JPH08507692 | [Title of Invention] Insect Control Method |
WO/2022/072335 | RAPID TRANSFORMATION OF MONOCOT LEAF EXPLANTS |
WO/2016/043985 | MODIFIED PLANT WATER USE BY CELL TYPE EXPRESSION OF PYR/PYL PROTEINS |
FELIX GEORG (DE)
WELDLE MELISSA (DE)
WO2014041026A1 | 2014-03-20 | |||
WO2014194882A1 | 2014-12-11 | |||
WO2010139790A1 | 2010-12-09 |
US20040067506A1 | 2004-04-08 | |||
US20100170006A1 | 2010-07-01 | |||
GB2503004A | 2013-12-18 | |||
US4945050A | 1990-07-31 | |||
US5036006A | 1991-07-30 | |||
US5100792A | 1992-03-31 |
EMILIE F. FRADIN ET AL: "Functional Analysis of the Tomato Immune Receptor Ve1 through Domain Swaps with Its Non-Functional Homolog Ve2", PLOS ONE, vol. 9, no. 2, 5 February 2014 (2014-02-05), pages e88208, XP055581543, DOI: 10.1371/journal.pone.0088208
M. ALBERT ET AL: "Arabidopsis thaliana Pattern Recognition Receptors for Bacterial Elongation Factor Tu and Flagellin Can Be Combined to Form Functional Chimeric Receptors", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 285, no. 25, 21 April 2010 (2010-04-21), pages 19035 - 19042, XP055072695, ISSN: 0021-9258, DOI: 10.1074/jbc.M110.124800
ALBERT ET AL., J BIOL CHEM, vol. 285, 2010, pages 19035 - 19042
BRUTUS A ET AL., PROC NATL ACAD SCI USA, vol. 107, 2010, pages 9452 - 9457
MOLECULAR PLANT PATHOLOGY, vol. 6, no. 1, January 2005 (2005-01-01), pages 85 - 97
PLANT PHYSIOL., vol. 132, no. 2, June 2003 (2003-06-01), pages 530 - 43
THE PLANT CELL, vol. 29, April 2017 (2017-04-01), pages 618 - 637
CURTIN, S.J.WANG, M.-B.WATSON, J.M.ROFFEY, P.BLANCHARD, C.L.WATERHOUSE, P.M.: "Rice Functional Genomics; Challenges, Progress and Prospects", 2007, pages: 291 - 332
KLEIN ET AL.: "High- Velocity Microprojectiles for Delivering Nucleic Acids Into Living Cells", NATURE, vol. 327, 1987, pages 70 - 73
EMERSCHAD ET AL.: "Somatic Embryogenesis and Plant Development from Immature Zygotic Embryos of Seedless Grapes (Vitis vinifera", PLANT CELL REPORTS, vol. 14, 1995, pages 6 - 12
SENIOR: "Uses of Plant Gene Silencing", BIOTECHNOLOGY AND GENETIC ENGINEERING REVIEWS, vol. 15, 1998, pages 79 - 119, XP000882203
FRALEY ET AL., PROC. NATL. ACAD. SCI. USA, vol. 79, 1982, pages 1859 - 63
FROMM ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 5824
CLAIMS 1. A chimeric pattern recognition receptor (PRR) for mediating defense reactions, comprising at least an ectodomain, a transmembrane domain, and a cytoplasmatic domain, characterized in that the ectodomain is derived from Leucine Rich Repeat (LRR) Receptor Like Protein (RLP), and at least the transmembrane do main and/or the cytoplasmatic domain is derived from a membrane bound kinase. 2. The chimeric PRR according to claim l, wherein the membrane bound kinase is selected from the group of leucine rich repeat (LRR) receptor-like kinases (RLK), such as a kinase selected from any of the following protein families: C-Lectin, CR4-like, CRPKi-likei, CRPKi-like2, DUF26, Extensin-like, L-Lectin, LRK10- likei, LRKio-like2, GDPDb, LRR I, LRR II, LRR III, LRR IV, LRR V, LRR VI, LRR VII, LRR VIII-l, LRR VIII-2, LRR IX, LRR X, LRR XI, LRR XII, LRR XIII, LRR XIV, LysM, PERK, RKF3-like, RLCK I, RLCK II, RLCK III, RLCK IV, TAK(RLCK V), RLCK VI, RLCK VII, RLCK VIII, RLCK IX, RLCK X, RLCK XI, RLCK XII, S- domaini, S-domain2, S-domain3, Thaumatin, URK I, or WAK-like. 3. The chimeric PRR according to claim 1 or 2, wherein the LRR-RLK is selected from any one of the following RLKs: BAKi, SERK4, SISERKi, BIRi, BIR2, SOBIRi, FER, CRK28, IOSi, PSKRi, PSYiR, ERECTA, SRF3, XA26, dsi, Bti9, SI- Lyki3, THEi, Pi-d2, LecRK-I.9, LecRK-V.5, LecRK-VI.2, NgRLKi, LecRKi, NbLRKi, WAKL22, OsWAKi, TaRLK-Ri,2,3, SNC4, LRK10, SNC2, and RLP52; and preferably wherein the LRR-RLK is SOBIRi. 4. The chimeric PRR according to any one of claims 1 to 3, wherein the transmem brane domain and the cytoplasmatic domain are derived from the LRR-RLK, such as and preferably SOBIRi. 5. The chimeric PRR according to any ones of claims 1 to 4, wherein the ectodomain is selected from a LRR-RLP involved in defense reactions such as, cellular dam age, pathogen or parasite recognition, and is for example RLPi, RLP23, RLP30 and any other RLPxx from Arabidopsis thaliana, or EIX2 (EIX2), or CUREi from S. ly coper sicum. 6. The chimeric PRR according to any one of claims l to 5, wherein the ectodomain is capable of binding to a molecular pattern associated with and indicative for the presence of microbial pathogens, herbivores, parasitic plants or tissue injury, such as a pathogen- and/or damage-associated molecular patterns (PAMPs, DAMPs), for example xylanase and SCFEi from fungi, flagellin and Emax from bacteria; or patterns indicative for cell necrosis, or ethylene-inducing peptide l-like proteins (NLPs) from bacteria, fungi or oomycetes. 7. A nucleic acid comprising a nucleotide sequence encoding for a chimeric PRR pro tein according to any one of claims 1 to 6. 8. A vector, such as an expression vector, comprising a nucleic acid according to claim 7. 9. A recombinant cell comprising a chimeric PRR according to any one of claims 1 to 6, a nucleic acid according to claim 7, or a vector according to claim 8 10. A recombinant multicellular organism, or parts, organs, fruits or seeds thereof, comprising the chimeric PRR protein according to any one of claims 1 to 6, prefer ably wherein the organism is a plant. 11. A use of a product in the treatment and/or protection of a plant against injuiy, a pathogenic infection, such as a bacterial infection, a viral infection or fungal infec tion, wherein the product is selected from a chimeric PRR according to any one of claims 1 to 6, a nucleic acid according to claim 7, a vector according to claim 8, a recombinant cell according to claim 9, or a recombinant multicellular organism according to claim 10. 12. A method for increasing the resistance of a plant to a pathogen infection, compris ing, introducing into said plant a chimeric PRR according to any one of claims 1 to 6, a nucleic acid according to claim 7, a vector according to claim 8, a recombinant cell according to claim 9, or a recombinant multicellular organism according to claim 10. 13. A method for producing a transgenic plant having enhanced resistance to a patho gen infection, comprising the step of introducing into a plant or into a plant cell of said plant a chimeric PRR according to any one of claims 1 to 6, a nucleic acid ac cording to claim 7, a vector according to claim 8, a recombinant cell according to claim 9, or a recombinant multicellular organism according to claim 10. 14. A plant, characterized in that it expresses a chimeric PRR according to any one of claims 1 to 6. 15. A screening method for damage- and/or microbe-associated molecular patterns (DAMPS, MAMPs), comprising the method steps of (i) expressing in a plant or plant cell a chimeric PRR according to any one of claims 1 to 6, (ii) contacting said plant or plant cell with a candidate compound, (iii) measuring the immune re sponse of said plant or plant cell in comparison with a control plant or plant cell, wherein an elevated immune response of said plant or plant cell indicates that said candidate compound is a DAMP and/or MAMP. 16. A method for sensitizing a plant against bacterial/viral/fungal/microbial infec tions or herbivorous attacks, the method comprising performing in said plant a method according to claim 13. 17. A method for producing a chimeric PRR for mediating defense reactions, the chi meric PRR comprising at least an ectodomain, a transmembrane domain, and a cytoplasmatic domain, the method comprising a step of directly or indirectly fus ing together (i) an ectodomain derived from Leucine Rich Repeat (LRR) Receptor Like Protein (RLP), to (ii) a transmembrane domain and/or a cytoplasmic domain derived from a membrane bound kinase, wherein preferably the chimeric PRR is the chimeric PRR according to any one of claims 1 to 6. |
FIELD OF THE INVENTION
The present invention pertains to novel artificially designed plant receptors for mediating defense reactions. The present invention provides chimeric pattern recognition receptors (PRRs) which are composed of the ectodomain sequences of leucine rich repeat receptor like protein (LRR-RLP) which lacks a functional intracellular signalling domain, and a trans membrane and/or cytoplasmatic domain of a receptor like kinase (RLK) that functions as PRR. The chimeric receptors of the invention can be used to transform plant cells or plants in order to supplement and enhance the defense capabilities in strength and/or diversity in the transformed plant or plant cell. Hence, the present invention pertains to such chimeric PRR proteins, their encoding nucleic acids, methods for their construction, as well as their various uses in agriculture or other plant-based businesses.
DESCRIPTION
Due to the constantly-increasing human population, and the declining area of land available for agriculture, it remains a major goal to improve the efficiency of agriculture and to in crease the range of exploitable plants in agriculture. Conventional approaches for crop and horticultural improvements utilise classical plant breeding techniques in order to identify new plant varieties having desirable characteristics, like higher yield, resistance to pests and unfavourable weather conditions, root development, nutrient uptake and stress tolerance in general. However, such classical breeding techniques have several negative aspects, namely that these techniques are typically labour intensive and often include alteration of multiple traits. Most importantly, they suffer from the very close restrictions of interspecies crossing. This is a particular a restraint for traits like resistance genes and pattern recognition recep tors that can confer resistance against herbivores and microbial pathogens. Such highly use ful genes often occur in species that cannot be used in classical breeding.
Genetic engineering of plants entails the isolation and manipulation of the genetic and epige netic material (typically in the form of DNA or RNA) and the subsequent introduction of that genetic material into a plant. Genetic engineering of plants at the industrial and laboratoiy scale is well established and has led to the development of plants having various improved economic, agronomic or horticultural traits. These technological advances have yielded crops that reduce food production costs through resistance to pests, herbicide, drought, and flood or generally enhance the growth and resistance of plants. Furthermore crops were engineered to produce substances such as vitamins that could improve human health. These approaches could help treat health issues in countries where people suffer from malnutrition such as vit amin A deficiency in countries where available foods do not provide the necessary nutrients for people.
Traits of particular economic interest are growth characteristics such as high yield of plant material such as fruits. Yield is normally defined as the measurable produce of economic val ue from a crop. This may be defined in terms of quantity and/or quality. Yield is directly de pendent on several factors, for example, the number and size of the organs, plant architecture (for example, the number of branches), seed production and more. Sustainability of yield, an eminent issue, is threatened by a multitude of herbivores and microbial pathogens. Thus, traits of resistance, notably those that act as specific immunodetectors for inducing active defense responses in host plants, are highly valuable.
Cellular signalling upon environmental or developmental signals in plants and animals alike are coordinated by membrane associated proteins - receptors - which provide an extracellu lar binding domain to which a signal-molecule can attach, for example pathogenic structures of pests or growth factors, and intracellular signalling domains, specifically kinase domains, which can transmit the extracellular signal intra-cellular by initiating a signalling cascade. In the plant kingdom many of such membrane-bound receptor kinases were identified in the past decade, e.g. in the genomes of rice or Arabidopsis are about 600 to 1000 genes that en code for these proteins.
In plants leucine-rich-repeat receptor-like proteins and receptor like kinases (LRR-RLP, LRR-RLK) are key in the recognition and transmittal of exogenic as well as endogenic signals. LRR-RLKs (or simply“RLKs”) are involved in developmental processes, growth, cell death, abscission fruit ripening and immune reactions upon pathogenic attacks. Individual RLPs or RLKs are involved in one or more biological processes; they bind through their extracellular portion specific signal-molecules, such as molecules that are characteristic in the event of an infection or damage caused by microbial or herbivorous attacks.
LRR-RLKs have a multi-domain architecture in which each domain provides a specific func tion for the receptor. The extracellular part of the receptor contains a leucine rich repeat (LRR) domain. The domain is named according to a series of repeating sequence motifs comprising about 20 to 30 amino acids with a high content of leucine. Leucine-rich repeats are frequently involved in the formation of protein-protein interactions, and not only found in plant receptors but also in a large variety of functionally unrelated proteins. Examples comprise the ribonuclease inhibitor, tropomodulin and toll-like receptors. Toll-like receptors are involved in innate immunity and developmental (Toll) processes. The LRR domain medi ates the binding of the receptor to a ligand molecule, and hence can be classified as the input domain of the LRR-RLK.
On the intracellular side the LRR-RLK has a protein kinase domain, that enzymatically catal yses the transfer of a phosphate group to a substrate protein. Usually the addition of phos phate groups to intracellular substrates results in the initiation of a signal cascade that even tually induces into a cellular response, for example the induction of immune related genes in order to fight off a pathogenic attack. Thus, the kinase domain could be classified as the out put domain of the LRR-RLK. Kinase and LRR domains are interconnected by the juxtamem- brane and transmembrane domains, the latter spanning the cellular membrane, which allow the receptor to be membrane bound.
Although the function of many LRR-RLKs remains elusive, examples of LRR-RLKs that rec ognize exogenous signals are Flagellin Sensing 2 (FLS2) and Elongation Factor Tu Receptor (EFR) of Arabidopsis. The corresponding ligands of the receptors are flg22, a specific domain of bacterial flagellin and elfi8, the N-terminus of bacterial elongation factor Tu (EF-Tu), re spectively. The EFR and FLS2 receptors function as immune receptors, also termed pattern recognition receptors (PRRs), recognising the presence of pathogens via microbe associated molecular patterns (MAMPs) and initiating a defense response in the plant cell. Other de fense response related receptors include XA21 from rice, CERKi and AtPEPRi, the latter rec ognizing endogenous danger signals related to wound healing processes.
A known LRR-RLK that binds endogenous signals of a plant is the brassinosteroid receptor BRIi (brassinosteroid insensitive 1) that is an essential component of a membrane bound multi-receptor complex recognizing the steroid brassinolide. This steroid hormone in plants is important for physiological and developmental regulation. He Z and colleagues showed in a study with chimeric receptors composed of extracellular BRIi domains and intracellular kinase domain of XA21, a rice defense response receptor, that artificial produced receptor chimeras could initiate a defense response in rice upon treatment with brassinosteroids. This study therefore shows that LRR-RLKs constitute an interesting starting point for the rational design of new receptor proteins in plants.
More novel chimeric receptors were constructed in Arabidopsis thaliana consisting of the complete ectodomain of EFR and the intracellular FLS2 kinase. These chimeras were shown to be sensitive towards the elfi8 peptide, the natural ligand of EFR (Albert et al 2010; J Biol Chem; Vol 285, pp 19035-19042). The study shows that both LRR-RLKs EFR and FLS2 alt- hough they recognize different ligand molecules, still share all functional aspects for initiat ing the intracellular signal output of LRR-RLKs. A similar chimeric receptor approach was used in the elucidation of the function of wall associated kinases (WAK), which are involved in the detection of oligogalacturonides, molecular signals of cell wall damages, growth and development. Swapping of the ecto- or endo-domains of WAK and EFR resulted in a substi tution of receptor function. EFR ectodomain WAKi kinase domain receptors sense elfi8 but display a signal output typical for native WAKi and vice versa (Brutus A et ah, 2010; Proc Natl Acad Sci USA, Vol 107, pp 9452-9457).
Chimeric receptors based on the LRR-RLKs domain structure, in which the ectodomain and the intracellular kinase domain are derived from different receptors can be used for the con trolled activation of cellular responses like immune response reactions in transgenic plants. A chimeric receptor that exploits the peculiarities of two receptors associated with plant de fense, like FLS2, EFR or WAKi receptors, was designed with the intend to increase plant re sistance to phytopathogenic organisms (WO 2010/139790).
Other than LRR-RLKs, also LRR receptor-like proteins (LRR-RLPs) which are characterized by a lack of any intracellular signalling domain (such as a kinase domain) are known to medi ate various defense responses (Molecular Plant Pathology 6(I):8S-97 Januaiy 2005). Their mechanism of signalling depends on a SOBIRi-type of adaptor kinase to form bimolecular receptor kinases (Gust and Felix, 2014). All families of higher plants have divergent, multi- membered arrays of LRR-RLPs and at least one gene of a SOBIRi-type adaptor kinase. How ever, interspecies and interfamily transfer of a LRR-RLP alone often meets compatibility problem resulting in malfunction of the transgenic LRR-RLP. Thus, also LRR-RLP with novel and agronomically valuable recognition specificities are not yet sufficiently harnessed for artificially increasing defense responses in recipient crop plants.
In view of the above, it is an object of the present invention to provide novel approaches for the rational design of artificial chimeric plant receptors usable to support plant defense mechanisms.
In a first aspect of the present invention, the above object is solved by a chimeric pattern recognition receptor (PRR) for mediating defense reactions, comprising at least an ectodo main, a transmembrane domain, and a cytoplasmatic domain, characterized in that the ecto domain is derived from Leucine Rich Repeat (LRR) Receptor Like Protein (RLP), and at least the transmembrane domain and/or the cytoplasmatic domain is derived from a membrane bound kinase. As used herein, the term“chimeric” in context of a protein or gene sequence refers to two or more coding sequences obtained from different genes, that have been cloned together and that, after translation, act as a single polypeptide sequence. Chimeric proteins are also re ferred to as“hybrid proteins.” As used herein, the term“chimeric protein” refers to coding sequences that are obtained from different species of organisms, as well as coding sequences that are obtained from the same species of organisms. A chimeric PRR in context of the in vention is therefore a chimeric protein as defined before, but having/maintaining a biological function of a PRR. The herein disclosed chimeric PRRs consist of a sequence which purely artificial and therefore does not occur in nature.
In the context of the present invention the term“ectodomain” shall refer to the extracellular parts of a transmembrane receptor which harbour the receptor’s function to bind to its lig ands. Specifically, in certain embodiments of the present invention, the term“ectodomain” shall preferably refer to the LRR domain of a plant PRR.
In the context of the present invention and in all of its embodiments the term“pathogen- associated molecular patterns” abbreviated PAMP shall refer to any molecular structure de rived from a plant pathogenic organism and/or any other microorganism, such as bacteria, fungi or unicellular eukaryotic organisms and/or small multi-cellular organisms.
The term“damage-associated molecular pattern”, abbreviated DAMP, refers to a biomarker metabolite pattern that is characteristic of cell death (e.g., for example, apoptosis). For ex ample, such DAMP biomarkers reflect the presence of oxidation and release biomarker in cluding, but not limited to or intracellular nucleic acid release. Such cell death in a plant might occur due to injury for example in context of herbivorous attacks.
In the context of the present invention the term“transmembrane domain” shall refer to parts of a transmembrane receptor which form a stable fold in a cellular membrane. The term shall refer in case of single pass transmembrane receptors only to the domain which spans the cel lular membrane. In case for multi pass transmembrane domains the term also denotes the region containing multiple single transmembrane domains.
In the context of the present invention the term“juxtamembrane domain” shall refer to the stretch of amino acids in a transmembrane receptor which is located on the extracellular side of the receptor, directly adjacent to the transmembrane domain. The juxtamembrane domain therefore connects the ectodomain with the transmembrane domain. The term“derived from” as used herein in context of sequences or domains or parts of genes and proteins, shall denote that the referred protein or gene, domain, part of a protein or gene, shall be understood to refer to a use of a sequence of said protein or gene, domain, or part of a protein or gene, as a source for the chimeric PRR. As an example the expression“domain A derived from protein Z” is to be understood that the nucleic acid sequence encoding or the amino acid sequence of protein Z is used as a source for the sequence of domain A, and that the sequence of domain A is at least 50%, 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99%, 100% identical to the sequence of the domain A in context of protein Z. Also“derived from” shall refer to a situation where the said protein or gene, domain, or part of a protein or gene is re moved from its context, or isolated from, the entity it is derived from.
As used herein, the terms“identical” or percent“identity”, when used anywhere herein in the context of two or more nucleic acid or protein/polypeptide sequences, refer to two or more sequences or sub-sequences that are the same or have (or have at least) a specified percent age of amino acid residues or nucleotides that are the same (i.e., at, or at least, about 60% identity, preferably at, or at least, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93% or 94%, identity, and more preferably at, or at least, about 95%, 96%, 97%, 98%, 99%, or higher iden tity over a specified region - preferably over their full length sequences - , when compared and aligned for maximum correspondence over the comparison window or designated re gion) as measured using a sequence comparison algorithms, or by manual alignment and visual inspection (see, e.g., NCBI web site). In a particular embodiment, the percentage iden tity can be determined by the Blast searches for amino acid identity, those using BLASTP 2.2.28+ with the following parameters: Matrix: BLOSUM62; Gap Penal-ties: Existence: 11, Extension: 1; Neighboring words threshold: 11; Window for multiple hits: 40.
The term“protein kinase” and“kinase” shall be understood to include enzymes that can cata lyze phosphorylation (addition of phosphate/phosphoryl group) of phosphorylable amino acids in proteins and/or peptides. These enzymes comprise, but are not limited to, protein tyrosine kinases, serine kinases and threonine kinases. A“membrane bound kinase” is a ki nase protein that is located to a cellular membrane, for example the plasma membrane, but also any intracellular membranes such as organelle-membranes, endosomes, the endoplas mic reticulum, Golgi apparatus etc. Such kinases often comprise a transmembrane domain or other membrane anchor.
Preferably the membrane bound kinase of the invention is selected from the group of leucine rich repeat (LRR) receptor-like kinases (RLK), such as a kinase selected from any of the fol lowing protein families: C-Lectin, CR -like, CRPKi-likei, CRPKi-like2, DUF26, Extensin- like, L-Lectin, LRKio-likei, LRKio-like2, GDPDb, LRR I, LRR II, LRR III, LRR IV, LRR V, LRR VI, LRR VII, LRRVIII-l, LRR VIII-2, LRR IX, LRR X, LRR XI, LRR XII, LRR XIII, LRR XIV, LysM, PERK, RKF3-like, RLCK I, RLCK II, RLCK III, RLCK IV, TAK(RLCK V), RLCK VI, RLCK VII, RLCK VIII, RLCK IX, RLCK X, RLCK XI, RLCK XII, S-domaini, S-domain2, S- domain3, Thaumatin, URK I, or WAK-like (Plant Physiol. 2003 Jun;i32(2):530-43·).
Even more preferably, the LRR-RLK is selected from any one of the following RLKs: BAKi, SERK4, SISERKi, BIRi, BIR2, SOBIRi, FER, CRK28, IOSi, PSKRi, PSYiR, ERECTA, SRF3, XA26, dsi, Bti9, SILyki3, THEi, Pi-d2, LecRK-I.9, LecRK-V.5, LecRK-VI.2, NgRLKi, LecRKi, NbLRKi, WAKL22, OsWAKi, TaRLK-Ri,2,3, SNC4, LRK10, SNC2, and RLP52; and preferably wherein the LRR-RLK is SOBIRi (The Plant Cell, Vol. 29: 618-637, April 2017).
Preferred SOBIRi orthologs of Arabidopsis thaliana SOBIRi are any one of the following (according to the July 2018 release of the Ensembl plant genome release: http://jul20i8- plants.ensembl.org/index.html):
Species Orthologue
Arabidopsis lyrata fgenesh2_kg.4 _ 1172 AT2G31880.1
Brassica oleracea Bo4gi77070
Brassica nap s BnaCnng39500D
Brassica napus BnaCo3gi78ooD
Brassica napus BnaAo3gi476oD
Brassica rapa Bra022870
Brassica oleracea Bo3g026470
Brassica napus BnaAo4gi86ooD
Brassica rapa Bra02i759
Brassica napus BnaA04gi8590D
Brassica napus BnaCnng3949oD
Brassica rapa Bra02i758
Brassica oleracea Bo4gi7766o
Helianthus annuus HannXRQ_Chri6g049757i
Corchorus capsularis CCACVLI_O8498
Theobroma cacao TCM_oi45i7
Manihot esculenta MANES_14G057400
Populus trichocarpa P0PTR_012G090500V3
Gossypium raimondii B456_OO3GIO8OOO
Vitis vinifera VIT_i7S0000g097i0
Vigna angularis LR48_Vigan04g070200
Glycine max GLYMA_04Gi90400
Manihot esculenta MANES_06Gll2200
Phaseolus vulgaris PHAVU_009Gi7i200
Glycine max GLYMA_o6Gi75ioo
Medicago truncatula MTR_3g075440
Vigna radiata gene7026 Helianthus annuus SOBIRi (HannXRQ_Chn6g049756i) Prunus persica PRUPE_5Gi6i700
Helianthus annuus HannXRQ_Chr09g027205i
Populus trichocarpa POPTR_oi5Go868oov3
Therefore, the skilled person is aware that SOBIRi orthologs usable in context of the present invention include proteins having an amino acid sequence with at least 60% identity to A. thaliana SOBIRi.
In other preferred embodiments the ectodomain of the chimeric PRR is not identical to, pref erably at most 95%, 90%, 85%, or most preferably less than or equal to 80% identical to, an ectodomain of the LRR- Receptor-like Kinase (LRR-RLK).
Furthermore preferred is one embodiment where the ectodomain of the chimeric PRR is de rived from an RLP which in its wild-type sequence does not contain a functional intracellular signalling domain, such as a functional intracellular kinase domain.
In context with the present invention, the term“wild type” in context of proteins, genes or plants, means that protein, gene or plant concerned has not been artificially genetically modi fied, and therefore consists of a sequence which occurs in nature and which was not subject to a targeted genetic alteration by humans. In particular such wild type proteins or genes do not consist of the sequence of a chimeric PRR of the invention.
In some embodiments it is preferred that the cytoplasmatic domain of the chimeric PRR comprises at least the functional kinase domain of said LRR-RLK. A kinase domain is func tional in context of the present invention if it mediates a signal dependent or constitutive phosphorylation of a protein target by the chimeric PRR of the invention. In context of the present invention it is in particular preferred that the transmembrane domain and the cyto plasmatic domain of the chimeric PRR are derived from SOBIRi.
In some embodiments the chimeric PRR is preferred, wherein the sequences of the LRR- RLP and the LRR-RLK are derived (i) from the same species, or (ii) from different species.
In some embodiments the chimeric PRR of the invention further comprises an intracellular and/or extracellular juxtamembrane domain, wherein said intracellular and/or extracellular juxtamembrane domain is derived from said LRR-RLK. Most preferably the intracellular juxtamembrane domain is derived from said LRR-RLK. In context of the invention it is in some embodiments preferred that the transmembrane do main of the chimeric PRR comprises at least one GxxxG (SEQ ID NO: 29) amino acid se quence motif, preferably more than one repeat of the GXXXG amino acid sequence motif, and preferably wherein the GxxxG amino acid sequence motif is located in the N-terminal half of the transmembrane domain. For example the transmembrane domain of the chimeric PRR is preferred comprising at least two, preferably three, more preferably four, consecutive GXXXG motifs, most preferably, the transmembrane domain comprises the conserved motif GXXXGXXXGXXXGXXXG (SEQ ID NO: 30), with not more than one variation of one G in said conserved motif.
As mentioned herein preferred embodiments include chimeric PRRs comprising SOBIR in tracellular signalling domains, and therefore it is in some embodiments preferred that the transmembrane domain of the chimeric PRR is derived from SOBIRi, and is at least 50%, 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99%, 100% identical to the transmembrane domain sequence of SOBIRi of Arabidopsis thaliana (SEQ ID NO: 5), or homologs, paralogs or orthologs thereof.
Preferably the LRR-RLP from which the ectodomain of the chimeric PRR is derived is select ed from a LRR-RLP involved in defense reactions such as, cellular damage, pathogen or para site recognition, and is for example RLPi, RLP23, RLP30 and any other RLPxx from Ara bidopsis thaliana, or EIX2 (EIX2), or CUREi from S. lycopersicum. Also any orthologs and homologs of these proteins shall be included in the present invention. However, only such LRR-RLP are referred to herein which do not contain a functional intracellular signalling domain. Preferably the ectodomain of the chimeric PRR of the invention is at least 50%, 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99%, 100% identical to the ectodomain of the said LRR- RLP. Furthermore, it is preferable that the ectodomain of the chimeric PRR of the invention is capable of binding to a molecular pattern associated with and indicative for the presence of microbial pathogens, herbivores, parasitic plants or tissue injury, such as a pathogen- and/or damage-associated molecular patterns (PAMPs, DAMPs), for example xylanase and “SCFEi” from fungi, flagellin and "Emax" from bacteria; or patterns indicative for cell necro sis, or ethylene-inducing peptide l-like proteins (NLPs) from bacteria, fungi or oomycetes.
A chimeric PRR according to the invention preferably consists of, or consists essentially of, a sequence that is not 90%, 95%, 98%, 99% most preferably not 100% identical to any natural ly occurring (wild type) plant protein sequence (is artificial).
In further embodiments the cytoplasmic domain of the chimeric PRR of the invention is de rived from SOBIRi of any plant species, or preferably of Arabidopsis thaliana, and comprises a SOBIRi functional kinase domain having an amino acid sequence that is at least 50%, 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99%, 100% identical to the kinase domain of SOBIRi of Arabidopsis thaliana (SEQ ID NO: 5).
The chimeric PRR of the invention may be provided as a protein or a gene construct, there fore the term shall, if not otherwise indicated or derivable from the context, refer to both amino acid sequence of the chimeric PRR or a nucleic acid sequence encoding for the chimer ic PRR protein.
Furthermore provided are in one additional aspect of the invention a nucleic acid comprising a nucleotide sequence encoding for a chimeric PRR protein according to the invention as de scribed herein. Such a nucleic acid may be provided in context of a vector, such as an expres sion vector, comprising said nucleic acid. Such nucleic acids or vectors are also referred to as being“recombinant”. A vector within the meaning of the present invention is a protein or a nucleic acid or a mixture thereof which is capable of being introduced or of introducing the polynucleotides comprised into a cell. It is preferred that the proteins encoded by the intro duced nucleic acid are expressed within the cell upon introduction of the vector.
In a preferred embodiment, the vector of the present invention comprises recombinant vec tors, plasmids, phagemids, phages, cosmids, viruses, in particular but not limited to virus- derived amplicon vectors, potato virus X based vectors, tobacco rattle virus based vectors, geminivirus-based vectors such as cabbage leaf curl virus and barley stripe mosaic virus based vectors and vectors based on satellite viruses (reviewed in Curtin, S.J., Wang, M.-B., Watson, J.M., Roffey, P., Blanchard, C.L. and Waterhouse, P.M.. (2007), chapter 12, p 291- 332 in“Rice Functional Genomics; Challenges, Progress and Prospects”. Upadhyaya, Nara- yana M. (Ed.), ISBN: 978-0-387-48903-2), virosomes, and nucleic acid coated particles, in particular gold spheres.
The term“recombinant nucleic acid molecule” refers to a polynucleotide produced by human intervention. A recombinant nucleic acid molecule can contain two or more nucleotide se quences that are linked in a manner such that the product is not found in a cell in nature. In particular, the two or more nucleotide sequences can be operatively linked and, for example, can encode a fusion polypeptide, or can comprise a nucleotide sequence and a regulatoiy el ement. A recombinant nucleic acid molecule also can be based on, but different, from a natu rally occurring polynucleotide, for example, a polynucleotide having one or more nucleotide changes such that a first codon, which normally is found in the polynucleotide, is replaced with a degenerate codon that encodes the same or a conservative amino acid, or such that a sequence of interest is introduced into the polynucleotide, for example, a restriction endonu- clease recognition site or a splice site, a promoter, a DNA replication initiation site, or the like.
Preferred is a recombinant vector according to the present invention, which is an expression vector, optionally comprising one or more genes, such as a gene of a chimeric PRR, to be ex pressed. Preferably, said expression is driven by a regulatory sequence (or sequences). A reg ulatory sequence can be isolated from a naturally occurring genomic DNA sequence or can be synthetic, for example, a synthetic promoter.
Regulatory sequences can be constitutively expressed regulatoiy sequences, which maintain gene expression at a relative level of activity (basal level), or can be regulated regulatoiy se quences. Constitutively expressed regulatoiy sequence can be expressed in any cell type, or can be tissue specific, which are expressed only in particular cell types, phase specific, which are expressed only during particular developmental or growth stages of a plant cell, or the like. A regulatory sequence such as a tissue specific or phase specific regulatory sequences or an inducible regulatory sequence useful in constructing a recombinant polynucleotide or in a practicing a method of the invention can be a regulatory sequence that generally, in nature, is found in a plant genome. However, the regulatoiy sequence also can be from an organism other than a plant, including, for example, from a plant virus, an animal virus, or a cell from an animal or other multicellular organism.
A preferred regulatory sequence useful for expression of polynucleotides of the invention is a promoter element. Useful promoters include, but are not limited to, constitutive, inducible, temporally regulated, developmental^ regulated, spatially-regulated, chemically regulated, stress-responsive, tissue-specific, viral and synthetic promoters. Promoter sequences are known to be strong or weak. A strong promoter provides for a high level of gene expression, whereas a weak promoter provides for a very low level of gene expression. An inducible pro moter is a promoter that provides for the turning on and off of gene expression in response to an exogenously added agent, or to an environmental or developmental stimulus. A bacterial promoter can be induced to varying levels of gene expression depending on the level of isothiopropyl galactoside added to the transformed bacterial cells. An isolated promoter se quence that is a strong promoter for heterologous nucleic acid is advantageous because it provides for a sufficient level of gene expression to allow for easy detection and selection of transformed cells and provides for a high level of gene expression when desired.
The choice of promoter will vary depending on the temporal and spatial requirements for expression, and also depending on the target species. In some cases, expression in multiple tissues is desirable. While in others, tissue-specific, e.g., leaf-specific, seed-specific, petal- specific, anther-specific, or pith-specific, expression is desirable. Although many promoters from dicotyledons have been shown to be operational in monocotyledons and vice versa, ide ally dicotyledonous promoters are selected for expression in dicotyledons, and monocotyle- donous promoters for expression in monocotyledons. There is, however, no restriction to the origin or source of a selected promoter. It is sufficient that the promoters are operational in driving the expression of a desired nucleotide sequence in the particular cell.
Other sequences that have been found to enhance gene expression in transgenic plants in clude intron sequences (e. g., from Adh 1, bronze l, actin l, actin 2 (WO 00/760067), or the sucrose synthase intron), poly adenylation signals in the 3’ prime UTR and viral leader se quences (e.g., from TMV, MCMV and AMV). For example, a number of non-translated leader sequences derived from viruses are known to enhance expression. Specifically, leader se quences from tobacco mosaic virus (TMV), maize chlorotic mottle virus (MCMV), and alfalfa mosaic virus (AMV) have been shown to be effective in enhancing expression (e.g., Gallie et al., 1987; Skuzeski et ah, 1990). Other leaders known in the art include but are not limited topicomavirus leaders, for example, EMCV leader (encephalomyocarditis virus s'-non-coding region; Elroy-Stein et al., 1989); potyvirus leaders, for example, TEV leader (tobacco etch virus); MDMV leader (maize dwarf mosaic virus); human immunoglobulin heavy chain bind ing protein (BiP) leader, (Macejak et al., 1991); untranslated leader from the coat protein mRNA of AMV (AMV RNA 4; Jobling et al., 1987), TMV (Gallie et al.,1989), and MCMV (Lommel et al., 1991; see also, della Cioppa et al., 1987).
For the expression of any constructs as described herein such as the chimeric PRR in a plant or plant cell, the invention preferably embodies that the described polynucleotides are opera ble linked to a promoter and to a polyadenylation site, wherein said promoter is character ized in that it is functional in said cell of said plant. As a promoter in this context, any se quence element is sufficient that induces transcription of the downstream sequence. The minimal requirements of promoters are veiy well known in the art and many of such promot ers are conventionally used for gene expression in plants.
In a preferred embodiment of the invention, the transformation of a plant or plant cell with any polynucleotide encoding a chimeric PRR of the invention and as described herein, is per formed by a method selected from standard procedures known in the art. Transformation of plant tissue can be achieved preferably by particle bombardment (Klein et al., "High- Velocity Microprojectiles for Delivering Nucleic Acids Into Living Cells," Nature 327:70-73 (1987)), also known as ballistic transformation of the host cell, as disclosed in U.S. Patent Nos. 4,945,050, 5,036,006, and 5,100,792, all to Sanford et al., and in Emerschad et al., "Somatic Embryogenesis and Plant Development from Immature Zygotic Embryos of Seedless Grapes (Vitis vinifera)" Plant Cell Reports 14:6-12 (1995). In particle bombardment, tungsten or gold microparticles are coated with the DNA of interest and then bombarded at the tissue using high pressure gas. In this way, it is possible to deliver foreign nucleotides into the nucleus. Biologically active particles (e.g., dried bacterial cells containing the vector and heterologous DNA) can also be propelled into plant cells. Other variations of particle bombardment, now known or hereafter developed, can also be used. Another preferred method of stably intro ducing the nucleic acid construct into plant cells is to infect a plant cell with Agrobacterium tumefaciens or Agrobacterium rhizogenes previously transformed with the polynucleotide construct. As described above, the Ti (or RI) plasmid of Agrobacterium enables the highly successful transfer of a foreign nucleic acid molecule into plant cells. A preferred variation of Agrobacterium transformation uses vacuum infiltration in which whole plants are used (Sen ior, "Uses of Plant Gene Silencing," Biotechnology and Genetic Engineering Reviews 15:79- 119 (1998)). Yet another referred method of introduction is fusion of protoplasts with other entities, either mini-cells, cells, lysosomes, or other fusible lipid-surfaced bodies (Fraley et al., Proc. Natl. Acad. Sci. USA 79:1859-63 (1982), ). Also preferred in a method, wherein the nucleic acid molecule is introduced into the plant cells by electroporation (Fromm et al., Proc. Natl. Acad. Sci. USA 82:5824 (1985)). In this technique, plant protoplasts are electro porated in the presence of plasmids containing the expression cassette. Electrical impulses of high field strength reversibly permeabilize biomembranes allowing the introduction of the plasmids. Electroporated plant protoplasts reform the cell wall, divide, and regenerate. Other preferred methods of transformation include chemical-mediated plant transformation, mi croinjection, physical abrasives, viral transduction and laser beams (Senior, "Uses of Plant Gene Silencing," Biotechnology and Genetic Engineering Reviews 15 : g- 119 (1998)). The precise method of transformation is not critical to the practice of the present invention. Any method that results in efficient transformation of the host cell of choice is appropriate for practicing the present invention.
Therefore, in another aspect of the invention a recombinant cell comprising a chimeric PRR of the invention, a nucleic acid, or a vector is provided. Such a recombinant cell is a bacterial cell or is a plant cell.
Additionally provided in context of the invention are recombinant multicellular organisms, or a part, organ, fruit or seed thereof, comprising the recombinant cell of the invention; prefera bly wherein the organism is a plant. Such an organism in some embodiments and aspects is not obtained by an essentially biological process for the production of plants. More preferably the organisms according to the invention are not exclusively obtained or obtainable by an essentially biological process. This may apply for any herein described embodiments or as pects relating to plants or animals. Another aspect also pertains to a product for use in the treatment and/or protection of a plant against injury, a pathogenic infection, such as a bacterial infection, a viral infection or fungal infection, wherein the product is selected from a chimeric PRR, a nucleic acid, a vec tor, a recombinant cell, or a recombinant multicellular organism according to the herein dis closed invention.
Yet another aspect pertains to a method for increasing the resistance of a plant to a pathogen infection, comprising, introducing into said plant a chimeric PRR, a nucleic acid, a vector, a recombinant cell, or a recombinant multicellular organism of the invention.
A plant of the invention the in the plant a PRR according to any one of claims l to 17 is intro duced by ectopic protein expression of said chimeric PRR in said plant.
In the herein disclosed invention the plant is a lower or higher plant, preferably including but not limited to corn ( Zea mays), Brassica sp. (e.g., B. napes, B. rapa, B.junced), alfalfa ( Medi - cago sativ a), rye ( Secale cereale), sorghum ( Sorghum bicolor, Sorghum vulgare), sunflower ( Helianthus annuus), safflower ( Carthamus tinctorius), wheat ( Triticum aestivum), soybean ( ' Glycine max), tobacco ( Nicotiana tabacum), potato {Solomon tuberosum), peanuts ( Rachis hypogaea), cotton ( Gossypium barbadense, Gossypium hirsutum), sweet potato ( Ipomoea batatus), cassava ( Manihot esculenta), coffee ( Cofea spp.), coconut ( Cocos nucifera), pine apple {Ananas comosus), citrus trees {Citrus spp.), cocoa {Theobroma cacao), tea {Camellia sinensis), banana {Musa spp.), avocado {Perseaultilane), fig {Ficuscasica), guava (Psidium guava), mango (Mangifera indica), olive (Olea europaea), papaya (Carica papaya), cashew (Anacardium occidentale), macadamia (Macadamia integrifolia), almond (Prunus amygda- lus), sugar beets (Beta vulgaris), sugar-cane (Saccharum spp.), oats (Avena sativa), duckweed (Lemna), barley (Hordeum vulgare), tomatoes (Lycopersicon esculentum), lettuce (e. g., Lac- tuca sativa), green beans (Phaseolus vulgaris), lima beans (Phaseolus limensis), peas (Lathy- rus spp.), and members of the genus Cucumis such as cucumber (C. sativus), cantaloupe (C. cantalupensis), and musk melon (C. melo). Ornamentals such as azalea (Rhododendron spp.), hydrangea (Macrophylla hydrangea), hibiscus (Hibiscus rosasanensis), roses (Rosa spp.), tulips (Tulipa spp.), daffodils (Narcissus spp.), petunias (Petunia hybrida), carnation (Dianthus caryophyllus), poinsettia (Euphorbia pulcherrima), and chrysanthemum (Chry santhemum spp.), impatiens, Begonia, Pelargonium, Viola, Cyclamen, Verbena, Vinca, Ta- getes, Primula, Saint Paulia, Agertum, Amaranthus, Antihirrhinum, Aquilegia, Cineraria, Clover, Cosmo, Cowpea, Dahlia, Datura, Delphinium, Gerbera, Gladiolus, Gloxinia, Hippeas- trum, Mesembiyanthemum, Salpiglossos, and Zinnia. Conifers that may be em-ployed in practicing the present invention include, for example, pines such as loblolly pine (Pinus taeda), slash pine (Pinus elliotii), ponderosa pine (Pinus ponderosa), lodgepole pine (Pinus contorta), and Monterey pine (Pinus radiata), Douglas-fir (Pseudotsuga menziesii); Western hemlock (Tsugaultilane); Sitka spruce (Picea glauca); redwood (Sequoia sempervirens); true firs such as silver fir (Abies amabilis) and balsam fir (Abies balsamea); and cedars such as Western red cedar (Thuja plicata), and Alaska yellow-cedar (Chamaecyparis nootkatensis.
Yet another aspect then pertains to a method for producing a transgenic plant having en hanced resistance to a pathogen infection, comprising the step of introducing into a plant or into a plant cell of said plant a chimeric PRR, a nucleic acid, a vector, a recombinant cell, or a recombinant multicellular organism of the invention. Also part of the invention is a plant, characterized in that it expresses a chimeric PRR as described herein before.
Another aspect also pertains to a screening method for damage- and/or microbe-associated molecular patterns (DAMPS, MAMPs), comprising the method steps of (i) expressing in a plant or plant cell a chimeric PRR according to the invention, (ii) contacting said plant or plant cell with a candidate compound, (iii) measuring the immune response of said plant or plant cell in comparison with a control plant or plant cell, wherein an elevated immune re sponse of said plant or plant cell indicates that said candidate compound is a DAMP and/or MAMP.
One aspect of the invention pertains to a method for sensitizing a plant against bacteri al/viral/fungal/microbial infections or herbivorous attacks, the method comprising perform ing in said plant a method for increasing the resistance of a plant to a pathogen infection.
In a final aspect the invention further pertains to a method for producing a chimeric PRR for mediating defense reactions, the chimeric PRR comprising at least an ectodomain, a trans membrane domain, and a cytoplasmatic domain, the method comprising a step of directly or indirectly fusing together (i) an ectodomain derived from Leucine Rich Repeat (LRR) Recep tor Like Protein (RLP), to (ii) a transmembrane domain and/or a cytoplasmatic domain de rived from a membrane bound kinase. Preferably the method is not an essentially biological process for the production of plants.
In context of this invention“fusing together” preferably constitutes either a step of introduc ing at least two donor nucleic acid sequences into one expressible nucleic acid sequence that encodes for the chimeric PRR, wherein the two donor nucleic acid sequences comprise a first donor nucleic acid sequence encoding for the ectodomain derived from the LRR-RLP, and a second donor nucleic acid encoding for the transmembrane domain and/or the cytoplasmatic domain derived from the membrane bound kinase. The chimeric PRR is preferably one as disclosed herein above. Therefore, the above defini tions and embodiments equally apply to the chimeric PRR produced by the above method and are omitted here in order to avoid unnecessary redundancy.
In some embodiments the method comprises a step of expressing said expressible nucleic acid sequence in a plant or plant cell, to obtain the chimeric PRR protein.
In order to allow for an easy isolation or purification of the chimeric PRRs of the present in vention, said chimeric PRR of the invention is in preferred embodiments conjugated to a tag, for example a poly histidine tag or to any other detectable tag, like for example a fluorescent or luminescent protein, preferably to GFP. Also any other fusion protein derived from the chimeric PRR of the invention is comprised by the present invention.
Preferred is also the chimeric PRR according to the invention that when expressed in a plant cell induces, upon binding to a ligand, intracellular signalling in said plant cell, preferably yielding into an immune response or other defense or protective response of said plant cell, such as ethylene synthesis, expression of immune genes or production of reactive oxygen species (oxidative burst).
On the other hand another preferred embodiment of the invention is that the chimeric PRR when expressed in a plant cell, induces upon binding to a ligand intracellular signalling, pref erably yielding into plant growth, plant cell death or a promotion of plant development or any other plant cellular response besides pathogen-specific responses.
In context of the invention an expressible sequence preferably relates to a genetic expression construct which allows for the expression of said nucleotide sequences in a plant, plant cell or plant tissue. It is specifically preferred that said construct is usable for stably or transiently transforming a plant, a plant cell or plant tissue with said construct.
For the expression of any constructs or vectors as described herein in a plant, plant tissue or plant cell, the invention preferably embodies that the described polynucleotides are operable linked to a promoter and to a polyadenylation site, wherein said promoter is characterized in that it is functional in said cell of said plant. As a promoter in this context, any sequence ele ment is sufficient that induces transcription of the downstream sequence. The minimal re quirements of promoters are very well known in the art and many of such promoters are con ventionally used for gene expression in plants. Also preferred in the context of the above method is to determine the binding of said chimer ic PRR to said candidate ligand molecule by binding assays, such as described in Albert et al. 2010, or via competition assays.
Further provided is a use of a chimeric PRR as described herein before, in a plant or plant cell or plant tissue to stimulate and/or promote plant growth, development or cell death.
Particularly preferred is the method as described herein, wherein said expression constructs allows for a plant cell type-specific or plant tissue-specific expression of said chimeric PRR. In this way it is possible to specifically flag certain plant cells of choice which then, by using the above method for isolation can be isolated/enriched and/or purified. In this respect it is preferred that said expression construct allows for a constitutive expression or a inducible expression after the transformation of the construct.
The matrix of choice in the above methods is selected from the group comprising tissue cul ture plates and dishes, beads or membranes.
All embodiments and aspects of the herein described invention may be combined with each other in a way plausible and technical feasible for the skilled artisan.
The present invention will now be further described in the following examples with reference to the accompanying figures and sequences, nevertheless, without being limited thereto. For the purposes of the present invention, all references as cited herein are incorporated by refer ence in their entireties. In the Figures :
Fig l depicts constructs used for turning a LRR-RLP into a LRR-RLK; to turn RLP23 or EIX2 into a RLK-like, the inventors added the TMD and the kinase of SOBIRi. To ensure that the resulting RLP23tmkSOBIRi and EIX2tmkS0BIRi behave like a RLK, the inventors built RLP23tmSOBIRi and EIX2tmS0BIRi as control. The inventors also built RLPitmkSOBIRi and RLP30tmkSOBIRi. The inventors further built EFRtmkSOBIR and EFRAkin-tmSOBIRi as controls.
Fig. 2 depicts RLP23 constructs containing the TMD of SOBIRi can propagate nlp20 signal ing; (A) Oxidative burst, treatments were flg22 100 nM (2, positive control), BSA (1, negative control) or nlp20 100 nM (3). Data show mean ± SD in luminol-dependent light emission (RLU, relative light units) of at least 4 replicates. (B) Ethylene induction in transformed leaf pieces treated for 3 h in the presence of 100 nM nlp20 (3), 4.5 pg Penicillium extract (2, posi- tive control) or water (l, negative control). Values show mean ± SD in pmol ethylene per ml of air of 3 replicates.
Fig. 3 depicts EIX2 constructs containing the TMD of SOBIRi can propagate xylanase sig naling; (A) Oxidative burst, treatments were flg22 100 nM (2, positive control), BSA (1, nega tive control) or xylanase 1 mg/ml (3). Data show mean ± SD in luminol-dependent light emission (RLU, relative light units) of at least 4 replicates. (B) Ethylene induction in trans formed leaf pieces treated for 3 h in the presence of 1 mg xylanase (3), 4.5 pg Penicillium ex tract (2, positive control) or water (1, negative control). Values show mean ± SD in pmol eth ylene per ml of air of 3 replicates.
Fig. 4 depicts EFR constructs containing the TMD of SOBIRi can propagate elfi8 signaling (A) Oxidative burst, treatments were flg22 100 nM (3, positive control), BSA (1, negative con trol) or elfi8 100 nM (2). Data show mean ± SD in luminol-dependent light emission (RLU, relative light units) of at least 4 replicates. (B) Ethylene induction in transformed leaf pieces treated for 3 h in the presence of 100 nM elfi8 (3), 4.5 pg Penicillium extract (2, positive con trol) or water (1, negative control). Values show mean ± SD in pmol ethylene per ml of air of 3 replicates.
Fig. 5 depicts co-immunoprecipitation of RLP23tmkSOBIRi with SOBIRi and BAKi; GFP- tagged receptors, SOBIRi-HA and BAKi-myc were expressed in N. benthamiana leaves for 72 h, were purified and tested for complex formation upon ligand-perception. Peptide was infil trated at 1 pM for 3 min prior to harvest.
Fig. 6 depicts RLP23tmkSOBIR can induce FRKi in A. thaliana sobiri-12 mutant; Induction of the reporter gene pFRKi::luc in protoplasts of A. thaliana sobin-12 mutant complemented with RLP23, RLP23tmkSOBIR or RLP23tmSOBIR and treated with BSA (1), flg22 (2) or with nlp20 (3).
Fig. 7 depicts entropy analysis of TMD consensus sequences; the entropy of each position in canonical TMD sequences reveals the conservation momentum of the a-helix for LRR-RLKs and LRR-RLPs. (A) EFR and EFR-likes (ELIs, 58 sequences), (B) EIX2 (10 sequences), (C) FLS2 (43 sequences), (D) RLP23 and homologs from Brassicaceae (136 sequences), (E) SOBIRi (37 sequences). Entropy of 0.0 means high conservation (no variation), entropy of 1.0 means low conservation (high variation). Red for charged residues (R, K), green for polar residues (N, Q), salmon for proline (P), orange for small side chain residues (G, S, T, A), blue for hydrophobic residues (I, L, V) and yellow for hydrophobic residues with an aromatic ring (F, Y, W). The best three models for a-helix momentum are indicated below the consensus sequence and show entropy fits.
And in the sequences:
SEQ ID NO: 1: EFR
MKLSFSLVFNALTLLLQVCIFAQARFSNETDMQALLEFKSQVSENNKREVLA
SWNHSSPFCNWIGVTCGRRRERVISLNLGGFKLTGVISPSIGNLSFLRLLNLA
DNSFGSTIPQKVGRLFRLQYLNMSYNLLEGRIPSSLSNCSRLSTVDLSSNHLG
HGVPSELGSLSKLAILDLSKNNLTGNFPASLGNLTSLQKLDFAYNQMRGEIPD
EVARLTQMVFFQIALNSFSGGFPPALYNISSLESLSLADNSFSGNLRADFGYLL
PNLRRLLLGTNQFTGAIPKTLANISSLERFDISSNYLSGSIPLSFGKLRNLWWL
GIRNNSLGNNSSSGLEFIGAVANCTQLEYLDVGYNRLGGELPASIANLSTTLTS
LFLGQNLISGTIPHDIGNLVSLQELSLETNMLSGELPVSFGKLLNLQWDLYS
NAISGEIPSYFGNMTRLQKLHLNSNSFHGRIPQSLGRCRYLLDLWMDTNRLN
GTIPQEILQIPSLAYIDLSNNFLTGHFPEEVGKLELLVGLGASYNKLSGKMPQA
IGGCLSMEFLFMQGNSFDGAIPDISRLVSLKNVDFSNNNLSGRIPRYLASLPSL
RNLNLSMNKFEGRVPTTGVFRNATAVSVFGNTNICGGVREMQLKPCIVQASP
RKRKPLSVRKKWSGICIGIASLLLIIIVASLCWFMKRKKKNNASDGNPSDSTT
LGMFHEKVSYEELHSATSRFSSTNLIGSGNFGNVFKGLLGPENKLVAVKVLN
LLKHGATKSFMAECETFKGIRHRNLVKLITVCSSLDSEGNDFRALVYEFMPK
GSLDMWLQLEDLERVNDHSRSLTPAEKLNIAIDVASALEYLHVHCHDPVAH
CDIKPSNILLDDDLTAHVSDFGLAQLLYKYDRESFLNQFSSAGVRGTIGYAAP
EYGMGGQPSIQGDVYSFGILLLEMFSGKKPTDESFAGDYNLHSYTKSILSGCT
SSGGSNAIDEGLRLVLQVGIKCSEEYPRDRMRTDEAVRELISIRSKFFSSKTTI
TESPRDAPQSSPQEWMLNTDMHTM
SEQ ID NO: 2 RLPi
MGLLQLKSYLKNLVDAEEEEEEGLSILKSWTHHEGDCCRWERVKCSDAING
HVIGLSLDRLVPVAFESQTRSLNLSLLHSFPQLQSLNLSWNWFTNLSDHFLG
FKSFGTLDKLTTLDFSHNMFDNSIVPFLNAATSIRSLHLESNYMEGVFPPQEL
SNMTNLRVLNLKDNSFSFLSSQGLTDFRDLEVLDLSFNGVNDSEASHSLSTA
KLKTLDLNFNPLSDFSQLKGLESLQELQVLKLRGNKFNHTLSTHVLKDLKML
QELDLSDNGFTNLDHGRDVDESRSEKRFDFREWQKVETLWIGLRLSFQMS
ITHHKSVTVGGNGFLGLEIPTSLQVLDFKRNQLSLTHEGYLGICRLMKLRELD
LSSNALTSLPYCLGNLTHLRTLDLSNNQLNGNLSSFVSGLPSVLEYLSLLDNN
FDGSFLFNSLVNQTRLTVFKLSSKVGVIQVQTESSWAPLFQLKMLYLSNCSLG
STMLGFLVHQRDLCFVDLSHNKLTGTFPTWLVKNNTRLQTILLSGNSLTKLQ LPILVHGLQVLDISSNMIYDSIQEDIGMVFPNLRFMNFSSNHFQGTIPSSIGE
MKSLQVLDMSSNGLYGQLPIMFLSGCYSLRVLKLSNNQLQGKIFSKHANLTG
LVGLFLDGNNFTGSLEEGLLKSKNLTLLDISDNRFSGMLPLWIGRISRLSYLY
MSGNQLKGPFPFLRQSPWVEVMDISHNSFSGSIPRNVNFPSLRELRLQNNEF
TGLVPGNLFKAAGLEVLDLRNNNFSGKILNTIDQTSKLRILLLRNNSFQTYIP
GKICQLSEVGLLDLSHNQFRGPIPSCFSKMSFGAEQNDRTMSLVADFDFSYIT
FLPHCQYGSHLNLDDGVRNGYQPKPATWDFLTKSRYEAYQGDILRYMHGL
DLSSNELSGEIPIEIGDLQNIRSLNLSSNRLTGSIPDSISKLKGLESLDLSNNKL
DGSIPPALADLNSLGYLNISYNNLSGEIPFKGHLVTFDERSYIGNAHLCGLPTN
KNCISQRVPEPPSVSTHAKEEENEEEGNVIDMVWFYWTCAAVYISTSLALFAF
LYIDSRWSREWFYRVDLCVHHILQFKRSSVCN
SEQ ID NO: 3 RLP23
MSKALLHLHFLSLFLLCCVCHSSIFTLNFHFTGIVACRPHQIQAFTKFTNEFD
TRGCNNSDTFNGVWCDNSTGAVAVLQLRKCLSGTLKSNSSLFGFHQLRYVD
LQNNNLTSSSLPSGFGNLKRLEGLFLSSNGFLGQVPSSFSNLTMLAQLDLSYN
KLTGSFPLVRGLRKLIVLDLSYNHFSGTLNPNSSLFELHQLRYLNLAFNNFSS
SLPSKFGNLHRLENLILSSNGFSGQVPSTISNLTRLTKLYLDQNKLTSSFPLVQ
NLTNLYELDLSYNKFFGVIPSSLLTLPFLAHLALRENNLAGSVEVSNSSTSSRL
EIMYLGSNHFEGQILEPISKLINLKHLDLSFLNTSYPIDLKLFSSLKSLRSLDLS
GNSISSASLSSDSYIPLTLEMLTLRHCDINEFPNILKTLKELVYIDISNNRMKG
KIPEWLWSLPLLQSVTLGNNYFTGFQGSAEILVNSSVLLLYLDSNNFEGALPD
LPLSIKGFGVASNSFTSEIPLSICNRSSLAAIDLSYNNFTGPIPPCLRNLELVYLR
NNNLEGSIPDALCDGASLRTLDVSHNRLTGKLPRSFVNCSSLKFLSVINNRIE
DTFPFWLKALPNLQVLTLRSNRFYGPISPPHQGPLGFPELRIFEISDNKFTGSL
PPNYFVNWKASSRTMNQDGGLYMVYEEKLFDEGGYGYTDALDLQYKGLHM
EQAKALTSYAAIDFSGNRLEGQIPESIGLLKALIAVNISNNAFTGHIPLSMANL
ENLESLDMSRNQLSGTIPNGLGSISFLAYINVSHNQLTGEIPQGTQITGQSKSS
FEGNAGLCGLPLKESCFGTGAPPMYHQKQEDKEEEEEEEEEEEEVLNGRAV
AIGYGSGLLLGLAIAQVIASYKPEWLVKIIGLNKRRKR
SEQ ID NO: 4 RLP30
MIPSQSNSFSGSVITLYFFLLGSLVLRTLASSRLHYCRHDQRDALLEFKHEFPV
SESKPSPSLSSWNKTSDCCFWEGVTCDDESGEWSLDLSYVLLNNSLKPTSGL
FKLQQLQNLTLSDCHLYGEVTSSLGNLSRLTHLDLSSNQLTGEVLASVSKLN
QLRDLLLSENSFSGNIPTSFTNLTKLSSLDISSNQFTLENFSFILPNLTSLSSLN
VASNHFKSTLPSDMSGLHNLKYFDVRENSFVGTFPTSLFTIPSLQrVYLEGNQ
FMGPIKFGNISSSSRLWDLNLADNKFDGPIPEYISEIHSLIVLDLSHNNLVGPI PTSISKLVNLQHLSLSNNTLEGEVPGCLWGLMTVTLSHNSFNSFGKSSSGAL
DGESMQELDLGSNSLGGPFPHWICKQRFLKYLDLSNNLFNGSIPPCLKNSTY
WLKGLVLRNNSFSGFLPDVFVNASMLLSLDVSYNRLEGKLPKSLINCTGMEL
LNVGSNIIKDTFPSWLVSLPSLRVLILRSNAFYGSLYYDHISFGFQHLRLIDISQ
NGFSGTLSPLYFSNWREMVTSVLEENGSNIGTEDWYMGEKGPEFSHSNSMT
MIYKGVETDFLRIPYFFRAIDFSGNRFFGNIPESVGLLKELRLLNLSGNSFTSN
IPQSLANLTNLETLDLSRNQLSGHIPRDLGSLSFLSTMNFSHNLLEGPVPLGT
QFQSQHCSTFMDNLRLYGLEKICGKAHAPSSTPLESEEFSEPEEQVINWIAAA
IAYGPGVFCGLVIGHIFFrAHKHEWFMEKFHRNKRRVVTTSAR
SEQ ID NO: 5 SOBIRi
MAVPTGSANLFLRPLILAVLSFLLLSSFVSSVEWLDIDSSDLKALQVIETELGV
NSQRSSASDVNPCGRRGVFCERRHSATTGEYVLRVTRLVYRSRSLTGTISPVI
GMLSELKELTLSNNQLVNAVPVDILSCKQLEVLDLRKNRFSGQIPGNFSSLSR
LRILDLSSNKLSGNLNFLKNLRNLENLSVANNLFSGKIPEQIVSFHNLRFFDF
SGNRYLEGPAPVMSSIKLQTSPHQTRHILAETPTSSPTNKPNNSTTSKAPKGA
PKPGKLKKKKKKSKKKKVAAWILGFWGAIGGTISGFVFSVLFKLIIQAIRGSE
KPPGPSIFSPLIKKAEDLAFLENEEALASLEIIGRGGCGEVFKAELPGSNGKIIA
VKKVIQPPKDADELTDEDSKFLNKKMRQIRSEINTVGHIRHRNLLPLLAHVS
RPECHYLVYEYMEKGSLQDILTDVQAGNQELMWPARHKIALGIAAGLEYLH
MDHNPRIIHRDLKPANVLLDDDMEARISDFGLAKAMPDAVTHITTSHVAGT
VGYIAPEFYQTHKFTDKCDIYSFGVILGILVIGKLPSDEFFQHTDEMSLIKWM
RNIITSENPSLAIDPKLMDQGFDEQMLLVLKIACYCTLDDPKQRPNSKDVRT
MLSQIKH
SEQ ID NO: 6 EIX2
MGKRTNPRHFLVTWSLLLLETAFGLTSREVNKTLCIEKERGALLEFKRGLND
DFGRLSTWGDEEECCNWKGIECDKRTGHVIVLDLHSEVTCPGHACFAPILTG
KVSPSLLELEYLNFLDLSVNGFENSEIPRFIGSLKRLEYLNLSSSDFSGEIPAQF
QNLTSLRILDLGNNNLIVKDLVWLSHLSSLEFLRLGGNDFQARNWFREITKV
PSLKELDLSVCGLSKFVPSPADVANSSLISLSVLHLCCNEFSTSSEYSWLFNFST
SLTSIDLSHNQLSRQIDDRFGSLMYLEHLNLANNFGAEGGVPSSFGNLTRLH
YLDMSNTQTYQWLPELFLRLSGSRKSLEVLGLNDNSLFGSIVNVPRFSSLKKL
YLQKNMLNGFFMERVGQVSSLEYLDLSDNQMRGPLPDLALFPSLRELHLGS
NQFQGRIPQGIGKLSQLRIFDVSSNRLEGLPESMGQLSNLERFDASYNVLKGT
ITESHFSNLSSLVDLDLSFNLLSLNTRFDWVPPFQLQFIRLPSCNMGPSFPKW
LQTQNNYTLLDISLANISDMLPSWFSNLPPELKILNLSNNHISGRVSEFIVSKQ
DYMIIDLSSNNFSGHLPLVPANIQIFYLHKNHFSGSISSICRNTIGAATSIDLSR NQFSGEVPDCWMNMSNLAVLNLAYNNFSGKVPQSLGSLTNLEALYIRQNSF
RGMLPSFSQCQLLQILDIGGNKLTGRIPAWIGTDLLQLRILSLRSNKFDGSIPS
LICQLQFLQILDLSENGLSGKIPQCLNNFTILRQENGSGESMDFKVRYDYIPGS
YLYIGDLLIQWKNQESEYKNALLYLKIIDLSSNKLVGGIPKEIAEMRGLRSLNL
SRNDLNGTWEGIGQMKLLESLDLSRNQLSGMIPQGLSNLTFLSVLDLSNNH
LSGRIPSSTQLQSFDRSSYSGNAQLCGPPLEECPGYAPPIDRGSNTNPQEHDD
DDEFSSLEFYVSMVLGFFVTFWGILGCLIVNRSWRNAYFTFLTDMKSWLHM
TSRVCFARLKGKLRN
SEQ ID NO: 7 RLPitmkSOBIRi
MGLLQLKSYLKNLVDAEEEEEEGLSILKSWTHHEGDCCRWERVKCSDAING
HVIGLSLDRLVPVAFESQTRSLNLSLLHSFPQLQSLNLSWNWFTNLSDHFLG
FKSFGTLDKLTTLDFSHNMFDNSIVPFLNAATSIRSLHLESNYMEGVFPPQEL
SNMTNLRVLNLKDNSFSFLSSQGLTDFRDLEVLDLSFNGVNDSEASHSLSTA
KLKTLDLNFNPLSDFSQLKGLESLQELQVLKLRGNKFNHTLSTHVLKDLKML
QELDLSDNGFTNLDHGRDVDESRSEKRFDFREWQKVETLWIGLRLSFQMS
ITHHKSVTVGGNGFLGLEIPTSLQVLDFKRNQLSLTHEGYLGICRLMKLRELD
LSSNALTSLPYCLGNLTHLRTLDLSNNQLNGNLSSFVSGLPSVLEYLSLLDNN
FDGSFLFNSLVNQTRLTVFKLSSKVGVIQVQTESSWAPLFQLKMLYLSNCSLG
STMLGFLVHQRDLCFVDLSHNKLTGTFPTWLVKNNTRLQTILLSGNSLTKLQ
LPILVHGLQVLDISSNMIYDSIQEDIGMVFPNLRFMNFSSNHFQGTIPSSIGE
MKSLQVLDMSSNGLYGQLPIMFLSGCYSLRVLKLSNNQLQGKIFSKHANLTG
LVGLFLDGNNFTGSLEEGLLKSKNLTLLDISDNRFSGMLPLWIGRISRLSYLY
MSGNQLKGPFPFLRQSPWVEVMDISHNSFSGSIPRNVNFPSLRELRLQNNEF
TGLVPGNLFKAAGLEVLDLRNNNFSGKILNTIDQTSKLRILLLRNNSFQTYIP
GKICQLSEVGLLDLSHNQFRGPIPSCFSKMSFGAEQNDRTMSLVADFDFSYIT
FLPHCQYGSHLNLDDGVRNGYQPKPATWDFLTKSRYEAYQGDILRYMHGL
DLSSNELSGEIPIEIGDLQNIRSLNLSSNRLTGSIPDSISKLKGLESLDLSNNKL
DGSIPPALADLNSLGYLNISYNNLSGEIPFKGHLVTFDERSYIGNAHLCGLPTN
KNCISQRVPEPPSVSTHAKEEENEEEGNVIDMVAAWILGFWGAIGGTISGFV
FSVLFKLIIQAIRGSEKPPGPSIFSPLIKKAEDLAFLENEEALASLEIIGRGGCGE
VFKAELPGSNGKIIAVKKVIQPPKDADELTDEDSKFLNKKMRQIRSEINTVGH
IRHRNLLPLLAHVSRPECHYLVYEYMEKGSLQDILTDVQAGNQELMWPARH
KIALGIAAGLEYLHMDHNPRIIHRDLKPANVLLDDDMEARISDFGLAKAMPD
AVTHITTSHVAGWGYIAPEFYQTHKFTDKCDIYSFGVILGILVIGKLPSDEFFQ
HTDEMSLIKWMRNIITSENPSLAIDPKLMDQGFDEQMLLVLKIACYCTLDDP
KQRPNSKDVRTMLSQIKH SEQ ID NO: 8 RLP23tmSOBIRi
MSKALLHLHFLSLFLLCCVCHSSIFTLNFHFTGIVACRPHQIQAFTKFTNEFD
TRGCNNSDTFNGVWCDNSTGAVAVLQLRKCLSGTLKSNSSLFGFHQLRYVD
LQNNNLTSSSLPSGFGNLKRLEGLFLSSNGFLGQVPSSFSNLTMLAQLDLSYN
KLTGSFPLVRGLRKLIVLDLSYNHFSGTLNPNSSLFELHQLRYLNLAFNNFSS
SLPSKFGNLHRLENLILSSNGFSGQVPSTISNLTRLTKLYLDQNKLTSSFPLVQ
NLTNLYELDLSYNKFFGVIPSSLLTLPFLAHLALRENNLAGSVEVSNSSTSSRL
EIMYLGSNHFEGQILEPISKLINLKHLDLSFLNTSYPIDLKLFSSLKSLRSLDLS
GNSISSASLSSDSYIPLTLEMLTLRHCDINEFPNILKTLKELVYIDISNNRMKG
KIPEWLWSLPLLQSVTLGNNYFTGFQGSAEILVNSSVLLLYLDSNNFEGALPD
LPLSIKGFGVASNSFTSEIPLSICNRSSLAAIDLSYNNFTGPIPPCLRNLELVYLR
NNNLEGSIPDALCDGASLRTLDVSHNRLTGKLPRSFVNCSSLKFLSVINNRIE
DTFPFWLKALPNLQVLTLRSNRFYGPISPPHQGPLGFPELRIFEISDNKFTGSL
PPNYFVNWKASSRTMNQDGGLYMVYEEKLFDEGGYGYTDALDLQYKGLHM
EQAKALTSYAAIDFSGNRLEGQIPESIGLLKALIAVNISNNAFTGHIPLSMANL
ENLESLDMSRNQLSGTIPNGLGSISFLAYINVSHNQLTGEIPQGTQITGQSKSS
FEGNAGLCGLPLKESCFGTGAPPMYHQKQEDKEEEEEEEEEEEEVAAWILGF
WGAIGGTISGFVFSVLFKPEWLVKIIGLNKRRKR
SEQ ID NO: 9 RLP23tmkSOBIRi
MSKALLHLHFLSLFLLCCVCHSSIFTLNFHFTGIVACRPHQIQAFTKFTNEFD
TRGCNNSDTFNGVWCDNSTGAVAVLQLRKCLSGTLKSNSSLFGFHQLRYVD
LQNNNLTSSSLPSGFGNLKRLEGLFLSSNGFLGQVPSSFSNLTMLAQLDLSYN
KLTGSFPLVRGLRKLIVLDLSYNHFSGTLNPNSSLFELHQLRYLNLAFNNFSS
SLPSKFGNLHRLENLILSSNGFSGQVPSTISNLTRLTKLYLDQNKLTSSFPLVQ
NLTNLYELDLSYNKFFGVIPSSLLTLPFLAHLALRENNLAGSVEVSNSSTSSRL
EIMYLGSNHFEGQILEPISKLINLKHLDLSFLNTSYPIDLKLFSSLKSLRSLDLS
GNSISSASLSSDSYIPLTLEMLTLRHCDINEFPNILKTLKELVYIDISNNRMKG
KIPEWLWSLPLLQSVTLGNNYFTGFQGSAEILVNSSVLLLYLDSNNFEGALPD
LPLSIKGFGVASNSFTSEIPLSICNRSSLAAIDLSYNNFTGPIPPCLRNLELVYLR
NNNLEGSIPDALCDGASLRTLDVSHNRLTGKLPRSFVNCSSLKFLSVINNRIE
DTFPFWLKALPNLQVLTLRSNRFYGPISPPHQGPLGFPELRIFEISDNKFTGSL
PPNYFVNWKASSRTMNQDGGLYMVYEEKLFDEGGYGYTDALDLQYKGLHM
EQAKALTSYAAIDFSGNRLEGQIPESIGLLKALIAVNISNNAFTGHIPLSMANL
ENLESLDMSRNQLSGTIPNGLGSISFLAYINVSHNQLTGEIPQGTQITGQSKSS
FEGNAGLCGLPLKESCFGTGAPPMYHQKQEDKEEEEEEEEEEEEVAAWILGF
WGAIGGTISGFVFSVLFKLIIQAIRGSEKPPGPSIFSPLIKKAEDLAFLENEEAL
ASLEIIGRGGCGEVFKAELPGSNGKIIAVKKVIQPPKDADELTDEDSKFLNKK MRQIRSEINTVGHIRHRNLLPLLAHVSRPECHYLVYEYMEKGSLQDILTDVQ
AGNQELMWPARHKIALGIAAGLEYLHMDHNPRIIHRDLKPANVLLDDDME
ARISDFGLAKAMPDAVTHITTSHVAGTVGYIAPEFYQTHKFTDKCDIYSFGVIL
GILVIGKLPSDEFFQHTDEMSLIKWMRNIITSENPSLAIDPKLMDQGFDEQM
LLVLKIACYCTLDDPKQRPNSKDVRTMLSQIKH
SEQ ID NO:io RLP30tmkSOBIRi
MIPSQSNSFSGSVITLYFFLLGSLVLRTLASSRLHYCRHDQRDALLEFKHEFPV
SESKPSPSLSSWNKTSDCCFWEGVTCDDESGEWSLDLSYVLLNNSLKPTSGL
FKLQQLQNLTLSDCHLYGEVTSSLGNLSRLTHLDLSSNQLTGEVLASVSKLN
QLRDLLLSENSFSGNIPTSFTNLTKLSSLDISSNQFTLENFSFILPNLTSLSSLN
VASNHFKSTLPSDMSGLHNLKYFDVRENSFVGTFPTSLFTIPSLQIVYLEGNQ
FMGPIKFGNISSSSRLWDLNLADNKFDGPIPEYISEIHSLIVLDLSHNNLVGPI
PTSISKLVNLQHLSLSNNTLEGEVPGCLWGLMTVTLSHNSFNSFGKSSSGAL
DGESMQELDLGSNSLGGPFPHWICKQRFLKYLDLSNNLFNGSIPPCLKNSTY
WLKGLVLRNNSFSGFLPDVFVNASMLLSLDVSYNRLEGKLPKSLINCTGMEL
LNVGSNIIKDTFPSWLVSLPSLRVLILRSNAFYGSLYYDHISFGFQHLRLIDISQ
NGFSGTLSPLYFSNWREMVTSVLEENGSNIGTEDWYMGEKGPEFSHSNSMT
MIYKGVETDFLRIPYFFRAIDFSGNRFFGNIPESVGLLKELRLLNLSGNSFTSN
IPQSLANLTNLETLDLSRNQLSGHIPRDLGSLSFLSTMNFSHNLLEGPVPLGT
QFQSQHCSTFMDNLRLYGLEKICGKAHAPSSTPLESEEFSEPEEQVAAWILGF
WGAIGGTISGFVFSVLFKLIIQAIRGSEKPPGPSIFSPLIKKAEDLAFLENEEAL
ASLEIIGRGGCGEVFKAELPGSNGKIIAVKKVIQPPKDADELTDEDSKFLNKK
MRQIRSEINTVGHIRHRNLLPLLAHVSRPECHYLVYEYMEKGSLQDILTDVQ
AGNQELMWPARHKIALGIAAGLEYLHMDHNPRIIHRDLKPANVLLDDDME
ARISDFGLAKAMPDAVTHITTSHVAGTVGYIAPEFYQTHKFTDKCDIYSFGVIL
GILVIGKLPSDEFFQHTDEMSLIKWMRNIITSENPSLAIDPKLMDQGFDEQM
LLVLKIACYCTLDDPKQRPNSKDVRTMLSQIKH
SEQ ID NO: 11 EIX2tmSOBIRi
MGKRTNPRHFLVTWSLLLLETAFGLTSREVNKTLCIEKERGALLEFKRGLND
DFGRLSTWGDEEECCNWKGIECDKRTGHVIVLDLHSEVTCPGHACFAPILTG
KVSPSLLELEYLNFLDLSVNGFENSEIPRFIGSLKRLEYLNLSSSDFSGEIPAQF
QNLTSLRILDLGNNNLIVKDLVWLSHLSSLEFLRLGGNDFQARNWFREITKV
PSLKELDLSVCGLSKFVPSPADVANSSLISLSVLHLCCNEFSTSSEYSWLFNFST
SLTSIDLSHNQLSRQIDDRFGSLMYLEHLNLANNFGAEGGVPSSFGNLTRLH
YLDMSNTQTYQWLPELFLRLSGSRKSLEVLGLNDNSLFGSIVNVPRFSSLKKL
YLQKNMLNGFFMERVGQVSSLEYLDLSDNQMRGPLPDLALFPSLRELHLGS NQFQGRIPQGIGKLSQLRIFDVSSNRLEGLPESMGQLSNLERFDASYNVLKGT
ITESHFSNLSSLVDLDLSFNLLSLNTRFDWVPPFQLQFIRLPSCNMGPSFPKW
LQTQNNYTLLDISLANISDMLPSWFSNLPPELKILNLSNNHISGRVSEFIVSKQ
DYMIIDLSSNNFSGHLPLVPANIQIFYLHKNHFSGSISSICRNTIGAATSIDLSR
NQFSGEVPDCWMNMSNLAVLNLAYNNFSGKVPQSLGSLTNLEALYIRQNSF
RGMLPSFSQCQLLQILDIGGNKLTGRIPAWIGTDLLQLRILSLRSNKFDGSIPS
LICQLQFLQILDLSENGLSGKIPQCLNNFTILRQENGSGESMDFKVRYDYIPGS
YLYIGDLLIQWKNQESEYKNALLYLKIIDLSSNKLVGGIPKEIAEMRGLRSLNL
SRNDLNGTWEGIGQMKLLESLDLSRNQLSGMIPQGLSNLTFLSVLDLSNNH
LSGRIPSSTQLQSFDRSSYSGNAQLCGPPLEECPGYAPPIDRGSNTNPQEHDD
DDEFSSLEVAAWILGFWGAIGGTISGFVFSVLFRSWRNAYFTFLTDMKSWL
HMTSRVCFARLKGKLRN
SEQ ID NO: 12 EIX2tmkSOBIRi
MGKRTNPRHFLVTWSLLLLETAFGLTSREVNKTLCIEKERGALLEFKRGLND
DFGRLSTWGDEEECCNWKGIECDKRTGHVIVLDLHSEVTCPGHACFAPILTG
KVSPSLLELEYLNFLDLSVNGFENSEIPRFIGSLKRLEYLNLSSSDFSGEIPAQF
QNLTSLRILDLGNNNLIVKDLVWLSHLSSLEFLRLGGNDFQARNWFREITKV
PSLKELDLSVCGLSKFVPSPADVANSSLISLSVLHLCCNEFSTSSEYSWLFNFST
SLTSIDLSHNQLSRQIDDRFGSLMYLEHLNLANNFGAEGGVPSSFGNLTRLH
YLDMSNTQTYQWLPELFLRLSGSRKSLEVLGLNDNSLFGSIVNVPRFSSLKKL
YLQKNMLNGFFMERVGQVSSLEYLDLSDNQMRGPLPDLALFPSLRELHLGS
NQFQGRIPQGIGKLSQLRIFDVSSNRLEGLPESMGQLSNLERFDASYNVLKGT
ITESHFSNLSSLVDLDLSFNLLSLNTRFDWVPPFQLQFIRLPSCNMGPSFPKW
LQTQNNYTLLDISLANISDMLPSWFSNLPPELKILNLSNNHISGRVSEFIVSKQ
DYMIIDLSSNNFSGHLPLVPANIQIFYLHKNHFSGSISSICRNTIGAATSIDLSR
NQFSGEVPDCWMNMSNLAVLNLAYNNFSGKVPQSLGSLTNLEALYIRQNSF
RGMLPSFSQCQLLQILDIGGNKLTGRIPAWIGTDLLQLRILSLRSNKFDGSIPS
LICQLQFLQILDLSENGLSGKIPQCLNNFTILRQENGSGESMDFKVRYDYIPGS
YLYIGDLLIQWKNQESEYKNALLYLKIIDLSSNKLVGGIPKEIAEMRGLRSLNL
SRNDLNGTWEGIGQMKLLESLDLSRNQLSGMIPQGLSNLTFLSVLDLSNNH
LSGRIPSSTQLQSFDRSSYSGNAQLCGPPLEECPGYAPPIDRGSNTNPQEHDD
DDEFSSLEVAAWILGFWGAIGGTISGFVFSVLFKLIIQAIRGSEKPPGPSIFSPL
IKKAEDLAFLENEEALASLEIIGRGGCGEVFKAELPGSNGKIIAVKKVIQPPKD
ADELTDEDSKFLNKKMRQIRSEINTVGHIRHRNLLPLLAHVSRPECHYLVYE
YMEKGSLQDILTDVQAGNQELMWPARHKIALGIAAGLEYLHMDHNPRIIHR
DLKPANVLLDDDMEARISDFGLAKAMPDAVTHITTSHVAGTVGYIAPEFYQT HKFTDKCDIYSFGVILGILVIGKLPSDEFFQHTDEMSLIKWMRNIITSENPSLA
IDPKLMDQGFDEQMLLVLKIACYCTLDDPKQRPNSKDVRTMLSQIKH
SEQ ID NO: 13 EFRtmkSOBIRi
MKLSFSLVFNALTLLLQVCIFAQARFSNETDMQALLEFKSQVSENNKREVLA
SWNHSSPFCNWIGVTCGRRRERVISLNLGGFKLTGVISPSIGNLSFLRLLNLA
DNSFGSTIPQKVGRLFRLQYLNMSYNLLEGRIPSSLSNCSRLSTVDLSSNHLG
HGVPSELGSLSKLAILDLSKNNLTGNFPASLGNLTSLQKLDFAYNQMRGEIPD
EVARLTQMVFFQIALNSFSGGFPPALYNISSLESLSLADNSFSGNLRADFGYLL
PNLRRLLLGTNQFTGAIPKTLANISSLERFDISSNYLSGSIPLSFGKLRNLWWL
GIRNNSLGNNSSSGLEFIGAVANCTQLEYLDVGYNRLGGELPASIANLSTTLTS
LFLGQNLISGTIPHDIGNLVSLQELSLETNMLSGELPVSFGKLLNLQWDLYS
NAISGEIPSYFGNMTRLQKLHLNSNSFHGRIPQSLGRCRYLLDLWMDTNRLN
GTIPQEILQIPSLAYIDLSNNFLTGHFPEEVGKLELLVGLGASYNKLSGKMPQA
IGGCLSMEFLFMQGNSFDGAIPDISRLVSLKNVDFSNNNLSGRIPRYLASLPSL
RNLNLSMNKFEGRVPTTGVFRNATAVSVFGNTNICGGVREMQLKPCIVQASP
RKRKPLSVRKKVAAWILGFWGAIGGTISGFVFSVLFKLIIQAIRGSEKPPGPSI
FSPLIKKAEDLAFLENEEALASLEIIGRGGCGEVFKAELPGSNGKIIAVKKVIQP
PKDADELTDEDSKFLNKKMRQIRSEINTVGHIRHRNLLPLLAHVSRPECHYL
VYEYMEKGSLQDILTDVQAGNQELMWPARHKIALGIAAGLEYLHMDHNPRI
IHRDLKPANVLLDDDMEARISDFGLAKAMPDAVTHITTSHVAGTVGYIAPEF
YQTHKFTDKCDIYSFGVILGILVIGKLPSDEFFQHTDEMSLIKWMRNIITSENP
SLAIDPKLMDQGFDEQMLLVLKIACYCTLDDPKQRPNSKDVRTMLSQIKH
SEQ ID NO: 14 EFRAkin-tmSOBIRi
MKLSFSLVFNALTLLLQVCIFAQARFSNETDMQALLEFKSQVSENNKREVLA
SWNHSSPFCNWIGVTCGRRRERVISLNLGGFKLTGVISPSIGNLSFLRLLNLA
DNSFGSTIPQKVGRLFRLQYLNMSYNLLEGRIPSSLSNCSRLSTVDLSSNHLG
HGVPSELGSLSKLAILDLSKNNLTGNFPASLGNLTSLQKLDFAYNQMRGEIPD
EVARLTQMVFFQIALNSFSGGFPPALYNISSLESLSLADNSFSGNLRADFGYLL
PNLRRLLLGTNQFTGAIPKTLANISSLERFDISSNYLSGSIPLSFGKLRNLWWL
GIRNNSLGNNSSSGLEFIGAVANCTQLEYLDVGYNRLGGELPASIANLSTTLTS
LFLGQNLISGTIPHDIGNLVSLQELSLETNMLSGELPVSFGKLLNLQWDLYS
NAISGEIPSYFGNMTRLQKLHLNSNSFHGRIPQSLGRCRYLLDLWMDTNRLN
GTIPQEILQIPSLAYIDLSNNFLTGHFPEEVGKLELLVGLGASYNKLSGKMPQA
IGGCLSMEFLFMQGNSFDGAIPDISRLVSLKNVDFSNNNLSGRIPRYLASLPSL
RNLNLSMNKFEGRVPTTGVFRNATAVSVFGNTNICGGVREMQLKPCIVQASP RKRKPLSVRKKVAAWILGFWGAIGGTISGFVFSVLFMKRKKKNNASDGNPS
DSTTLGMFHEKVSYEELHSA
SEQ ID NO: 15 to 28 depict nucleic acid sequences encoding the corresponding amino acid sequences of SEQ ID NO: 1 to 14, in that order (see table 1).
EXAMPLES
Table 1: Sequences of the present invention:
Molecular differences between LRR-RLKs and LRR-RLPs: turning a RLP in a
RLK-like
To identify the molecular characteristics of RLKs and based on the previous results, the in ventors generated chimeric receptors containing the ectodomain of RLPi, RLP23 or RLP30 and the TMD and kinase of SOBIRi (RLPitmkSOBIRi, RLP23tmkSOBIRi and RLP23tmkSOBIRi, Fig 1). The inventors also generated a chimeric receptor containing the ectodomain of RLP23 and the TMD of SOBIRi and the cytoplasmic C-tail of RLP23 (RLP23tmSOBIRi, Fig. l) to assess what molecular features are important for RLK-like func tionality. As control, the inventors built similar construct based on EIX2 and EFRAkin. The inventors transiently expressed these constructs in N. benthamiana, a RLP23-, EIX2- and EFR-free background, and could observe for all constructs a gain of perception to nlp20, xy- lanase and elfi8, respectively (Fig. 2-4). The constitutive interaction with SOBIRi and the ligand-dependent interaction with BAKi for RLP23tmkSOBIRi and EFRtmkSOBIRi was subsequently shown in a co-immunoprecipitation assay from transformed N. benthamiana material (Fig. 5), thus suggesting a tripartite kinase complex. Finally, to determine whether these constructs truly behave like RLKs, the inventors measured the induction of the FRKi reporter gene in protoplasts of A. thaliana sobin-12 mutants transiently expressing either RLP23tmkSOBIRi or RLP23tmSOBIRi. As depicted in Figure 6, RLP23tmkSOBIRi, but not RLP23tmSOBIRi, could induce FRKi expression, thus showing that the former does behave like a RLK.
Analysis of TMD sequences using Shannon’s entropy
To study the evolution of LRR receptors, the inventors first had to establish a suitable da taset. For that, AtEFR (UniProt ID: C0LGT6) was BLASTed against all plant reference prote- omes available on UniProt (www.uniprot.org). A CLANS map was generated using the best 1000 hits from every proteome. The 1000 hits per proteome mark was chosen to keep the following computing steps to a reasonable time. A pairwise comparison was launched using the global alignment STRETCHER from EMBOSS to generate the CLANS map. Length- adjusted scores were then used as cutoff in the CLANS map, as p-values were giving a subop- timal discriminating power within this dataset. For instance, when running a BLASTp search on NCBI for AtEFR against all Viridiplantae (taxonomy ID: 33090, max target output: 5000), the typical results would show over 2500 results having an E-value of 0.0, while their Max scores vary from 2099 to 546, giving a long range of differences which are not reflected in E- values. Nota bene, the analysis was performed on sequences available on UniProt, which in some cases may contain sequencing errors or sequences that might have been mislabelled. The CLANS map ran at different cutoff values to identify the optimal cutoff: enough to sepa rate clusters that they can be individually identified, but not so much that it becomes tedious work to decipher the map. For the rest of the analysis, the length-adjusted HSP score cutoff of 2.0 was chosen as indicative of cluster evolution. After manually annotating the map by accessing UniProt Reference Proteome annotations and checking back on the NR database for annotations not present in the Reference Proteomes, sequences of the main clusters were extracted on separate FASTA files and the phylogenetic tree of each cluster was established. Sequences from each cluster were aligned using Clustal Omega (v. 1.2.1) and alignments were refined using MUSCLE (v. 3.8.31). TMD were identified with PolyPhobius (phobi- us.sbc.su.se/poly.html).
Based on the above results, the inventors extracted from a CLANS map the sequences of SOBIRi, EFR, RLP23, FLS2 and EIX2 and their respective homologs from other plant species and aligned their TMD sequences. The inventors then analyzed the variation of the canonical TMD sequences and calculated the entropy for each position, using Shannon’s equation (Shannon, 1948). After that, the inventors plotted the resulting consensus sequences, with uppercase symbols representing the amino acids that are highly conserved and lowercase letters representing positions where there is some variation among the canonical sequences. The inventors fitted the entropy of each position to a hypothetical a-helix momentum. The angle in a straight a-helix is of 3.63 residues per turn, but natural variations can present an gles of 3.5 (7 residues over 2 complete turns, depicted as 7/2), 3.6 (18/5), 3.66 (11/3) or 3.75 (45/4) (Lupas and Bassler, 2017). The inventors fitted the entropies of this TMD canonical sequences on the best helical momentum, as based on the conservation of each position of the TMD. As depicted on Fig. 7, the TMD sequences of EIXs, RLP23S and SOBIRis contain a highly conserved GxxxG motif, whereas the TMD of EFRs or FLS2s do not present such a motif. Moreover, the TMD of LRR-RLPs and SOBIRi are richer in aromatic residues which are located opposite, before or after to the GxxxG motif. Such residues are in contrast not present in such proportions in the TMDs of LRR-RLKs.
Furthermore, the GxxxG motif in the TMD of SOBIRi locates in the first half of the sequence, whereas this motif appears in the middle and final sections of the TMD from LRR-RLPs, thus suggesting that other residues are playing a role and might act as key-hole actors to ensure the specificity of interaction.
Methods:
Chemicals and solvents
Chemicals and solvents were ordered from Sigma- Aldrich (St. Louis, USA), Carl Roth (Karls ruhe), Merck (Darmstadt), VWR (Radnor, USA), Duchefa (Haarlem, NL) and Fluka (Buchs, CH).
Peptides and elicitors
Flg22, nlp20 and elfi8 were synthetized and provided by different suppliers. Stock solutions of peptides were prepared in H2O and diluted in a solution medium with 1 mg/ml BSA and 100 mM NaCl. Bacterial strains
XLi blue Escherichia coli were used for vector production in bacteria (maxi- and mini-prep). TOPio E. coli were used for pENTR TOPO cloning. E. coli were grown in liquid LB medium at 37°C and 200 rpm in a shaker or on LB-agarose plates at 37°C in stationary incubators. Agrobacterium tumefaciens GV3101 were used for plant transformation and transient ex pression in Nicotiana benthamiana. A. tumefaciens were transformed by electroporation and positive colonies were picked after 48I1 growth on LB-agarose plates at 30°C in station ary incubators. They were then grown overnight at 30°C and 250 rpm in a shaker in liquid LB medium.
Plant material
Seedlings of Arabidopsis thaliana were grown at 22°C under a 8:16 h lightidark photoperiod at 70 pE/m2/s and 40-65% relative humidity in controlled environment (four weeks covered with a lid in a Percival growth chamber, followed by two weeks without lid in a Mobylux Grow Bank, CLF Plant-Climatics, Emersacker). Leaves of 4-6 weeks old A. thaliana sobiri-12 mutant plants were used for protoplasts isolation and transformation. To study protein ex pression and functionality in a different plant background, 4-5 weeks old Nicotiana ben thamiana were used for bioassays as well as for interaction studies. They were grown in the greenhouse at 22°C 16:8 h lightidark photoperiod.
Agrob cterium-mediated transformation of Nicotiana benthamiana
Nicotiana benthamiana is commonly used for transient expression assays (e.g. Albert et al, 2015). Transformation was mediated by Agrobacterium tumefaciens (strain GV3101) cariy- ing plasmids encoding the gene of interest. After overnight incubation of transformed bacte ria in LB medium (at 30°C, 250 rpm), bacteria were collected by centrifugation (4000 g, 8 min) and resuspended to an OD of 1 in 10 mM MgCl2 with 150 uM acetosyringone. After in cubation at room-temperature for 90 min, bacteria were diluted to an OD of 0.4, mixed 1:1 with A. tumefaciens (C58C1) carrying the P19 suppressor of silencing (Voinnet et al, 2003) and pressure-infiltrated in 4-5 week old N. benthamiana leaves. Leaves were cut in pieces for bioassays 24I1 after infiltration, or harvested 36I1 after infiltration and directly frozen in liq uid nitrogen for protein expression analysis.
Protoplasts isolation and pFRKi::Luc assay
Transient expression in mesophyll protoplasts from Arabidopsis thaliana sobiri-12 mutant leaves was performed as described in (Yoo et al, 2007). Briefly, aliquots of 20 000 proto plasts were cotransformed with 5 pg plasmid with the reporter construct pFRKiuluciferase and 5 pg plasmid with the receptor construct to be tested. Protoplasts were resuspended in W5 solution with 0.2 mM luciferin. Aliquots were incubated overnight (max I2h) in a 96-well plate before treatment with the respective peptides (BSA-NaCl as control, elfi8, pepi, BL, csp22, CLV3, flg22). Luciferase activity was monitored via light emission using a luminome- ter (Mithras LB 940).
Oxidative burst
Analysis of oxidative burst was performed on leaf pieces (see Ethylene production, above) of transiently transformed N. benthamiana. Leaf pieces were placed in individual wells of a 96- well plate with a 90:10 pi H20:mastermix solution (1 ml H2O, 20 mΐ luminol, 3 mΐ peroxi dase). After a 5-10 min pre-run to test for the background of ROS production, leaf pieces were induced with either the peptide to be tested, BSA/NaCl (neg. control) or flg22 100 nM (positive control) as previously described (Albert et al., 2010).
PCRs. electrophoresis and DNA sequencing
Primers were designed with CLC Workbench 7, with an optimal length of 20-22 nt, ideally with 60% GC content and a melting temperature between 55-63°C. The forward primers had an additional“CACC” overhang for directional pENTR TOPO cloning. Chimeric receptors were created by binding two separate PCR products with overlapping ends as previously de scribed (Albert et al, 2010c; Mueller et al, 2012a). Truncated constructs were generated using reverse primers at the desired target (no stop codon). Chimeric receptors were built with normal external primers and overlapping chimeric internal primers, which had half of each sequence and were 40-50 nt long. All primers were ordered from Sigma- Aldrich.
Gel electrophoresis were all performed with 1% agarose-TAE gels and band purification was done with the GeneJET Gel Extraction kit from ThermoFisher Scientific. DNA sequencing was performed by GATC Biotech (Konstanz).
Vectors
After using pENTR/TEV/D-TOPO or pENTR/D-TOPO as entry vectors (pENTR directional TOPO kits, Invitrogen), constructs were exported to EcoRI-digested PK7FWG2 expression vectors (Spectinomycin resistance in bacteria), containing the cauliflower mosaic virus 35S overexpressing promoter and a C-terminal GFP tag. Alternatively, PGWB14 was used for HA- tagged constructs and PGWB17 for Myc-tagged constructs (both vectors have Hygromycin and Kanamycin resistances in bacteria).
Protein biochemistry
Protein separation from crude extract or immune-enriched fractions was achieved with 8% SDS-PAGE gels, unless indicated otherwise. The inventorsstern blotting to nitrocellulose membrane (GE Healthcare) was performed using semi-dry western blotting technology from BioRad. Immunoprecipitation (IP) and co-IP was based on magnetic GFP-Trap MA beads (unless indicated otherwise) from Chromotek, and performed as described in Jehle et al., (2013). Crude extract blotting used 30 mg of grinded leaf material resuspended in 2 volumes [w/v] of loading buffer mixed with b-mercaptoethanol. The following antibodies were used: anti-GFP produced in rabbit (Torrey Pines Biolabs Inc.), anti-Myc produced in rabbit (Sig ma- Aldrich) and anti-HA produced in mouse (Sigma- Aldrich).