablets or granules having an enteric coating. Preferably, compositions for inhalation are presented for administration to the respiratory tract as a snuff or an aerosol or solution for a nebulizer, or as a microfine powder for insufflation, alone or in combination with an inert carrier such as lactose. In such a case the particles of active compound suitably have diameters of less than 50 microns, preferably less than 10 microns, for example between 1 and 5 microns, such as between 2 and 5 microns. A favored inhaled dose will be in the range of 0.05 to 2 mg, for example 0.05 to 0.5 mg, 0.1 to 1 mg or 0.5 to 2 mg. For parenteral administration, fluid unit dose forms are prepared containing a immunoglobulin single variable domain of the present invention and a sterile vehicle. The immunoglobulin single variable domain, depending on the vehicle and the concentration, can be either suspended or dissolved. Parenteral solutions are normally prepared by dissolving the compound in a vehicle and filter sterilising before filling into a suitable vial or ampoule and sealing. Advantageously, adjuvants such as a local anaesthetic, preservatives and buffering agents are also dissolved in the vehicle. To enhance the stability, the composition can be frozen after filling into the vial and the water removed under vacuum. Parenteral suspensions are prepared in substantially the same manner except that the compound is suspended in the vehicle instead of being dissolved and sterilised by exposure to ethylene oxide before suspending in the sterile vehicle. Advantageously, a surfactant or wetting agent is included in the composition to facilitate uniform distribution of the active compound. Where appropriate, small amounts of bronchodilators for example sympathomimetic amines such as isoprenaline, isoetharine, salbutamol, phenylephrine and ephedrine; xanthine derivatives such as theophylline and aminophylline and corticosteroids such as prednisolone and adrenal stimulants such as ACTH may be included. As is common practice, the compositions will usually be accompanied by written or printed directions for use in the medical treatment concerned. All these medicaments can be intended for human or veterinary use.

The efficacy of the immunoglobulin single variable domains of the invention, and of compositions comprising the same, can be tested using any suitable in vitro assay, cell-based assay, in vivo assay and/or animal model known per se, or any combination thereof, depending on the specific disease or disorder involved.

A further aspect of the invention relates to a method for producing an immunoglobulin single variable domain according to the invention, said method comprising the steps of:

- expressing, in a suitable host cell or expression system, a nucleic acid sequence encoding an immunoglobulin single variable domain according to the invention; and optionally

- isolating and/or purifying said immunoglobulin single variable domain or said polypeptide.

Suitable expression systems include constitutive and inducible expression systems in bacteria or yeasts, virus expresson systems, such as baculovirus, semliki forest virus and lentiviruses, or transient transfection in insect or mammalian cells. Suitable host cells include E. coli, Lactococcus lactis, Saccharomyces cerevisiae, Schizosaccharomyces pombe, Pichia pastoris, and the like. Suitable animal host cells include HEK 293, COS, S2, CHO, NSO, DT40 and the like. The cloning, expression and/or purification of the immunoglobulin single variable domains can be done according to techniques known by the skilled person in the art.

The following examples more fully illustrate preferred features of the invention, but are not intended to limit the invention in any way. Those having ordinary skill in the art and access to the teachings herein will recognize additional modifications and embodiments within the scope thereof. Therefore, the present invention is limited only by the claims attached herein. All of the starting materials and reagents disclosed below are known to those skilled in the art, and are available commercially or can be prepared using well-known techniques.

EXAMPLES

Material and methods to the Examples Mice and rabbits

Female Balb/c and C57BL/6 mice for biodistribution experiments in naive animals were purchased from Harlan. C57BL/6 MM -deficient mice were provided by Etienne Pays (Universite Libre de Bruxelles). Female ApoE-/- and control C57BI/6J mice were purchased from Charles River. ApoE-/- mice were fed a Western diet containing 0.25% cholesterol (Safe) for 18 weeks, whereas control mice remained on a standard chow diet. Myocardial-infarction prone Watanabe heritable hyperlipidemic rabbits were provided by Prof. Dr. Masashi Shiomi (Institute for Experimental Animals, Kobe University School of Medicine, Japan).

All animal studies were approved by and performed according to the guidelines of the institutional review board. Generation and production of mono- and bivalent anti-mouse MMR Nanobodies.

The anti-MMR Nanobody (Nb) clone 1 was isolated from an immune phage library in a similar way as described before (Saerens et al. 2004, J Biol Chem. 279: 51965-72; Saerens et al. 2008, Immunol Methods. 329: 138-50). In brief, an alpaca (Vicugna pacos) was immunised with 100μg recombinant mouse MMR (R&D Systems) six times at weekly intervals. mRNA prepared from peripheral blood lymphocytes was used to make cDNA with the Ready-to-Go You-prime-first-strand beads (GE Healthcare). The gene sequences encoding the VHHs were PCR amplified using the CALL001/CALL002 and A6E/38 primer pairs. These PCR fragments were ligated into the pHEN4 phagemid vector after digestion with the Pstl and BstEII restriction enzymes. Using M13K07 helper phage infection, the VHH library was expressed on phages and specific Nanobody-phages were enriched by several consecutive rounds of in vitro selection on microtiter plates (Nunc). Individual colonies were screened in ELISA for antigen recognition with non-specific phage particles serving as a negative control. The VHH genes of the clones that scored positive in ELISA were recloned into the expression vector pHEN6 using the restriction enzymes Pstl and BstEII. Expression in the periplasm and purification of Nanobodies from E. coli periplasmic extracts using immobilized metal affinity chromatography (IMAC) on Ni-NTA resin (Sigma-Aldrich, St. Louis, MO) followed by size exclusion chromatography (SEC) on Superdex 75 HR 10/30 (Pharmacia, Gaithersburg, MD) in phosphate buffered saline pH 7.4 (PBS) was performed as described previously (Conrath et al. 2001, Antimicrob Agents Chemother 45, 2807-2812).

Bivalent Nanobodies were generated by recombinantly attaching a linker sequence 3' of the VHH sequence using PCR primer biNbF (5'-CCG GCC ATG GCC CAG GTG CAG CTT CAG GAG TCT GG AGG AGG-3'; SEQ ID NO:158) and primers biNbG4SR (5'-TGA TTC CTG CAG CTG CAC CTG ACT ACC GCC GCC TCC AGA TCC ACC TCC GCC ACT ACC GCC TCC GCC TGA GGA GAC GGT GAC CTG GGT C-3'; SEQ ID NO:159), biNbg2cR (5'-TGA TTC CTG CAG CTG CAC CTG TGC CAT TGG AGC TTT GGG AGC TTT GGA GCT GGG GTC TTC GCT GTG GTG CGC TGA GGA GAC GGT GAC CTG GGT C-3';SEQ ID NO:160), biNblgAR (5'- TGA TTC CTG CAG CTG CAC CTG ACT TGC CGG TGG TGT GGA TGG TGA TGG TGT GGG AGG TGT AGA TGG GCT TGA GGA GAC GGT GAC CTG GGT C-3'; SEQ ID NO:161) which code for a (G ₄ S) ₃ (GGGGSGGGGSGGGGS; SEQ ID NO:162), llama lgG2 hinge (AHHSEDPSSKAPKAPMA; SEQ ID NO:163) or human IgA hinge (SPSTPPTPSPSTPPAS; SEQ ID NO:164) linker respectively. These PCR fragments were inserted 5' of the VHH gene in the original VHH expression vector with a Pstl/BstEII restriction digest. After ligation, the resulting bivalent anti-MMR Nanobodies were expressed and purified as described above.

Generation of anti-human MMR and anti-human/mouse MMR cross-reactive Nanobodies.

The anti-human macrophage mannose receptor (MMR) and anti-human/mouse MMR cross-reactive Nanobodies (Nbs) were isolated from an immune phage library in a similar way as described before (Saerens et al. 2004, J Biol Chem. 279: 51965-72; Saerens et al. 2008, Immunol Methods. 329: 138- 50)). However, in order to generate cross-reactive Nbs, an alternating immunisation schedule was carried out. An alpaca (Vicugna pacos) was immunised with 100μg human MMR (R&D Systems #2534) followed by 100 μg mouse MMR (R&D Systems #2535) one week later. This alternating schedule was maintained for a total of 6 weeks and both proteins were mixed with the Gerbu adjuvant before injection. After immunisation, blood was collected and the peripheral blood lymphocytes were isolated. mRNA was extracted from these cells using TRIzol (Invitrogen) and was reverse-transcribed with oligo(dT) and Superscript II RT (Invitrogen), following the manufacturer's instructions. The gene sequences encoding the variable domains (VHHs) were PCR amplified, with the leader sequence specific CALLOOl (5'-GTC CTG GCT CTC TTC TAC AAG G-3'; SEQ ID NO: 165) and CH2 exon specific CALL002 (5'-GGT ACG TGC TGT TGA ACT GTT CC-3'; SEQ ID NO: 166) primers. After 1% agarose gel separation , the 600 bp fragment VHH-CH2 fragment was isolated from gel and re-amplified using the nested primers A6E (5'- GAT GTG CAG CTG CAG GAG TCT GGR GGA GG-3'; SEQ ID NO: 167) and PMCF (5'- CTA GTG CGG CCG CTG AGG AGA CGG TGA CCT GGG T -3'; SEQ ID NO: 168) specific for the framework-1 and framework-4 regions, respectively. These PCR fragments were ligated into the phagemid vector pMECS, a variant of pHEN4 (Arbabi Ghahroudi et al. 1997, FEBS Lett. 414:521-6), after digestion with the Pstl and Notl restriction enzymes. The pMECS differs from the pHEN4 in coding for a HA (YPYDVPDYGS; SEQ ID NO: 169) and 6xhistidine tag fusion at the C-terminus of the Nb instead of a HA tag only fusion. Ligated material was transformed in freshly prepared E. coli TGI cells and plated on LB plates with ampicillin. The colonies were scraped from the plates, washed and stored at - 80 °C in LB-medium supplemented with glycerol (50% final concentration). Using M13VCS helper phage infection, the VHH library was expressed on phages. Specific Nanobody-phages were enriched by several consecutive rounds of in vitro selection on antigen coated to wells of microtiter plates (Nunc). For isolation of human/mouse MMR cross-reactive Nbs, screening was performed using human and mouse MMR alternatingly. Bound phage particles were eluted with 100 mM triethylamine (pH 11.0), immediately neutralized with 1 M Tris-HCI (pH 7.4) and used to infect E. coli TGI cells. Individual colonies were picked and expression of recombinant Nanobody-M13 protein III by addition of 1 mM isopropyl- -D-thiogalac-topyranoside (IPTG). The periplasmic extract of each clone was subsequently tested in ELISA for human MMR recognition with non-specific antigen coated wells serving as a negative control. Human/mouse MMR cross-reactive Nbs were also screened in a similar fashion against mouse MMR, only clones reactive with both human and mouse antigens were withheld as cross-reactive Nbs. Each ELISA was performed on plates coated with 1 μg/ml MMR in 100 mM NaHC0 ₃ buffer pH = 8.8. After coating the plates are washed with PBS +0.05% Tween-20 (PBST) and blocked for 2h with PBS + 0.05% Tween-20 + 2% non-fat dry milkpowder (Nestle) (PBSM). The PE extracts are then incubated for lh on the plate and then washed with PBST followed by lh incubation of 0.5 μg/ml mouse anti-HA tag antibody (16B12, Covance) in PBSM. After washing with PBST, 1.5 μg/ml alkaline phosphatase conjugated anti-mouse antibody (Sigma) in PBSM in added to the plate for lh followed by PBST washing. Finally, the ELISA is developed using 2 mg/ml alkaline phosphatise substrate (Sigma) in AP-buffer (100 mM NaCI, 50 mM MgCI ₂ , 100 mM Tris pH=9.5) and the optical density signal at 405 nm is measured.

Expression and purification of anti-human MMR and anti-human/mouse MMR cross-reactive Nanobodies.

The pMECS-Nb plasmids of the clones that scored positive in ELISA were transformed into E. coli WK6 cells. These cells stop translation at the TAG codon and therefore express the Nbs without a phage protein fusion. Production of recombinant VHH was performed in shaker flasks by growing the bacteria in Terrific Broth supplemented with 0.1% glucose and ampicillin until an absorbance at 600 nm between 0.6 and 0.9 was reached. VHH expression was then induced with 1 mM IPTG for 16 h at 28 °C. After pelleting the cells, the periplasmic proteins were extracted by osmotic shock. This periplasmic extract was loaded on a nickel-nitrilotriacetic acid (Thermo Scientific), and after washing, the bound proteins were eluted in PBS with 500 mM imidazol. The eluted fraction of this immobilized metal affinity chromatography (IMAC) was dialysed to Vivaspin 2 centrifugal concentrators (Sartorius). The final purity of the protein was checked by SDS-PAGE (Figure 6A). The final yield was determined from UV absorption at 280 nm using the calculated theoretical extinction coefficient of the VHH. A HA tag is useful for detection of Nanobodies via flow cytometry, but has been shown to interfere with 99mTc labeling on adjacent His tags. Therefore, for experimental tests involving 99mTc labelling, the Nanobodies were recloned to the pHEN6c vector. This removes the HA tag and only fuses a 6xHis tag at the C-terminus of the Nanobody. In addition, after periplasmic expression and IMAC purification, Nanobodies to be used in experiments involving 99mTc labelling were subjected to an additional purification step via size exclusion chromatography as described above for the anti-mouse MM Nanobodies (Figure 6B and 6C).

Surface plasmon resonance

Affinity analysis was performed using a BIAcore T100 (GE Healthcare) with HEPES-buffered saline running buffer (10 mM HEPES with 0.15 M NaCI, 3.4 mM EDTA and 0.005% surfactant P20 at pH 7.4). MRR was immobilized on a CM5 chip in acetate buffer 50 mM (pH 5,0), resulting in 2100 RU MMR coated on the chip. A second channel on the same chip was activated/deactivated in a similar way and served as a negative control. The MMR Nanobodies were used as analytes in 11 different concentrations, ranging from 1 to 2000 nM, at a flow rate of 10 ml/min. Glycine-HCI 50 mM (pH 2.0) was used for elution. The kinetic and equilibrium parameters (kd, ka and K _D ) values were calculated from the combined sensogram of all concentrations using BIAcore T100 evaluation software 2.02 (GE Healthcare).

Cell preparation and flow cytometry

The Nanobodies used for flow cytometry staining were produced from the original pMECS phage vector and therefore each Nanobody possesses a C-terminal HA and 6xHis tag. For examining specific binding of the anti-MMR Nanobodies to mouse MMR, 3LL-R tumors were induced by injecting 3E6 cancer cells subcutaneously in C57BI/6 mice. After 15 days of tumor growth, the tumors were isolated, chopped and incubated for 25 minutes (37°C) with 10 U/ml Collagenase typel, 400 U/ml Collagenase typelV and 30 U/ml DNAsel (Worthington). Density gradients (Axis-Shield) were used to remove tissue debris and dead cells. Nanobodies were added at 10 μg/ml to 1E6 cells per tube. After at least one hour of incubation with anti-MMR Nanobody or control Nanobody, cells were washed two times with ice-cold Hank's Buffered Salt Solution (HBSS) buffer (containing 0,74 g/l EDTA and 0,5% (v/v) heat inactivated fetal calf serum) and incubated with 0.5 μ§/ιτιΙ Alexa fluor 488 conjugated anti-HA tag monoclonal antibody (clone 16B12, Invitrogen). Commercial antibodies used for cell surface stainings were Alexa Fluor 647 conjugated anti-mouse Ly6C monoclonal antibody (clone E -MP20, AbD Serotec), PerCPCy5.5 conjugated anti-mouse MHCII monoclonal antibody (clone M5/114.15.2, Biolegend), Phycoerythrin conjugated anti-mouse Ly6G monoclonal antibody (clone 1A8, BD Biosciences). For flow cytometry measurements, CDllb+Ly6G- tumor associated macrophages were further gated on MHCII expression, as the MHCII ^low TAMs express MMR to a high degree. Binding profiles of anti-MMR Nanobodies were recorded.

In order to examine binding of the Nanobodies to human MMR, human immature dendritic cells were used. Cryopreserved immature dendritic cells derived from healthy human donor monocytes were a kind gift of Dr. Karine Breckpot (Vrije Universiteit Brussel, Jette, Belgium). To prepare the immature dendritic cells, peripheral blood mononuclear cells were removed from the blood via leukapheresis and monocytes were separated by adherence to plastic Nunclon dishes (Nunc, Biotech Line, Slangerup, Denmark). After removal of the non-adherent cells, immature dendritic cells were in vitro generated during a six days differentiation from monocytes in RPMI 1640 medium supplemented with 500 U/ml IL-4 (Invitrogen) and 1000 U/ml GM-CSF (Gentaur). Cells were harvested at day 6, counted and aliquoted at 1E7 cells/vial. The cells were cryopreserved in 85% autologous serum, 10% DMSO (Sigma- Aldrich) and 5% Glucosteril 40% (Fresenius, Albertslund, Denmark). For flow cytometry analysis, cells were thawed on ice and incubated for more than one hour at room temperature with precooled RPMI 1640 medium supplemented with 500 U/ml IL-4 (Invitrogen) and 1000 U/ml GM-CSF (Gentaur). Next, 10% normal rabbit serum was added to prevent aspecific Fc mediated binding of antibodies. After half an hour the Nanobodies were added at 10 μg/ml to 2E5 cells per tube. After at least one hour of incubation with anti-MMR Nanobody or control Nanobody, cells were washed two times with ice-cold HBSS buffer supplemented with 1% normal rabbit serum (Eppendorf 5810-R Centrifuge, 8 minutes, 1400 rpm, 4°C) and incubated with 0.5 μg/ml Alexa fluor 488 conjugated anti-HA tag monoclonal antibody (clone 16B12, Invitrogen). Allophycocyanin conjugate (APC) conjugated anti-human CDllc monoclonal antibody (clone B-ly6, BD Biosciences) was used for CDllc staining. Stained cells were washed once more with ice-cold HBSS buffer supplemented with 1% normal rabbit serum (Eppendorf 5810-R Centrifuge, 8 minutes, 1400 rpm, 4°C) and analysed by flow cytometry. Nanobody labeling and in vitro characterization of ^99m Tc-labeled Nanobodies

For labeling of Nanobodies with ^99m Tc at their hexahistidine tail, [ ^99m Tc(H ₂ 0)3(CO) ₃ ] ⁺ was synthesized by adding 1 mL of ^99m Tc04 ^" (0.74-3.7 GBq) to an Isolink kit (Mallinckrodt Medical BV) containing 4.5 mg of sodium boranocarbonate, 2.85 mg of sodium tetraborate.l0H ₂ O, 8.5 mg of sodium tartrate.2H ₂ 0, and 7.15 mg of sodium carbonate, pH 10.5. The vial was incubated at 100°C in a boiling bath for 20 min. The freshly prepared was allowed to cool at room temperature for 5 min and neutralized with 125 μΐ of 1 M HCI to pH 7-8. [ ^99m Tc(H ₂ 0)3(CO) ₃ ] ⁺ was added to 50 μΐ of 1 mg/mL monovalent Nanobody or 2 mg/ml bivalent Nanobody, together with 50 μί of carbonate buffer, pH 8. The mixture was incubated for 90 min at 52°C in a water bath. The labeling efficiency was determined by instant thin-layer chromatography in acetone as mobile phase and analyzed using a radiometric chromatogram scanner (VCS-201; Veenstra). When the labeling yield was less than 90%, the ^99m Tc- Nanobody solution was purified on a NAP-5 column (GE Healthcare) pre-equilibrated with phosphate- buffered saline (PBS) and passed through a 0.22 μιτι Millipore filter to eliminate possible aggregates. Pinhole SPECT-microCT imaging procedure

Mice were intravenously injected with 100-200 μΙ 45-155 MBq (about 5-10 μg) of ^99m Tc-Nanobody. Mice were anesthetized with a mixture of 18.75 mg/kg ketamine hydrochloride (Ketamine 1000 ^* , CEVA, Brussels, Belgium) and 0.5 mg/kg medetomidin hydrochloride (Domitor ^* , Pfizer, Brussels, Belgium) 10-15 min before pinhole SPECT acquisition. MicroCT imaging was followed by pinhole SPECT on separate imaging systems. MicroCT was performed using a dual source CT scanner (Skyscan 1178, Skyscan, Aartselaar, Belgium) with 60 kV and 615 mA at a resolution of 83 μιτι. The total body scan time was 2 minutes. Image reconstruction was performed using filtered backprojection (Nrecon, Skyscan, Aartselaar, Belgium). Total body pinhole SPECT was performed at 60 min or 180 min post-injection (p.i.) using a dual headed gamma camera (e.cam ¹⁸⁰ Siemens Medical Solutions, IL, USA), mounted with two multi-pinhole collimators (3 pinholes of 1.5 mm in each collimator, 200 mm focal length, 80 mm radius of rotation). Images were acquired over 360 degrees in 64 projections of 10 s into 128 x 128 matrices resulting in a total imaging time of 14 min. The SPECT images were reconstructed using an iterative reconstruction algorithm (OSEM) modified for the three pinhole geometry and automatically reoriented for fusion with CT based on six ⁵⁷ Co landmarks.

Image analysis

Image viewing and quantification was performed using AMIDE Medical Image Data Examiner software. Ellipsoid regions of interest ( OIs) were drawn around the tumor and major organs. Uptake was calculated as the counts in the tissue divided by the injected activity counts and normalized for the ROI size (%IA/cm ³ ). High-resolution image 3D-reconstructions were generated using OsiriX Imaging Software. Biodistribution analysis

30 min after microCT/SPECT acquisition, mice were sacrificed with a lethal dose of pentobarbital (Nembutal; CEVA). Aorta, kidneys, liver, lungs, muscle, spleen, lymph nodes, bone, heart, and blood were removed and weighed, and the radioactivity was measured using an automated γ-counter (Cobra I I Inspector 5003; Canberra-Packard). Tissue and organ uptake was calculated as percentage of injected activity per gram of tissue (%IA/g), corrected for decay. For analysis of aorta targeting, aortas were cut into 12 segments and radioactivity of each segment was measured separately. A lesion-extension index was attributed to each segment as shown in the inset of Figure X: (-) no lesion (control segments), (+) lesion covering up to 50% of the arterial segment length, (++) lesions covering more than 50% of the arterial segment length, and (+++) lesions extending over the whole segment length. Aortic lesion and control uptakes were defined as the average uptake in all segments ranked (+++) or (-), respectively.

In vivo assessment of cross-reactivity in rabbits

To assess in vivo crossreactivity in rabbits, anti-MMR nanobodies were labeled with ^99m Tc via tricarbonyl chemistry as described above. WHH LMI rabbits (male, ± 2 months old, 1.5-1.9 kg) were anesthetized by intramuscular injection of 35 mg/kg ketamine and 5 mg/kg xylazine. ^99m Tc-nanobody (300 ± 65 MBq) was injected intravenously via the marginal ear vein. The animals were immediately subjected to dynamic planar imaging using a γ-camera (e.cam ¹⁸⁰ Siemens Medical Solutions, Wheaton, IL, USA) making acquisitions every 10 sec during 60 min with the following camera settings: 256x256 matrix and zoom factor 1.78. At the end, animals were killed by intravenous injection of 100 mg/kg pentobarbital and all major organs and tissues were harvested. The organs and tissues were weighted and radioactivity in representative samples was counted in a γ-well counter (Cobra I I Inspector 5003, Canberra-Packard). Results were corrected for background and decay, and expressed as percentage of injected activity per organ or as differential uptake ratio (DU R, calculated as (tissue activity/tissue weight)/(injected activity/animal body weight) (%ID/g/kg). Statistics

Statistical significance was determined by the Student's i test, using Microsoft Excel or GraphPad Prism 4.0 software. Differences were considered significant when P≤ 0.05. Geometric means and confidence intervals were determined using Microsoft Excel. 18F labeling of Nanobodies

[ F]-fluoride was obtained through the nuclear reaction 0(p,n) F by bombarding 18 MeV accelerated protons on >95% ¹⁸ 0 enriched water (Campro, the Netherlands) in a CG 560 cyclotron. After transfer to a SynthERA ^® module (IBA Molecular, Belgium), the resultant [ ¹⁸ F]-fluoride was separated from ¹⁸ 0-enriched water on a SepPak™ Light Accell plus QMA anion exchange cartridge (Waters, US). The anion exchange cartridge was pre-conditioned sequentially with 5 ml of 8.4% NaHC0 ₃ (VWR, Belgium) and 5 ml of deionized water. The [ ¹⁸ F] was eluted from the cartridge using 600 μΙ of a solution containing 4.2 mg K ₂ C0 ₃ and 22.6 mg Kryptofix 2.2.2 ( K222) in acetonitrile/water (1:1) (vial 1) (ABX, Germany). The solvent was evaporated under a stream of nitrogen at 110 °C to generate the anhydrous K ₂₂ 2/K[ ¹⁸ F] F complex.

¹⁸ F-labeling of Nanobodies was performed using the prosthetic group N-succinimidyl-4- [ ¹⁸ F] fluorobenzoate ([ ¹⁸ F]-SFB). The [ ¹⁸ F]-SFB prosthetic group was produced using a disposable ¹⁸ F-FDG cassette (IFP™ nucleophilic, IBA Molecular). A solution of 4 mg (0.011 mmol) Ethyl 4- [Trimethylammonium]Benzoate (ABX, Germany) in 2 ml DMSO (vial 2)(Sigma-Aldrich, Belgium) was added to the dried [ ¹⁸ F] complex in the reaction vial which was heated to 110 °C for 15 min to produce ethyl-4-[ ¹⁸ F]fluorobenzoic acid. This intermediate was hydrolysed adding 20 μΙ (0.02 mol) of an 0,1 M aqueous tetrapropylammoniumhydroxide (TPAOH) solution in 0.5 ml DMSO (vial 3) and subsequently activated with 26 mg (0.072 mmol) of the coupling agent N,N,N',N'-Tetramethyl-0-(N- succinimidyl)uronium hexafluorophosphate (HSTU) in 1ml CH ₃ CN (vial 4) to form N-succinimidyl 4- [ ¹⁸ F]fl uorobenzoate ([ ¹⁸ F]-SFB). Unpurified [ ¹⁸ F]-SFB was transferred to a vial containing 4 ml 5% acetic acid solution and 8 ml 0,9% NaCI-solution. The purification was optimized using only one solid phase extraction cartridge. This purification was performed on a second SynthERA ^® module using an in-house made automatic three-way valve to transfer the diluted [ ¹⁸ F]-SFB and washing solution. Afterwards the [ ¹⁸ F]-SFB was dried in a conical vial by means of gentle heating in nitrogen environment. After evaporation the Nanobody solution, in a 0.1 M borate buffer, was added to the dried residue in the reaction vessel and allowed to react for 20 minutes at room temperature. The labeling of Nanobody and purification by size exclusion chromatography using a PD-10 column (GE Healthcare) were performed on a semi-automatic in-house made system connected to the SynthERA ^® module and transferred in a vial after passing a 0.22μιτι filter (Millipore). The final purified ¹⁸ F-FB-anti-MMR was collected in a solution of phosphate buffered saline pH 7.4.

Overall, [ ¹⁸ F]-SFB was synthesized and purified using two SynthERA modules (IBA Molecular) with a radiochemical yield of 50-60% (decay corrected). Two- to five hundred MBq of ¹⁸ F-FB-anti-MMR Nanobody was obtained with a radiochemical purity of more than 97% and overall radiochemical yield of 5% using the fully automated protocol.

PET/CT imaging procedure

Male Watanabe rabbits of 13-16 months old were used for PET imaging. 18F-labeled nanobodies were injected via marginal ear vein. The dose at injection was: 0.5 - 1 mCi (50-100 μg nanobody). PET/CT Imaging was performed at 2h-2.5h post-injection.

The PET scan was performed on a Philips Gemini TF64 PET/CT; PET images were acquired over 24-28 min (6-7 bed positions, with 4 min per position) and reconstructed to 300-342 slices of 288 x 288 pixels (at 2mm isotropic voxel size), with attenuation correction based on the CT data. The parameters of the CT scan were: 120kV at approx. 30 mA with voxel size of 2mm, using filtered backprojection. Total CT scan time was approx. 20 sees. Xenetix was used as CT contrast, which was injected manually into marginal ear vein just prior to the CT acquisition, after the scout scan.

Myocardial ischemia/ reperfusion injury (IRI) rat model

Myocardial IRI was induced by ligation of the left anterior descending coronary artery during 60 minutes followed by loosening of the suture in 17 Wistar rats. Seven animals were sham operated. The infarct size was assessed by a ^99m Tc-Tetrofosmin scan on day 2. Pinhole-SPECT^CT acquisitions of ^99m Tc-MMR-Nb were taken at baseline, at day (D) 5, 9, 12, 16, 21, 28 and 3 months after IRI.

Quantification of the uptake of ^99m Tc-MMR-Nb in the infarct zone (IZ) was performed by measuring the absolute mean uptake at the anterolateral segment of equally sized volumes of interest.

Immunofluorescence staining was performed with an anti-MMR antibody and an anti-CD68 antibody. Statistical analysis was conducted using repeated measures ANOVA on log-transformed data. Data are shown as mean ± standard deviation and significance was set to .05. As a control, in vivo quantification of a ^99m Tc labeled control-Nb (cAbBCIIlO) is being performed.

Example 1. Generation of Nanobodies against the mouse Macrophage Mannose Receptor (CD206 - MMR) Anti-CD206 (anti-MMR) Nanobodies (Nbs), which are the smallest available antigen-binding entities, were created in order to target MMR-positive cells in vivo. Nanobodies were raised against the recombinant extracellular portion of MMR, as described in the Materials and Methods (see also Table 1). The binding characteristics of the monovalent anti-MMR Nanobodies were compared using surface Plasmon resonance (SPR) measurements (Table 2). Nanobody clone 1 demonstrated an 8-fold higher apparent affinity for immobilized recombinant MMR compared to Nanobody clone 3 (K _D = 2.31 x 10 ^s M versus 1.91 x 10 ^~7 M, respectively), and became hence the Nanobody of choice for the remaining of this study. In addition, SP competition studies demonstrated that pre-treatment with Nanobody clone 1 does not preclude Nanobody clone 3 binding, and vice versa, suggesting that anti-MMR Nb clone 1 and Nb clone 3 bind to non-overlapping epitopes (data not shown). Example 2. In vivo imaging with anti-mouse Macrophage Mannose Receptor Nanobodies in naive mice using Pinhole SPECT/micro-CT analysis

In a next step, we performed in vivo imaging using Macrophage Mannose Receptor (MMR) targeting Nanobody clone 1. The Nanobodies were labeled at their hexahistidine-tail with ^99m Tc at elevated temperatures by tricarbonyl-chemistry. Purified, ^99m Tc-labeled Nanobodies were injected intravenously in mice and total body scans were made using pinhole SPECT and microCT.

The first step in the in vivo evaluation was the study of the biodistribution in healthy mice. This allows to evaluate physiological sites of specific accumulation and to determine the pharmacokinetic properties of the imaging probes. MMR Nanobodies show uptake in organs such as lungs, spleen and liver. The blood clearance is fast with less than 1 % IA (injected activity)/ml remaining in blood at lh30 post injection. We also tested MMR Nanobodies in MMR knock-out mice where the uptake in liver and spleen dropped below 1% ΙΑ/g (Figure 1). These data indicate that the accumulation in organs such as liver and spleen is related to MMR expression and therefore specific. Only the accumulation in lungs appears to be MMR-unrelated.

Example 3: Generation of anti-MMR bivalent Nanobodies Bivalent Nanobodies were constructed by linking two anti-MMR Nanobody 1 entities using (G ₄ S) ₃ (GGGGSGGGGSGGGGS; SEQ ID NO:151), llama lgG2 hinge (AHHSEDPSSKAPKAPMA; SEQ ID NO:152) or human IgA hinge (SPSTPPTPSPSTPPAS SEQ ID NO:153) linkers. These bivalent anti-MMR molecules showed a 5-fold higher avidity compared to the monovalent clone 1 Nanobody, which can be attributed largely to 3-fold increase in K _D . The different linkers used for bivalent Nanobody construction did not seem to have a significant effect on the affinity of the molecules for the MMR antigen. As a negative control Nanobody in all experiments, we consistently used a-BCII10 Nb, which is a binder of the β-lactamase BCII enzyme of Bacillus cereus.

Example 4: Assessment of the biodistribution and specificity of anti-MMR Nanobody clone 1 and its bivalent derivative in naive mice using Pinhole SPECT/micro-CT analysis Next, we wished to assess whether the anti-MMR Nb clone 1 and its bivalent derivative could be used for targeting and imaging of MMR-expressing cells in vivo. To this end, anti-MMR monovalent Nb were labeled with ^99m Tc and injected intravenously in naive C57BL/6 mice. 3 hours post injection, total-body scans were acquired using pinhole SPECT and micro-CT (Figure 2), images were quantified and tracer uptake expressed as percentage injected activity per gram cubic centimetre (%IA/cm ³ ) (Table 3). To ascertain the specificity of the anti-MMR Nb and to prove that any potential targeting was not due to aspecific retention, anti-MMR Nb were also injected in naive C57BL/6 MMR ^7- mice. In MMR ^7- mice, SPECT/micro-CT images show a high tracer uptake in the kidneys and urinary activity in the bladder, indicative of renal clearance, but only low background-level retention is seen in other organs (Figure 2; Table 3). The only exception was the lungs, suggesting that lung-targeting was aspecific. In contrast, WT mice showed an increased retention of the anti-MMR Nb in several organs, including heart, bone, spleen and liver, with the latter two showing the most intense signals (Figure 2). These results indicate that the anti-MMR monovalent Nb has a high in vivo specificity and can efficiently target organs such as the liver and spleen. A similar experiment was performed with the different bivalent anti-MMR Nb constructs, all of which showing an even increased uptake in the liver as compared to the monovalent molecule and a concomitant reduction in clearance via the kidneys (Table 4). Again, retention of bivalent anti-MMR Nb in all organs, except the lung, is MMR-specific and is absent in MMR ^7" mice. As was expected, retention of the control cAbBCIIlO Nb is very low in all organs, resulting in a massive clearance via the kidneys (Table 4). Example 5. Selection of anti-human MMR Nbs

Next, anti-human MMR Nanobodies were generated (see also Material and Method section). After 4 panning rounds of an anti-human/anti-mouse MMR phage bank on human MMR, up to 100 fold enrichments for hMMR reactive phages were observed per panning round. Therefore, 188 colonies from all rounds were selected for PE-expression. These PE-extracts were used in PE-ELISAs to determine which clones react effectively to hMMR. In total 100 clones were selected based on these results (Figure 3). Additionally, the DNA and protein sequence of the selected clones was determined (Table 5) and double clones or premature stopping clones were discarded.

Example 6. Selection of anti-human/mouse MMR cross-reactive Nbs

Next, anti-human/mouse MMR cross-reactive Nanobodies were generated (see also Material and Method section). The anti-human/anti-mouse MMR phage bank was alternatingly screened on human and mouse MMR for a total of 4 rounds, resulting in up to 100 fold enrichments for hMMR/mMMR reactive phages from the second panning round. Therefore, 188 colonies from the second and third rounds were selected for PE-expression. These PE-extracts were used in PE-ELISAs to determine which clones react effectively to MMR, clones were selected after the ELISA on hMMR (Figure 4). These clones were then screened for binding on mouse MMR (Figure 5). Only clones (42) that reacted to both antigens were withheld as true cross-reactive Nbs. These clones were sequenced (Table 6) and divided into families based on their CDR3 regions. Example 7. Production of representative set of anti-human or anti-human/mouse MMR Nbs

A set of representative clones was selected for Nb production in E. coli: (1) anti-human Nbs: NbhMMRml.33, NbhMMRm4.83, NbhMMRml0.19, NbhMMRm23.30, NbhMMRm2.15, NbhMMRm3.1, NbhMMRm5.38, NbhMMRml2.6, NbhMMRmll.5, NbhMMRml5.43, NbhMMRml6.95; (2) anti-human/mouse Nbs: NbhmMMRml4.4, NbhmMMRm6.71, NbhmMMRm24.31, NbhmMMRm20.52, NbhmMMRm3.49, NbhmMMRm22.84, NbhmMMRml9.52, NbhMMRm21.22, NbhmMMRml4.93, NbhmMMRml5.49, NbhmMMRml7.72, NbhmMMRml0.79, NbhmMMRm7.67, NbhmMMRm26.70. Each clone was grown in a two litre culture. After expression and osmotic shock, the resulting extract was purified on 1 ml of Ni-NTA resin. The resulting 5 ml of eluted Nb was dialysed to PBS after which the concentration was determined using a Nanodrop device and purity was assessed on Coomassie stained SDS-PAGE gels (example for NbhmMMRm5.38 in Figure 6A). The Nanobodies all produced between 0.7 and 9 mg Nb/I E coli culture (Table 7).

Example 8. Determination of kinetic rate constants of a representative set of anti-human or anti- human/mouse MMR Nbs via surface plasmon resonance (SPR)

The binding characteristics and affinity of selected Nbs towards the recombinant hMMR and recombinant mMMR antigen was examined in further detail using surface plasmon resonance. A combined sensogram was recorded for each Nb (example for NbhmMMRm3.49 in Figure 7) and the kinetic and equilibrium parameters (kd, ka and KD) values were calculated (Table 8 and Table 9). Most but not all results on binding to mouse or human rMMR obtained via this SPR analysis are in agreement with the results obtained by PE-ELISA. Based on the kinetic and equilibrium parameters (kd, ka and KD) values five among the cross-reactive anti-hmMMR Nbs were selected for further analysis (indicated in bold in Table 8 and Table 9). These five Nbs (NbhmMMRm3.1, NbhmMMRml4.4, NbhmMMRm5.38, NbhmMMRm26.70 and NbhmMMRm3.49) displayed rather low dissociation rate constants, which makes them suitable for in vivo imaging. The corresponding KD values for these Nanobodies ranged from 68 nM to 2 nM. It can clearly be seen from the data in Table 8 and 9 that the Nbs have a preferred MMR antigen: NbhmMMRm3.1, NbhmMMRml4.4, NbhmMMRm5.38 and NbhmMMRm3.49 have a higher affinity for the hMMR Ag compared to the mMMR Ag. In contrast, NbhmMMRm26.70 binds better to mMMR Ag as compared to hMMR Ag, even though the first rounds of immunization and panning were performed using the hMMR antigen.

Example 9. Determination of binding of a representative set of anti-human or anti-human/mouse MMR Nbs on MMR expressed on cells via flow cytometry In order to confirm the binding specificity of the 5 selected Nbs to MMR expressed on cells, flow cytometric analysis was performed.

Binding to cell-expressed mouse MMR was determined on tumor associated macrophages derived from a preclinical mouse tumor model, making use of the previously documented finding that TAMs contain molecularly and functionally distinct subsets differing in expression of MMR: MMR is highly expressed on MHC ll ^low TAMs, whereas MMR expression is lower for MHC ll ^hlgh TAMs (Movahedi et al., 2010). As shown in Figure 8, clear shifts in fluorescence intensity, comparable to the shift of the anti- mMMR Nb clone 1, could be detected on MHCII ^low TAMs for NbhMMRm3.1, NbhmMMRml4.4, NbhmMMRm26.70 and NbhMMRm3.49. Remarkably, binding of NbhmMMRm5.38 to TAMs could not be detected. In order to investigate the binding specificity of the selected Nbs to human MMR, human immature monocyte-derived dendritic cells were generated and gated on CDllc ⁺ cells. As shown in Figure 9, binding of NbhMMRm3.1, NbhmMMRml4.4, NbhmMMRm5.38 and NbhmMMRm3.49 to hMMR expressed on immature dendritic cells was clearly detected, whereas no significant shift in fluorescence intensity could be detected for NbhmMMRm26.70. Overall, the flow cytometry analysis indicates that NbhmMMRm5.38 binds on cell expressed human MMR, but not mouse MMR. In contrast, NbhmMMRm26.70 has a similar binding pattern to the orginal anti-mouse MMR clone 1 and binds to mouse but not human MMR. NbhMMRm3.1, NbhmMMRml4.4 and NbhMMRm3.49 bind to both mouse and human MMR expressed on cells.

Example 10. Tissue distribution experiments with anti-human Macrophage Mannose Receptor Nanobodies in naive mice.

In a next step, we wished to assess whether selected anti-human MMR Nbs could be used for in vivo targeting of MMR-expressing cells. Since the flow cytometry analysis on human immature dendritic cells had revealed that NbhmMMRm26.70 does not bind to human MMR, it was not analysed at this time. Since NbhmMMRm3.1 and NbhmMMRm3.49 share the same CDR3 loop, but NbhmMMRm3.49 has a better affinity for recombinant MMR as compared to NbhmMMRm3.1, among those two Nanobodies, NbhmMMRm3.49 was selected for the in vivo targeting. Also NbhmMMRml4.4 and NbhmMMRm5.38 were included in the selection to be used for this example. Since the latter did not bind to mouse MMR according to the flow cytometric analysis, it could be used to exclude aspecific binding and accumulation in tissues. The selected Nanobodies were labeled with ^99m Tc and injected intravenously in naive C57BL/6 mice. 3 hours post injection, the mice were dissected and radioactivity was measured in the major organs. As shown in Figure 10, NbhmMMRml4.4 and NbhmMMRm3.49 exhibited similar tissue distribution as the original anti-mouse MMR Nanobody clone 1, with high uptake in organs such as lungs, spleen and liver. In contrast, the negative controls NbhmMMRm5.38 and Nb cAbBclllO mainly showed high tracer uptake in the kidneys, indicative of renal clearance.

Example 11. Nb MMR ell aortic distribution in ApoE-/- mice

To perform a first preliminary assessment of the use of anti-MMR Nanobodies for in vivo targeting of atherosclerotic plaques, ApoE-/- mice fed on a "Western diet" were used as a model of atherosclerosis. Anti-MMR Nb clone 1 was labeled with ^99m Tc and injected intravenously in 3 mice. In Figure 11, uptake of Nb MMR clone 1 in aorta segments ranked according to the lesion-extension index is shown as compared to negative control Nanobody cAb BCII10 and positive control Nanobody cAb VCAMl-5. The signal obtained on plaque-containing aorta sections was higher for the anti-MMR Nanobody than for the anti-VCAMl Nanobody. Please note that the 3 mice that were tested in this experiment had quite progressed atherosclerotic disease and in fact no lesion-free aorta sections were present in these mice. Therefore, additional experiments will be required to confirm that the signal obtained on the atherosclerotic lesions is higher than the background signal on control aorta sections.

Example 12. In vivo targeting with anti-Macrophage Mannose Receptor Nanobodies in Myocardial- infarction prone Watanabe heritable hyperlipidemic rabbits.

Myocardial-infarction prone Watanabe heritable hyperlipidemic rabbits (WHHLMI rabbits) show hypercholesterolemia due to a deficiency of Low-Density Lipoprotein receptors, a very similar lipoprotein metabolism to humans and a spontaneous development of progressive coronary atherosclerosis and myocardial infarction. They thus represent an ideal animal model for atherosclerosis.

To assess which of the anti-MMR Nanobodies are cross-reactive in rabbits and can thus be used for in vivo imaging experiments in WHHLMI rabbits, an in vivo experiment was performed in which three of the lead anti-MMR nanobodies (MMR Nb ell, NbhmMMRm3.49 and NbhmMMRml4.4) were labeled with ^99m Tc via tricarbonyl chemistry as described previously and injected intravenously in WHHLMI rabbits. All three Nanobodies were cleared via the kidneys and urine. High uptake in liver and bone marrow could also be observed for NbhmMM m3.49 and NbhmMMRml4.4, while no uptake in these or organs was seen for MMR Nb ell (Figure 12). Thus, it seems NbhmMMRm3.49 and NbhmMMRml4.4 but not MMR Nb ell are cross-reactive in rabbits.

The cross-reactive Nanobodies will next be ^99m Tc-labeled and injected in WHHLMI rabbits of 12-20 months old, which have different stages of atherosclerosis development. At 3h post-injection, the animals will be euthanized, the aortas will be removed and cut into segments of 1-2 cm long. The segments will be weighted and radioactivity will be counted in a gamma-well counter. For each aorta segment, the plaques will be classified in 4 groups based on the American Heart Association (AHA) recommendations: neo-intimal, atheromatous, fibroatheromatous and collagen-rich lesions. The classification will be obtained after histologic evaluation (HES- and tri-chrome staining). Additional characteristics will be evaluated with immunohistology (expression of MMR, VCAM-1, Lox-1, Macrophage infiltration, lipid infiltration, hemorrhages, calcification...). The radioactive signals will then be correlated with the histological findings to assess the association of the obtained signal for anti-MMR Nanobodies with the stage and vulnerability of the plaques.

Example 13. Anti-MMR Nanobody-based immunohistochemistry on human clinical samples of atherosclerotic plaques

In order to test the relevancy of anti-MMR Nanobodies for targeting of human vulnerable atherosclerotic plaques, immunohistochemistry analysis will be performed on human clinical samples of atherosclerotic plaques. As a preparatory step, the conditions for performing immunohistochemistry using the anti-MMR Nanobodies will be optimized using control MMR positive tissue samples (such as human liver). In particular, the Nanobody clones recognizing human MMR will be subcloned and produced in fusion with a detection tag such as hemagglutinin (HA) for detection by secundary anti-HA reagents. Also, it will be evaluated which of the anti-MMR Nanobody clones are optimal for immunohistochemistry.

Using the optimized reagents, immunohistochemistry analysis will next be performed on human clinical samples of whole-mount carotid endarterectomy specimens and the signals obtained using the anti-MMR Nanobodies will be correlated with the stage and vulnerability of the various plaques. Example 14. In vivo targeting and PET/CT based in vivo imaging with anti-Macrophage Mannose Receptor Nanobodies in Myocardial-infarction prone Watanabe heritable hyperlipidemic rabbits. Taking into account the resolution required for optimal in vivo imaging of atherosclerotic lesions, the anti-MMR Nanobody NbhmMMRm3.49 and the control Nanobody cAbBclllO were 18F labeled for PET imaging. Male WHHLMI rabbits of 13-16 months old were injected with 18F-labeled Nanobodies via marginal ear vein. For the control Nanobody, signals were only detected in kidneys and bladder (Figure 13 and Figure 14; right column). Rabbits injected with the anti-MMR nanobody additionally exhibited marked signals in the liver and the skin. Interestingly, atherosclerotic lesions in the abdominal aorta (Figure 13; left column) and carotid artery (Figure 14; left column) of rabbits were readily visualized using NbhmMMRm3.49.

Example 15. In vivo targeting and PET/CT based in vivo imaging with anti-Macrophage Mannose Receptor Nanobodies in a myocardial ischemia/reperfusion injury (IRI) rat model

Improving the management of acute myocardial ischemia (Ml) has led to a decrease in early mortality in Europe. However, ischemic heart diseases remain the most important cause of morbidity and mortality in developed countries. Studies have shown that the inflammatory process after Ml might be of interest for prognosing patient outcome, such as evaluating the risk of developing heart remodeling and/or heart failure, and treatment decisions. Therefore, methods for the in vivo assessment of different subsets of immune responses after Ml are warranted. Here, the expression profile of M2- inflammation over time was imaged, using radiolabeled Nanobodies (Nbs) targeting the macrophage mannose receptor (MMR, CD206+), in a myocardial ischemia/reperfusion injury (IRI) rat model (see Material and Methods section). Myocardial IRI was induced by ligation of the left anterior descending coronary artery during 60 minutes followed by loosening of the suture in 17 Wistar rats. Seven animals were sham operated. The infarct size was assessed by a ^99m Tc-Tetrofosmin scan on day 2. Pinhole-SPECT^CT acquisitions of ^99m Tc-MMR-Nb were taken at baseline, at day (D) 5, 9, 12, 16, 21, 28 and 3 months after IRI. Four animals died during the procedure and 4 animals died shortly thereafter. Infarct zone (IZ), expressed as total perfusion deficit (TPD), was 11.72 ± 5.50. The ratio of the ^99m Tc-MMR-Nb uptake in IRI and sham- operated rats was significantly different over time (F(6,48)=2.57, p=.03) (Figures 15). There was a significant difference on D5, D9, D12 and D16 (p<.05) between sham and IRI, but no difference was observed at baseline and after D16 (Figure 16). A significant correlation was also present between the in vivo quantified mean ratio of ^99m Tc-MMR-Nb uptake and TPD (r=.824, n=12, p<.001) (Figure 17). Ex vivo immunofluorescence staining on cardiac cryo-sections demonstrated the presence of MMR in the IZ and the surrounding pericardium, this was in accordance with the localization of in vivo uptake. Furthermore, MMR co-localized with CD68 on double immunofluorescence staining (Figures 18-19). Table 1: Anti- mouse CD206 (MMR) Nanobodies (anti-MMR Nanobody clone 1 and 3): monovalent en bivalent constructs and Nanobodies

GGTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACACGGCCGTCTATTACTGTAAT

GCTAACACCTATAGCGACTCTGACGTTTATGGCTACTGGGGCCAGGGGACCCAGGTC

ACCGTCTCCTCAAGCCCATCTACACCTCCCACACCATCACCATCCACACCACCGGCA AG

TC AG GTG C AG CTG C AG G AGTCTG G AG G AG G CTTG GTG C AG CCTG G GG G GTCTCTG A

GACTCTCCTGTGCAGCCTCTGGAAACATCTTCAGTATCAATGCCATCGGCTGGTACC G

CCAGGCTCCAGGGAAGCAGCGCGAGTTGGTCGCAACTATTACTCTTAGTGGTAGCAC

AAACTATGCAGACTCCGTGAAGGGCCGATTCTCCATCTCCAGAGACAACGCCAAGAA

CACGGTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACACGGCCGTCTATTACTG T

AATGCTAACACCTATAGCGACTCTGACGTTTATGGCTACTGGGGCCAGGGGACCCAG

GTCACCGTCTCCTCACACCACCATCACCATCAC

Amino acid seq + QVQLQESGGGLVQPGGSLRLSCAASGN I FSINAIGWYRQAPGKQRELVATITLSGSTNYA His tag DSVKGRFSISRDNAKNTVYLQM NSLKPEDTAVYYCNANTYSDSDVYGYWGQGTQVTVSS

(M MR biv IgA) SPSTPPTPSPSTPPASQVQLQESGGGLVQPGGSLRLSCAASGNI FSINAIGWYRQAPGKQ SEQ I D N0:5 RELVATITLSGSTNYADSVKGRFSISRDNAKNTVYLQMNSLKPEDTAVYYCNANTYSDSD V

YG YWGQGTQVTVSS H H H H H H

DNA seq + His tag CAGGTGCAGCTTCAGGAGTCTGGAGGAGGCTTGGTGCAGCCTGGGGGGTCTCTGAG (M MR biv ACTCTCCTGTGCAGCCTCTGGAAACATCTTCAGTATCAATGCCATCGGCTGGTACCGCC (Gly4Ser)3) AGGCTCCAGGGAAGCAGCGCGAGTTGGTCGCAACTATTACTCTTAGTGGTAGCACAA SEQ ID NO:139 ACTATGCAGACTCCGTGAAGGGCCGATTCTCCATCTCCAGAGACAACGCCAAGAACAC

GGTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACACGGCCGTCTATTACTGTAAT

GCTAACACCTATAGCGACTCTGACGTTTATGGCTACTGGGGCCAGGGGACCCAGGTC

ACCGTCTCCTCAGGCGGAGGCGGTAGTGGCGGAGGTGGATCTGGAGGCGGCGGTAG

TCAGGTGCAGCTGCAGGAGTCTGGAGGAGGCTTGGTGCAGCCTGGGGGGTCTCTGA

G ACTCTCCTGTG C AG CCTCTG G A AAC ATCTTC AGTATC AATG CC ATCG G CTG GTACCG

CC AG G CTCC AG G G A AG CAGCGCGAGTTGGTCG C AACTATT ACTCTTAGTG GT AG C AC

AAACTATGCAGACTCCGTGAAGGGCCGATTCTCCATCTCCAGAGACAACGCCAAGAA

CACGGTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACACGGCCGTCTATTACTG T

AATGCTAACACCTATAGCGACTCTGACGTTTATGGCTACTGGGGCCAGGGGACCCAG

GTCACCGTCTCCTCACACCACCATCACCATCAC

Amino acid seq + QVQLQESGGGLVQPGGSLRLSCAASGN I FSINAIGWYRQAPGKQRELVATITLSGSTNYA His tag DSVKGRFSISRDNAKNTVYLQM NSLKPEDTAVYYCNANTYSDSDVYGYWGQGTQVTVSS (M M R biv GGGGSGGGGSGGGGSQVQLQESGGGLVQPGGSLRLSCAASGN I FSINAIGWYRQAPGK (Gly4Ser)3) QRELVATITLSGSTNYADSVKGRFSISRDNAKNTVYLQMNSLKPEDTAVYYCNANTYSDS D SEQ ID N0:6 VYG YWGQGTQVTVSS H H H H H H

DNA seq + His tag CAGGTGCAGCTTCAGGAGTCTGGAGGAGGCTTGGTGCAGCCTGGGGGGTCTCTGAG (M MR biv g2c) ACTCTCCTGTGCAGCCTCTGGAAACATCTTCAGTATCAATGCCATCGGCTGGTACCGCC SEQ ID N0:140 AGGCTCCAGGGAAGCAGCGCGAGTTGGTCGCAACTATTACTCTTAGTGGTAGCACAA

ACTATGCAGACTCCGTGAAGGGCCGATTCTCCATCTCCAGAGACAACGCCAAGAACAC

GGTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACACGGCCGTCTATTACTGTAA T

GCTAACACCTATAGCGACTCTGACGTTTATGGCTACTGGGGCCAGGGGACCCAGGTC

ACCGTCTCCTCAGCGCACCACAGCGAAGACCCCAGCTCCAAAGCTCCCAAAGCTCCA A

TG G C AC AG GTG C AG CTG C AG G AGTCTG GAG GAG G CTTG GTG C AG CCTG G G G G GTCT

CTGAGACTCTCCTGTGCAGCCTCTGGAAACATCTTCAGTATCAATGCCATCGGCTGG T

ACCGCCAGGCTCCAGGGAAGCAGCGCGAGTTGGTCGCAACTATTACTCTTAGTGGTA

GCACAAACTATGCAGACTCCGTGAAGGGCCGATTCTCCATCTCCAGAGACAACGCCA A

GAACACGGTGTATCTGCAAATGAACAGCCTGAAACCTGAGGACACGGCCGTCTATTA

CTGTA ATG CTA AC ACCTATAG CG ACTCTG ACGTTTATG G CT ACTG GGGCCAGGGGACC

CAGGTCACCGTCTCCTCACACCACCATCACCATCAC

Aminoacid seq + QVQLQESGGGLVQPGGSLRLSCAASGN I FSINAIGWYRQAPGKQRELVATITLSGSTNYA His tag DSVKGRFSISRDNAKNTVYLQM NSLKPEDTAVYYCNANTYSDSDVYGYWGQGTQVTVSS

(M M R biv g2c) AHHSEDPSSKAPKAPMAQVQLQESGGGLVQPGGSLRLSCAASGN IFSI NAIGWYRQAPG SEQ ID N0:7 KQRELVATITLSGSTNYADSVKGRFSISRDNAKNTVYLQMNSLKPEDTAVYYCNANTYSD S DVYGYWGQGTQVTVSS H H H H H H

Table 2. SPR kinetic and equilibrium parameters for anti-MMR Nanobodies and bivalent Nanobody 1 derivatives.

Nb:Nanobody; biv: bivalent; GS: (Gly ₄ Ser) ₃ linker; g2c: llama lgG2 hinge linker; IgA: human IgA hinge linker; SE: standard error.

Table 3. Uptake values of ^m Tc-labeled anti-MMR Nb clone 1 in naive and MMR ' mice based on Pinhole SPECT/micro-CT at 1 hour post injection.

Tracer uptake is expressed as percentage injected activity per gram cubic centimeter (%IA/cm ³ ).

Organs/Tissues MMR Nb in WT (%IA/cm ³ ) MMR Nb in MMR ^"7" (%IA/cm ³ )

Heart 2.04 ± 0.21 1.13 ± 0.12

Lungs 5.96 ± 0.16 9.06 ± 2.43

Liver 18.66 ± 0.87 0.91 ± 0.16

Spleen 6.17 ± 0.31 0.34 ± 0.21

Kidney Left 80.98 ± 1.65 100.58 ± 0.4

Kidney Right 81.65 ± 2.32 102.82 ± 6.17

Muscle 1.74 ± 0.50 0.39 ± 0.22

Bone 5.02 ± 0.01 0.46 ± 0.02 Table 4. Uptake values of Tc-labeled bivalent anti-MMR Nb constructs (with (G ₄ S) ₃ , llama lgG2 hinge or human IgA hinge linkers), monovalent anti-MMR Nb clone 1, and control cAbBCIIlO Nb in naive and MMR ⁷ mice based on Pinhole SPECT/micro-CT at 1 hour post injection. Tracer uptake is expressed as percentage injected activity per gram cubic centimeter (%IA/cm ³ ).

Organs- (G4S)3 (G4S)3 Llama Llama lgG2c Human IgA Human IgA MMR Nb cAbBCIIlO lgG2c

Tissues WT MMR-/- MMR-/- WT MMR-/- WT WT

(%IA/cm3) (%IA/cm3) WT (%IA/cm3) (%IA/cm3) (%IA/cm3) (%IA/cm3) (%IA/cm3)

(%IA/cm3)

Lungs 1.053 ± 0.082 1.246 ± 0.038 0.987 ± 1.271 ± 0.130 0.936 ± 0.086 1.169 ± 2.543 ± 1.837 ±

0.167 0.161 0.417 0.271

Liver 20.857 ± 0.930 ± 0.081 20.491 ± 1.658 ± 0.077 21.571 ± 1.176 ± 13.670 ± 2.637 ±

0.215 0.578 0.435 0.044 0.741 0.203

Spleen 14.018 ± 0.634 ± 0.042 13.618 ± 1.347 ± 0.300 13.805 ± 0.477 ± 13.070 ± 0.933 ±

1.669 1.497 1.353 0.007 0.251 0.113

Kidney 26.381 ± 225.129 ± 24.257 ± 193.162 ± 8.114 26.728 ± 210.760 ± 160.443 ± 415.643 ±

Left 2.054 13.936 1.129 3.014 14.414 13.153 15.162

Kidney 26.074 ± 212.682 ± 24.599 ± 202.343 ± 0.779 24.947 ± 214.144 ± 159.003 ± 408.597 ±

Right 2.227 6.308 2.053 2.463 11.751 13.700 22.588

Bone 1.466 ± 0.062 0.282 ± 0.016 1.041 ± 0.254 ± 0.030 1.089 ± 0.138 0.263 ± ND ND

0.114 0.022 Table 5. Anti-human MMR Nbs selected after ELISA on human MMR of PE-extracts from single Nb clones isolated from phage display. In addition to the Nb sequence sensu strictu depicted here, all clones also carry a C-terminal extension containing a HA and 6xHis tag (AAAYPYDVPDYGSHHHHHH; SEQ ID NO: 170). CD 1 (red), CDR2 (green) and CDR3 (blue) domains are also indicated, and are listed separately in Table 10.

Table 6. Anti-human/mouse MMR cross-reactive Nbs selected after ELISA on human MMR and mouse MMR of PE-extracts from single Nb clones isolated from phage display. In addition to the Nb sequence sensu strictu depicted here, all clones also carry a C-terminal extension containing a HA and 6xHis tag (AAAYPYDVPDYGSHHHHHH; SEQ ID NO: 170). CD 1 (red), CDR2 (green) and CDR3 (blue) domains are also indicated, and are listed separately in Table 10.

Name SEQ ID Sequence

NO:

NbhmMM 36 QVQLQESGGGLVQPGGSLRLSCTASGFPFSSAPMSWVRQAPGKELEWVSYIGYTGTITDY ANSVKGRFTISRDN Rm26.70 AKNRLYLQMNSLXPEDTAVYFCAQGYARLIADSDLVRGQGTQVTVSS

NbhmMM 37 QVQLQESGGRLGAAGGSLRLSCTASGFPFNIYPMSWVRQAPGKGFEWVSYISHGGTTTDY SDAVKGRFTISRD Rm27.95 NAKNRLYLQMDSLXPEDTAVYFCAQGYARLMTDSELVRGQGTQVTVSS

Table 7. Production yields and physico-chemical characteristics of the anti-human MMR and anti- human/mouse MMR cross-reactive Nbs. All N bs produce between 0.7 and 9 mg/l E coli culture. T.B. D. : to be determined.

Extinction Estimated number of MW

Theoretical coefficient production

Name A.A. Nb+HA+His

Pi (assuming all Cys capacity (g/l £ Nb+HA+His (dalton)

form cystines) Coli)

NbhMMRm21.22 137 15045 5.91 26025 2.1

NbhmMMRml4.93 141 15289 6.63 26025 2.6

NbhmMMRml5.49 131 14226 8.00 30035 4.0

NbhmMMRml7.72 138 14896 7.18 24535 3.4

NbhmMMRml0.79 140 15130 6.63 31525 T.B.D

NbhmMMRm7.67 137 15153 7.18 30035 4.0

NbhmMMRm8.67 151 16635 6.76 40005 2.0

NbhmMMRml3.89 139 15096 6.70 30035 5.4

NbhmMMRml8.63 135 14393 7.18 34045 9.0

NbhmMMRm25.86 135 14891 6.29 24535 3.9

NbhmMMRm26.70 140 15299 7.18 24535 6.0

NbhmMMRm27.95 140 15392 7.22 24535 1.0

Table 8. SPR kinetic and equilibrium parameters for anti-MMR Nanobodies on mouse MMR.

N b:Nanobody; SE: standard error; NB: no binding.

Table 9. SPR kinetic and equilibrium parameters for anti-MMR Nanobodies on human MMR.

Nb: Nanobody; SE: standard error; NB: no binding.

NbhmMM m21.22 3.4 E+5 1.2 E-3 3.6 E-9 1.72

NbhmMMRm22.84 4.9 E+4 1.9 E-3 3.8 E-8 0.262

NbhmMMRm24.31 2.6 E+5 6.9 E-4 2.7 E-9 0.386

NbhmMMRm26.70 5.8 E+5 7.3 E-3 1.3 E-8 1.03

Table 10. CDRs of MMR-specific Nanobodies

Nanobody SEQ ID NO ¹ CDR1 CDR2 CDR3 reference number

NbhmMMRm24.31 21 GFTLKNHHIG (SEQ ID SINSSGGST (SEQ ID LRRYYGLN LDPGSYDY (SEQ ID

NO:53) NO:85) NO:117)

NbhmMMRm20.52 22 GRIFSAYAMG (SEQ ID AISRSGDST (SEQ ID RTVSAPPSAAWGYGY (SEQ ID

NO:54) NO:86) NO:118)

NbhmMMRm3.49 23 GFSLDYYAIG (SEQ ID CISYKGGST (SEQ ID GFVCYNYDY (SEQ ID NO:119)

NO:55) NO:87)

NbhmMMRm22.84 24 GRTFSNYVNYAMG (SEQ SISWSSVTT fSEQ ID HLAQYSDYAYRDPHQFGA (SEQ ID

ID NO:56) NO:88) NO:120)

NbhmMMRml9.52 25 GDTFSNYVMA (SEQ ID AIRLSGAR (SEQ ID GHTWGQYAY (SEQ ID NO:121)

NO:57) NO:89)

NbhmMMRm21.22 26 GRTFSSAAMG (SEQ ID LINLDDGET (SEQ ID RGRFDDNYEY (SEQ ID NO:122)

NO:58) NO:90)

NbhmMMRml4.93 27 GRTFSINYMG (SEQ ID AITSGSGST (SEQ ID DMDSSLSGGYVDV (SEQ ID

NO:59) NO:91) NO:123)

NbhmMMRml5.49 28 GSTFSINNMG (SEQ ID GITGGNT (SEQ ID NWGAY (SEQ ID NO:124)

NO:60) NO:92)

NbhmMMRml7.72 29 GSIVSINAMG (SEQ ID LVTGSGRT (SEQ ID LVIGPLEGYDY (SEQ ID NO:125)

NO:61) NO:93)

NbhmMMRml0.79 30 GSIFSIKTMG (SEQ ID AVSSGGST (SEQ ID DGVVAWDQPYDNY (SEQ ID

NO:62) NO:94) NO:126)

NbhmMMRm7.67 31 GRTFSVNAMA (SEQ ID SITSSGLDT (SEQ ID ERWDNGMVY (SEQ ID NO:127)

NO:63) NO:95)

NbhmMMRm8.67 32 GSMFSINAWG (SEQ ID SITSGGGST (SEQ ID ERWDGYALGYSPNHGSGHRPYNY

NO:64) NO:96) (SEQ ID NO:128)

NbhmMMRml3.89 33 GSIFSINAWG (SEQ ID EITSSGST (SEQ ID VAVTFTTPRSDY (SEQ ID NO:129)

NO:65) NO:97)

NbhmMMRml8.63 34 GSIISINAMA (SEQ ID AISSGGST (SEQ ID GGGWRPGA (SEQ ID NO:130)

NO:66) NO:98)

NbhmMMRm25.86 35 GFTVSTSMIN (SEQ ID DVLPSGST (SEQ ID NRETMPPF (SEQ ID NO:131)

NO:67) NO:99)

NbhmMMRm26.70 36 GFPFSSAPMS (SEQ ID YIGYTGTIT (SEQ ID GYARUADSDLV (SEQ ID NO:132)

NO:68) NO: 100)

NbhmMMRm27.95 37 GFPFNIYPMS (SEQ ID YISHGGTTT (SEQ ID GYARLMTDSELV (SEQ ID NO:133)

NQ:69) NO:101)

Nanobody sequences without His tag Table 11. Amino acid sequences of human and mouse macrophage mannose receptor

KCFKIFGFMEEERKNWQEARKACIGFGGNLVSIQNEKEQAFLTYHMKDS

TFSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPGGRRSSLSYEDA

DCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGF

VKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNAFAWLQMETS

NERVWIALNSNLTDNQYTWTDKWRVRYTNWAADEPKLKSACVYLDLD

GYWKTAHCNESFYFLCKRSDEIPATEPPQLPGRCPESDHTAWIPFHGHCY

YIESSYTRNWGQASLECLRMGSSLVSIESAAESSFLSYRVEPLKSKTNFWIG

LFRNVEGTWLWINNSPVSFVNWNTGDPSGERNDCVALHASSGFWSNIH

CSSYKGYICKRPKIIDAKPTHELLTTKADTRKMDPSKHHHHHH

Mouse MMR 143 MRLLLLLAFISVIPVSVQLLDARQFLIYNEDHKRCVDALSAISVQTATCNPE (Mrcl) AESQKFRWVSDSQIMSVAFKLCLGVPSKTDWASVTLYACDSKSEYQKWE

CKNDTLFGIKGTELYFNYGNRQEKNIKLYKGSGLWSRWKVYGTTDDLCSR

GYEAMYSLLGNANGAVCAFPFKFENKWYADCTSAGRSDGWLWCGTTT

DYDKDKLFGFCPLHFEGSERLWNKDPLTGILYQINSKSALTWHQARASCK

QQNADLLSVTEIHEQMYLTGLTSSLSSGLWIGLNSLSVRSGWQWAGGSP

FRYLNWLPGSPSSEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNNTL

NPFIIPSASDVPTGCPNQWWPYAGHCYRIHREEKKIQKYALQACRKEGG

DLASIHSIEEFDFIFSQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTK

WLPGEPSHENNRQEDCVVMKGKDGYWADRACEQPLGYICKMVSQSH

AVVPEGADKGCRKGWKRHGFYCYLIGSTLSTFTDANHTCTNEKAYLTTVE

DRYEQAFLTSLVGLRPEKYFWTGLSDVQNKGTFRWTVDEQVQFTHWNA

DMPGRKAGCVAMKTGVAGGLWDVLSCEEKAKFVCKHWAEGVTRPPEP

TTTPEPKCPENWGTTSKTSMCFKLYAKGKHEKKTWFESRDFCKAIGGELA

SIKSKDEQQVIWRLITSSGSYHELFWLGLTYGSPSEGFTWSDGSPVSYEN

WAYGEPNNYQNVEYCGELKGDPGMSWNDINCEHLNNWICQIQKGKTL

LPEPTPAPQDNPPVTADGWVIYKDYQYYFSKEKETMDNARAFCKKNFGD

LATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSKVDFVA

WATGEPNFANDDENCVTMYTNSGFWNDINCGYPNNFICQRHNSSINA

TAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGL

KGNLVSIENAQEQAFVTYHMRDSTFNAWTGLNDINAEHMFLWTAGQG

VHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSK

QGYICQTQTDPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCK

DHTSLLASILDPYSNAFAWMKMHPFNVPIWIALNSNLTNNEYTWTDRW

RVRYTNWGADEPKLKSACVYMDVDGYWRTSYCNESFYFLCKKSDEIPAT

EPPQLPGKCPESEQTAWIPFYGHCYYFESSFTRSWGQASLECLRMGASLV

SIETAAESSFLSYRVEPLKSKTNFWIGMFRNVEGKWLWLNDNPVSFVNW

KTGDPSGERNDCVVLASSSGLWNNIHCSSYKGFICKMPKIIDPVTTHSSITT

KADQRKMDPQPKGSSKAAGVVTVVLLIVIGAGVAAYFFYKKRHALHIPQE

ATFENTLYFNSNLSPGTSDTKDLMGNIEQNEHAII

Recombinant 144 LLDARQFLIYNEDHKRCVDALSAISVQTATCNPEAESQKFRWVSDSQIMS mouse MMR VAFKLCLGVPSKTDWASVTLYACDSKSEYQKWECKNDTLFGIKGTELYFN (R&D systems) YGNRQEKNIKLYKGSGLWSRWKVYGTTDDLCSRGYEAMYSLLGNANGA

VCAFPFKFENKWYADCTSAGRSDGWLWCGTTTDYDKDKLFGFCPLHFE

GSERLWNKDPLTGILYQINSKSALTWHQARASCKQQNADLLSVTEIHEQ

MYLTGLTSSLSSGLWIGLNSLSVRSGWQWAGGSPFRYLNWLPGSPSSEP

GKSCVSLNPGKNAKWENLECVQKLGYICKKGNNTLNPFIIPSASDVPTGC

PNQWWPYAGHCYRIHREEKKIQKYALQACRKEGGDLASIHSIEEFDFIFSQ

LGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLPGEPSHENNRQED

CVVMKGKDGYWADRACEQPLGYICKMVSQSHAVVPEGADKGCRKGW

KRHGFYCYLIGSTLSTFTDANHTCTNEKAYLTTVEDRYEQAFLTSLVGLRPE

KYFWTGLSDVQNKGTFRWTVDEQVQFTHWNADMPGRKAGCVAMKT

GVAGGLWDVLSCEEKAKFVCKHWAEGVTRPPEPTTTPEPKCPENWGTT SKTSMCFKLYAKGKHEKKTWFESRDFCKAIGGELASIKSKDEQQVIWRLIT

SSGSYHELFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYC

GELKGDPGMSWNDINCEHLNNWICQIQKGKTLLPEPTPAPQDNPPVTA

DGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYI

NKNGGQSPYFIGMLISMDKKFIWMDGSKVDFVAWATGEPNFANDDEN

CVTMYTNSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKE

GWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQEQAF

VTYHMRDSTFNAWTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGR

RSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTDPSLPVS

PTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDHTSLLASILDPYSNAF

AWMKMHPFNVPIWIALNSNLTNNEYTWTDRWRVRYTNWGADEPKLK

SACVYMDVDGYWRTSYCNESFYFLCKKSDEIPATEPPQLPGKCPESEQTA

WIPFYGHCYYFESSFTRSWGQASLECLRMGASLVSIETAAESSFLSYRVEPL

KSKTNFWIGMFRNVEGKWLWLNDNPVSFVNWKTGDPSGERNDCVVL

ASSSGLWNNIHCSSYKGFICKMPKIIDPVTTHSSITTKADQRKMDPQPKGS

SKAHHHHHH

Human MMR 145 LLDTRQFLIYNEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIM (MRC1) - SVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFN ectodomain YGNRQEKNIMLYKGSGLWSRWKIYGTTDNLCSRGYEAMYTLLGNANGA

TCAFPFKFENKWYADCTSAGRSDGWLWCGTTTDYDTDKLFGYCPLKFEG

SESLWNKDPLTSVSYQINSKSALTWHQARKSCQQQNAELLSITEIHEQTYL

TGLTSSLTSGLWIGLNSLSFNSGWQWSDRSPFRYLNWLPGSPSAEPGKSC

VSLNPGKNAKWENLECVQKLGYICKKGNTTLNSFVIPSESDVPTHCPSQW

WPYAGHCYKIHRDEKKIQRDALTTCRKEGGDLTSIHTIEELDFIISQLGYEP

NDELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVVM

KGKDGYWADRGCEWPLGYICKMKSRSQGPEIVEVEKGCRKGWKKHHFY

CYMIGHTLSTFAEANQTCNNENAYLTTIEDRYEQAFLTSFVGLRPEKYFWT

GLSDIQTKGTFQWTIEEEVRFTHWNSDMPGRKPGCVAMRTGIAGGLW

DVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCFKL

YAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKL

FWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDP

TMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYK

DYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQ

SAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCVTMYSNS

GFWNDINCGYPNAFICQRHNSSINATTVMPTMPSVPSGCKEGWNFYSN

KCFKIFGFMEEERKNWQEARKACIGFGGNLVSIQNEKEQAFLTYHMKDS

TFSAWTGLNDVNSEHTFLWTDGRGVHYTNWGKGYPGGRRSSLSYEDA

DCVVIIGGASNEAGKWMDDTCDSKRGYICQTRSDPSLTNPPATIQTDGF

VKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNAFAWLQMETS

NERVWIALNSNLTDNQYTWTDKWRVRYTNWAADEPKLKSACVYLDLD

GYWKTAHCNESFYFLCKRSDEIPATEPPQLPGRCPESDHTAWIPFHGHCY

YIESSYTRNWGQASLECLRMGSSLVSIESAAESSFLSYRVEPLKSKTNFWIG

LFRNVEGTWLWINNSPVSFVNWNTGDPSGERNDCVALHASSGFWSNIH

CSSYKGYICKRPKIIDAKPTHELLTTKADTRKMDPSK

Mouse MMR 146 LLDARQFLIYNEDHKRCVDALSAISVQTATCNPEAESQKFRWVSDSQIMS (Mrcl) - VAFKLCLGVPSKTDWASVTLYACDSKSEYQKWECKNDTLFGIKGTELYFN ectodomain YGNRQEKNIKLYKGSGLWSRWKVYGTTDDLCSRGYEAMYSLLGNANGA

VCAFPFKFENKWYADCTSAGRSDGWLWCGTTTDYDKDKLFGFCPLHFE

GSERLWNKDPLTGILYQINSKSALTWHQARASCKQQNADLLSVTEIHEQ

MYLTGLTSSLSSGLWIGLNSLSVRSGWQWAGGSPFRYLNWLPGSPSSEP

GKSCVSLNPGKNAKWENLECVQKLGYICKKGNNTLNPFIIPSASDVPTGC

PNQWWPYAGHCYRIHREEKKIQKYALQACRKEGGDLASIHSIEEFDFIFSQ LGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLPGEPSHENNRQED

CVVMKGKDGYWADRACEQPLGYICKMVSQSHAVVPEGADKGCRKGW

KRHGFYCYLIGSTLSTFTDANHTCTNEKAYLTTVEDRYEQAFLTSLVGLRPE

KYFWTGLSDVQNKGTFRWTVDEQVQFTHWNADMPGRKAGCVAMKT

GVAGGLWDVLSCEEKAKFVCKHWAEGVTRPPEPTTTPEPKCPENWGTT

SKTSMCFKLYAKGKHEKKTWFESRDFCKAIGGELASIKSKDEQQVIWRLIT

SSGSYHELFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYC

GELKGDPGMSWNDINCEHLNNWICQIQKGKTLLPEPTPAPQDNPPVTA

DGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYI

NKNGGQSPYFIGMLISMDKKFIWMDGSKVDFVAWATGEPNFANDDEN

CVTMYTNSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKE

GWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQEQAF

VTYHMRDSTFNAWTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGR

RSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTDPSLPVS

PTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDHTSLLASILDPYSNAF

AWMKMHPFNVPIWIALNSNLTNNEYTWTDRWRVRYTNWGADEPKLK

SACVYMDVDGYWRTSYCNESFYFLCKKSDEIPATEPPQLPGKCPESEQTA

WIPFYGHCYYFESSFTRSWGQASLECLRMGASLVSIETAAESSFLSYRVEPL

KSKTNFWIGMFRNVEGKWLWLNDNPVSFVNWKTGDPSGERNDCVVL

ASSSGLWNNIHCSSYKGFICKMPKIIDPVTTHSSITTKADQRKMDPQPKGS

SKA

Rat 147 MEHTLWAMRLPLLLAFISVIPVAVQLLDSRQFLIYNEDHKRCVDALSAISV

QTATCNPEAESQKFRWVSESQIMSVAFKLCLGVPSKTDWASVTLYACDS

Full-length

KSEFQKWECKNDTLFGIKGTELYFNYGNRQEKNIKLYKGSGLWSRWKVY

Rattus

GTTDDLCSRGYEAMYSLLGNANGAVCAFPFKFENKWYADCTSAGRSDG

norvegicus

WLWCGTTTDYDTDKLFGFCPLQFEGSKRLWNTDPLTGILYQINSKSALT

MRC1 (NCBI

WHQARASCKQQNAELLSVTEIHEQMYLTGLTSSLTSGLWIGLNSLSLSTG

Reference

WQWAGGSPFRYLNWLPGSPSSEPGKSCVSLNPGKNAKWENLECVQKL

Sequence:

GYICKKGNNTLNPFIIPSESDVPTACPNQWWPYAGHCYRIYREEKKIQKYA

NP_00109959

LQACRKEGGDLASIHSIEEFDFIFSQLGYEPNDELWIGLNDIKIQMYFEWS

3.1)

DGTPVTFTKWLPGEPSHENNRQEDCVVMKGKDGYWADRACEQPLGYI

CKMVSQIHTVIPEGAEKGCRKGWKRHGFYCYLIGSTLSTFADANQTCTNE

KAY LTTV E D R YEQA F LTS LVG L R P E KY F WTG LS DVQN KGT F R WTV D EQV

QFTHWNADMPGRKAGCVAMKTGVAGGLWDVLSCEEKAKFVCKHWAE

GVTRPPEPTTTPEPKCPEDWGTTSKTSMCFKLYAKGKHEKKTWFESRDFC

KAIGGELASIKSKDEQQVIWRLITSSGSYHELFWLGLTYGSPSEGFTWSDG

SPVSYENWAYGEPNNYQNVEYCGELKGDPGMSWNDINCEHLNNWICQ

IQKGKTLLPEPTPAPQDNPPVTADGWVIYKDYQYYFSKEKETMDNARAF

CKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGLLISLDKKFIWMDGSK

VDFVAWATGEPNFANDDENCVTMYTNSGFWNDINCGYPNNFICQRHN

SSINATAMPTTPPTPGGCKEGWHLYNNKCFKIFGFAEEEKKTWKEARKA

CIGLKGNLVSIENAKEQAFVTYHMRDSTFNAWTGLNDVNSEHTFLWTD

GRGVHYTNWGKGYPGGRRSSLSYEDVDCVVVIGGNSREAGTWMDSTC

DSKQGYICQTQTDPSVPISPTTAPKDGFVKYGKSSYALMKLKSPWHEAEK

YCKDRTSLLASILDPYSNAFAWMKMHPFNVPIWIALNSNLTNNEYTWTD

KWRVRYTNWGTDEPKLKSACVYMDVDGYWKTSYCNESFYFLCKKSDEIP

ATEPPQLPGKCPESEQTAWIPFHGHCYYIESSFTRSWGQASLECLRMGAS

LVSIETAAESSFLSYRVEPLKSKTNFWIGMFRNVEGKWLWLNDNPVSFVN WKTGDPSGERNDCVVLSSSSGLWNNIHCTSYKGFICKMPKIIDPVTTHSSI

TTKADQRKMDPQPKGSSKAAGVVIVVLLIVIGAGVAAYFFYKKRRVLHIP

QEATFENTLYFNSNPSPGTSDTKDLVGNIEQNEHAVI

Rabbit 148 MKPSLLLAFVSVIPAAVQLLDTRQFLIYNEDHKRCVEAISSSAVQTAVCNP

DAESQRFRWVSEFHVMSVAFKLCLGVPSKTDWVSVTLYNCDSKSEFQK

Full-length

WECKNDTLFGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYGTTDDL

Oryctolagus

CSRGYEAMYTLLGNANGATCAFPFKFQNKWYADCTSAGRSDGWLWCG

cuniculus

TTTDYDADKLFGFCPVKFEGSESLWNKDPLTSISYQINSKSALTWHQARKS MRC1 (NCBI

CQQQNAELLSITEIHEQTYLTGLTSSLTSGLWIGLNSLSFNSGWQWSGGS

Reference

PFRYLNWLPGSPSAEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTS

Sequence:

LNSFVIPSESDVPTNCPSQWWPYAGHCYRIHREEKKIQKDALIACRKEGG XP_002717402

DLASIHSIEEFDFIISQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKW

•1) FRGEPSHENNRQEDCVVMKGKDGYWADRACERPLNYICKMTSRTQAT

GIVEVETGCRKGWKRHGFYCYLIGHTLSTFTEANQTCESEKAYLTTVEDRY

EQAFLTSLIGLRPEKYFWTGLSDIQNKGTFQWTIEEEVQFTHWNSDMPG

RKAGCVAMRTGIAGGLWDILKCDEKAKFVCKHWAEGVTRPPEPTTTPEP

RCPEDWGTSSKTSLCFKLFAKGKHEKKTWFESRDFCRAVGGELASINNKE

EQQIIWRLITAGGSYHELFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEP

NNYQNVEFCGELKADPGMSWNDINCEHLNNWICQIQKGQTLKPEPTPA

PQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIKSES

EKKFLWKYVNRNDAQTAYFIGLLVSLDKKFAWMDGSKVDYVSWATGEP

NFANEDENCVTMYANSGFWNDINCGYPNAFICQRHNSSINATVMPTVP

PGPRGCKEGWNFYNNKCFKIFGFVEEEKKNWQDARKACIGFGGNLVSIH

NEKEQAFLIYHMKDSTFNAWTGLNDVNSEHTFLWTDGRGVHYTNWGK

GFPGGRRSSLSYEDADCVVIIGGKSRDAGKWMDDTCDSKQGYICQTPSD

PSLPSSRTTVPTDGFIRYGKSSYSLMKLKLQWHEADKYCKDDTSLIASILDP

YSNAFVWMQMQTFNVPVWIALNSNLTNNEYVWTDRWRVRYTNWAP

DEPKLKSACVYLDLDGYWKTAYCNESFYFLCKRSDEIPATEPPQLPGRCPE

SEHTAWIPFHGHCYYIESSYTRNWGQASLECLRMGSSLVSIESASESSFLSY

RVEPLKSKTNFWIGMFRNVEGMWLWVNNNPVSFVNWNTGDPSGERN

DCVLLDASSGLWNNIHCSSYKGYICKRPKIVDAEPTQTEVTTKADSRKDAP

SKKSSSMAGVVIIVTLLILTGAGFAAYFFYKKRRVHIPQEGTFENTLYFNSRS

SPGTSDTKDLMGNIEQNEHAVI