Login| Sign Up| Help| Contact|

Patent Searching and Data


Title:
DNA ADENINE METHYLTRANSFERASES AND USES THEREOF
Document Type and Number:
WIPO Patent Application WO/1998/012206
Kind Code:
A1
Abstract:
The present invention relates to the isolation and sequencing of a novel class of methyltransferase genes, including the methyltransferase gene from $i(Rhizobium meliloti), $i(Agrobacterium tumefaciens), $i(Brucella abortus), and $i(Helicobacter pylori). The invention further comprises efficient methods of assaying methyltransferase activity.

Inventors:
SHAPIRO LUCY (US)
BENKOVIC STEPHEN J (US)
WRIGHT RACHEL (US)
STEPHENS CRAIG (US)
KAHNG LYN SUE (US)
BERDIS ANTHONY (US)
LEE IRENE (US)
Application Number:
PCT/US1997/016593
Publication Date:
March 26, 1998
Filing Date:
September 17, 1997
Export Citation:
Click for automatic bibliography generation   Help
Assignee:
UNIV LELAND STANFORD JUNIOR (US)
PENN STATE RES FOUND (US)
SHAPIRO LUCY (US)
BENKOVIC STEPHEN J (US)
WRIGHT RACHEL (US)
STEPHENS CRAIG (US)
KAHNG LYN SUE (US)
BERDIS ANTHONY (US)
LEE IRENE (US)
International Classes:
C12N9/10; (IPC1-7): C07H21/04; C07H21/02; C12N15/63; C12N15/85; C12N9/10; C12Q1/68; C12Q1/48; G01N33/567; C07K16/40
Other References:
NATURE, 07 August 1997, Vol. 388, TOMB et al., "The Complete Genome Sequence of the Gastric Pathogen Helicobacter Pylori", pages 539-547.
JOURNAL OF BACTERIOLOGY, Sept. 1997, Vol. 179, No. 18, WRIGHT et al., "The CcrM DNA Methyltransferase is Widespread in the Alpha Subdivision of Proteobacteria ans Its Essential Functions are Conserved in Rhizobium Meliloti and Caulobacter Crescentus", pages 5869-5877.
J. MOL. BIOL., 1994, Vol. 235, ZWEIGER et al, "A Caulobacter DNA Methyltransferase That Functions Only in the Predivisional Cell", pages 472-485.
J. BIOL. CHEM., 25 May 1990, Vol. 265, No. 15, REICH et al., "Inhibition of EcoRI DNA Methylase with Cofactor Analogs", pages 8966-8970.
METHODS IN ENZYMOLOGY, 1987, Vol. 155, NELSON et al., "Purification and Assay of Type II DNA Methylases", pages 32-41.
Attorney, Agent or Firm:
Weber, Kenneth A. (8th floor Two Embarcadero Cente, San Francisco CA, US)
Download PDF:
Claims:
WHAT IS CLAIMED IS:
1. An isolated nucleic acid encoding a methyltransferase wherein said methyltransferase has a molecular weight of about 3045 kilodaltons and binds to a polyclonal antibody that specifically binds to a polypeptide from the group of polypeptides having SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, and SEQ ID NO:8.
2. An isolated nucleic acid according to Claim 1 that encodes a Rhizobium meliloti DNA methyltransferase (SEQ ID NO:2).
3. A nucleic acid of Claim 2, wherein the nucleic acid comprises SEQ ID NO: 1.
4. A nucleic acid of Claim 2 contained in a genetically engineered cell.
5. An isolated protein encoding a methyltransferase wherein said methyltransferase has a molecular weight of about 3045 kilodaltons and binds to a polyclonal antibody that specifically binds to a polypeptide from the group of polypeptides having SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, and SEQ ID NO:8.
6. An isolated DNA adenine methyltransferase of claim 5 wherein said methyltransferase has the amino acid sequence provided in SEQ ID NO:2.
7. An isolated nucleic acid according to Claim 1 that encodes a Brucella abortus DNA methyltransferase (SEQ ID NO:4).
8. An isolated nucleic acid of Claim 7, wherein the nucleic acid comprises SEQ ID NO:3.
9. A nucleic acid of Claim 7 contained in a genetically engineered cell.
10. An isolated DNA adenine methyltransferase of claim 5 having SEQ ID NO:4.
11. 1 1.
12. An isolated nucleic acid according to Claim 1 that encodes an Agrobacterium tumefaciens DNA methyltransferase comprising SEQ ID NO:6.
13. An isolated nucleic acid of Claim 1 1 , wherein the nucleic acid comprises SEQ ID NO:5.
14. A nucleic acid of claim 1 1 contained in a genetically engineered cell.
15. An isolated DNA adenine methyltransferase of claim 5 wherein said methyltransferase has the amino acid sequence provided in SEQ ID NO: 6.
16. An isolated nucleic acid according to Claim 1 that encodes a Helicobacter pylori DNA methyltransferase (SEQ ID NO:8).
17. An isolated nucleic acid of Claim 15, wherein the nucleic acid comprises SEQ ID NO:7.
18. 1 7.
19. A nucleic acid of claim 15 contained in a genetically engineered cell.
20. An isolated DNA adenine methyltransferase having SEQ ID NO:8.
21. A nucleic acid of claim 1 that encodes a processive methyltransferase that methylates a first site in a DNA substrate and then a second site in the DNA substrate without dissociating from the DNA substrate between the time of methylation of the first site and the time of methylation of the second site.
22. An efficient assay for methyltransferase activity, comprising the steps of: a) contacting a processive methyltransferase with 1 ) a substrate selected from the group consisting of: CH3 5' atcctctcgcg*agtcaacagaaa 3' aggagagcgc tcagttgtctttataggcgc; CH, 5 ' atcctctcgcg * agtcaacagaaatatccgctcatcaccgcaagtt 3' aggagagcgc tcagttgtctttataggcgagtagtggcgttcaaaaggca; and CH3 5' atcctctcgcg*agtcaacagaaatatccgcgagtcaccgcaagttttccgtitgaccggc 3' aggagagcgc tcagttgtctttataggcgctcagtggcgttcaaaaggcaaactggccgtgggagg; and b) further contacting said processive methyltransferase with a methyl donor prior to or at the same time as the addition of the DNA substrate, wherein the methyltransferase methylates the DNA substrate.
23. An assay according to Claim 20, wherein the methyl donor is S adenosyl methionine.
24. An assay according to Claim 20, wherein the assay is performed at 30° C or 37° C.
25. An assay according to Claim 20, wherein the assay is performed in the presence of 150 mM potassium acetate.
26. An assay for screening for inhibitors of DNA methyltransferase activity that comprises: i. contacting in an aqueous reaction mixture a nucleic acid encoding a DNA methyltransferase wherein said methyltransferase has a molecular weight of about 3045 kilodaltons and binds to a polyclonal antibody that specifically binds to a polypeptide from the group of polypeptides having SEQ ID NO:2, SEQ ID NO:4, SEQ I D NO:6, and SEQ ID NO:8 with an antisense agent that inhibits the expression of the methyltransferase; and, ii. detecting the level of inhibition relative to a control reaction mixture that is substantially identical to the reaction mixture of step i except that the antisense agent is not present in an amount effective to inhibit the expression of the methyltransferase.
27. A method of claim 24 wherein the antisense agent is a ribozyme.
28. A method of claim 24 wherein the reaction mixture is within a host cell.
29. A method of claim 24 wherein the antisense agent is exogenously added to the reaction mixture.
30. A method for assaying for inhibitors of DNA methyltransferase activity comprising the steps of: i. contacting a first aqueous reaction mixture containing a DNA methyltransferase wherein said methyltransferase has a molecular weight of about 30 45 kilodaltons and binds to a polyclonal antibody that specifically binds to a polypeptide from the group of polypeptides having SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, and SEQ ID NO:8 with an agent that inhibits the biological activity of the methyltransferase; and, ii. detecting the level of inhibition relative to a control reaction mixture that is substantially identical to the reaction mixture of step i except that the inhibitory agent is not present in an amount effective to inhibit the expression of the methyltransferase.
31. A method of claim 28 wherein the DNA methyltransferase is not contained within a living cell.
32. A method of claim 28 wherein the DNA methyltransferase is from Brucella abortus.
33. A method of claim 28 wherein more than one agent is tested at the same time.
34. An assay for detecting antibiotics that target processive adenine methyltransferases, comprising: a) contacting a methyltransferase with a methyltransferase substrate in the presence and absence of a test substance; and b) detecting the enzymatic activity of the methyltransferase in the presence and absence of the test substance.
35. An assay according to Claim 32 wherein the enzymatic activity detected in the assay is a processive activity.
Description:
DNA ADENINE METHYLTRANSFERASES AND USES THEREOF

GOVERNMENT RIGHTS

The research that led to this application was supported in part by an NIH grant, and the government may have certain rights to the invention.

BACKGROUND OF THE INVENTION

A. Field of the invention

This invention pertains to the field of microbiology and to the treatment of conditions caused by microbes. In particular, this invention pertains to the isolation, sequencing, and detection of a DNA adenine methyltransferase gene from a variety of micro-organisms.

B. Related Art

Most organisms modify their genomic DNA by the methylation of specific nucleotide bases. DNA methylation is critical to gene regulation and repair of mutational lesions (for recent reviews see Jost and Saluz, DNA Methylation,

Molecular Biology and Biological Significance. Birhauser Verlag, Basel, Switzerland (1993); Palmer and Marinus, Gene 143:1 -12 (1994)).

DNA methylation is catalyzed by a class of enzymes of varying substrate specificity called DNA methyltransferase enzymes. A DNA methyltransferase from the bacterium Caulobacter crescentus, cell cycle regulated methyltransferase ("CcrM" refers to the protein and "ccrM" denotes the gene), methylates the adenine residue in the recognition sequence GANTC (Zweiger et al., ). Mol. Biol. 235: 472-485, 1994; N denotes any nucleotide). CcrM is unusual, as it is not part of a restriction modification system, and is the only known prokaryotic DNA methyltransferase shown to be essential for viability (Stephens et a/., Proc. Natl.

Acad. Sci. 93:1210-1214, 1996) outside of a restriction modification system (i.e., a

coexpressed methylase and restriction enzyme which recognize a same nucleotide sequence)

The CcrM protein, and therefore its DNA methylation activity, is present only at the predivisional stage of the cell cycle (Zweiger et a/., / Mol. Biol. 235- 472-485, 1994, Stephens et a/., Proc Natl Acad Sci 93.1 210-1214, 1996).

This is controlled in two ways; the ccrM gene is transcribed only in the predivisional cell (Stephens et al , I Bactenol 1 77.1662-1669, 1995) and the CcrM protein is highly unstable and is completely degraded by the time of cell division in a Lon protease dependent process (Wright et al., Genes and Development 10 1532-1542, 1996)

SUMMARY OF THE INVENTION

The present invention comprises the isolation and sequence of a number of methyltransferase-encoding nucleic acids and their gene products, including the methyltransferase gene from Rhizobium meliloti, Brucella abortus, Agrobacterium tumefaciens, and Helicobacter pylon These novel DNA methyltransferases are potential targets for new antimicrobial agents. Under the assay conditions provided herein, these enzymes exhibit a novel property called processivity.

In one series of embodiments, the invention comprises an isolated nucleic acid that encodes a Rhizobium meliloti DNA methyltransferase, including a nucleic acid having SEQ ID NO:1 , cells that contain and express such nucleic acids; and isolated DNA adenine methyltransferases encoded by such a nucleic acid (e.g., SEQ ID NO: 2).

In another series of embodiments, the invention comprises an isolated nucleic acid that encodes a Brucella abortus DNA methyltransferase (e g , SEQ ID

NO:4), particularly a nucleic acid having SEQ ID NO.3; cells that contain and express such nucleic acids, and isolated DNA adenine methyltransferases encoded by such nucleic acid.

In another series of embodiments, the invention comprises an isolated nucleic acid (e , SEQ ID NO: 5) that encodes a partial sequence of Agrobacterium tumefaciens DNA methyltransferase (e g , SEQ ID NO 6).

In another series of embodiments, the invention comprises an isolated nucleic acid (e.g , SEQ ID NO: 7) that encodes a Helicobacter pylori DNA methyltransferase ( ., SEQ ID NO: 8), cells that contain and express such nucleic acids, and isolated DNA adenine methyltransferases encoded by such nucleic acid. The ccrM genes for Rhizobium meliloti, Agrobacterium tumefaciens and Brucella abortus exhibit homology to Caulobacter ccrM. It is highly likely that the ccrM homologs are a new DNA methyltransferase family which is not part of a restriction modification system.

Both Caulobacter and Rhizobium ccrM are essential for viability. Neither gene can be disrupted from the chromosome unless a copy is provided in trans on a plasmid (Stephens et al., Proc. Nat'l. Acad. Sci. 93: 1210-1214, 1996; this application). The overexpression of both Rhizobium and Caulobacter ccrM results in defects in cell morphology and cell division, demonstrating the importance of DNA methylation in these two bacteria. Hemimethylated DNA could be detected in both Rhizobium and Caulobacter. In the case of Caulobacter this is due to the cell cycle regulation of ccrM.

In another embodiment, this invention provides for vectors incorporating any of the above-described nucleic acids. The vectors preferably include the above-described nucleic acid operably linked to (under the control of) a promoter, either constitutive or inducible. The vector can also include an initiation and a termination codon.

In another embodiment, this invention provides for cells that contain the above-mentioned nucleic acids and cells that express the above-mentioned nucleic acids that encode adenine methyltransferases. For example, host cells may be transfected with a nucleic acid of SEQ ID NO: 1 , 3, 5, or 7.

In addition to providing for host cells stably transfected with nucleic acids encoding adenine methyltransferases, this invention also uses these transfected host cells to detect compounds that are capable of inhibiting adenine methyltransferase. The invention further provides for nucleic acid probes that are capable of selectively hybridizing to a nucleic acid encoding an adenine methyltransferase. For example, the nucleic acid probe can be the nucleic acid of SEQ ID NO: 1 , 3, 5, or 7 These probes can be used to measure or detect nucleic acids encoding adenine

methyltransferases. The probes are incubated with a biological sample to form a hybrid of the probe with complementary nucleic acid sequences present in the sample. The extent of hybridization of the probe to these complementary nucleic acid sequences is then determined. In another embodiment, this invention provides for antibodies to the methyltransferases encoded by the above-mentioned nucleic acids. Particularly preferred antibodies specifically bind a polypeptide comprising at least 10, more preferably at least 20, 40, 50, and most preferably at least 100, 200, and even 300 contiguous ammo acids, or even the full length polypeptide encoded by a nucleic acid selected from the group consisting of SEQ ID NO: 1 , SEQ ID NO: 3, SEQ ID

NO: 5, or SEQ ID NO: 7; wherein said polypeptide elicits the production of an antiserum or antibody which specifically binds to a polypeptide selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 4, SEQ. ID NO: 6, or SEQ ID NO: 8, wherein the antiserum or antibody preferably does not cross-react with the C crescentus adenine methyltransferase. The antibody can be polyclonal or monoclonal. The antibody can also be humanized or human.

This invention also provides for cells (e.g., recombinant cells such as hybridomas or tπomas) which synthesize any of the above-described antibodies. This invention also provides for kits for the detection and/or quantification of the above-mentioned nucleic acids. The kit can include a container containing one or more of any of the above identified nucleic acids, amplification primers, and antibodies with or without labels, free, or bound to a solid support as described herein. The kits can also include instructions for the use of one or more of these reagents in any of the assays described herein. This invention further provides for methods and assays for identification and screening for novel antibiotics that target the methyltransferases of this invention. Such assays include those for screening for inhibitors of DNA methyltransferase activity that comprises:i. contacting in an aqueous reaction mixture a nucleic acid encoding a DNA methyltransferase wherein said methyltransferase has a molecular weight of about 30-45 kilodaltons and binds to a polyclonal antibody that specifically binds to a polypeptide from the group of polypeptides having SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, and SEQ ID NO:8 with an antisense agent that inhibits the expression of the methyltransferase; and ii. detecting the level of inhibition relative

to a control reaction mixture that is substantially identical to the reaction mixture of step i except that the antisense agent is not present in an amount effective to inhibit the expression of the methyltransferase. The methods include both in vivo and in vitro methods. The antisense agents can either be added exogenously or are produced endogenously through conventional recombmant gene methods.

Other methods for screening include methods for assaying for inhibitors of DNA methyltransferase activity comprising the steps of: i. contacting an aqueous reaction mixture containing a DNA methyltransferase wherein said methyltransferase has a molecular weight of about 30-45 kilodaltons and binds to a polyclonal antibody that specifically binds to a polypeptide from the group of polypeptides having SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, and SEQ ID NO:8 with an agent that inhibits the biological activity of the methyltransferase; and, u. detecting the level of inhibition relative to a control reaction mixture that is substantially identical to the reaction mixture of step i except that the inhibitory agent is not present in an amount effective to inhibit the expression of the methyltransferase. The DNA methyltransferase is not contained within a living cell or the assay can be an in vivo assay where the enzyme is inhibited within a living cell.

Processive assays are also described herein such as an assay for detecting antibiotics that target processive adenine methyltransferases, comprising: 0 contacting a methyltransferase with a methyltransferase substrate in the presence and absence of a test substance; and b) detecting the enzymatic activity of the methyltransferase in the presence and absence of the test substance.

Finally, this invention also provides therapeutic methods. These include methods of detecting infections with Brucella spp. and H pylori by detecting the presence or absence of specific sequences of Brucella or H. pylori adenine methyltransferases or by detecting the proteins themselves Other methods include treating conditions caused by Agrobacterium spp., Rhizobium spp, and Helicobacter spp. Other methods involve administering to a mammal a therapeutically effective dose of a composition comprising a methyl transferase inhibitor and a pharmacological excipient. For animal associated bacteria, methods are preferably performed on mammals such as mice, rats, rabbits, sheep, goats, pigs, more preferably on primates including human patients. Of course for plant

associated bacteria such as Agrobacterium and Rhizobium spp., the preferred methods are performed on their respective host plants.

BRIEF DESCRIPTION OF THE SEQUENCES

Figure 1 is a sequence of a nucleic acid that encodes a Rhizobium meliloti DNA methyltransferase (SEQ ID NO:1). The start codon is boxed and the stop codon is circled.

Figure 2 is the peptide sequence of a Rhizobium meliloti DNA methyltransferase (SEQ ID NO:2).

Figure 3 is a sequence of a nucleic acid that encodes a Brucella abortus DNA methyltransferase (SEQ ID NO-.3). The start codon is boxed and the stop codon is circled.

Figure 4 is a peptide sequence of a Brucella abortus DNA methyltransferase (SEQ ID NO:4).

Figure 5 is a partial sequence of a nucleic acid that encodes an Agrobacterium tumefaciens DNA methyltransferase (SEQ ID NO:5).

Figure 6 is a partial peptide sequence of an Agrobacterium tumefaciens DNA methyltransferase (SEQ ID NO:6).

Figure 7 is a complete sequence of a nucleic acid that encodes a Helicobacter pylori DNA methyltransferase (SEQ ID NO:7).

Figure 8 is a complete peptide sequence of a Helicobacter pylori DNA methyltransferase (SEQ ID NO:8).

LIST OF TABLES

Table 1 is a comparison of the sequences of Caulobacter crescentus ("Ccr"), Rhizobium meliloti ("Rme"), Agrobacterium tumefac/ens_i"Atu"), Brucella abortus ("Bab"), and Helicobacter pylori ("Hpy") DNA adenine methyltransferases.

DETAILED DESCRIPTION OF THE INVENTION A. Definitions

The term "biological activity" in the context of DNA methyltransferase refers to the capacity of the enzyme to act as a methyltransferase as defined herein.

The term "methyltransferase" denotes an enzyme that transfers a methyl group from a methyl donor to a specific site on a nucleic acid substrate, wherein the specific site is preferably a specific base in a characteristic sequence present in the nucleic acid substrate.

The term "processive" methyltransferase signifies that, under the assay conditions used, whenever there is more than one potential methylation site on a DNA substrate, after methylating a first site the methyltransferase methylates the second or subsequent sites without dissociating from the DNA substrate.

The term "DNA-dependent" signifies that the methyltransferase tends to lose activity in solution in the absence of a DNA substrate.

The term "nucleic acid" refers to deoxyribonucleotides or ribonucleotides and polymers thereof in either single- or double-stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural nucleotides which have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g. degenerate codon substitutions) and complementary sequences and as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res. 79:5081 (1991 ); Ohtsuka et al., ). Biol. C/τem. 260:2605-2608 (1985); and Cassol et al., 1992; Rossolini et a/., Mol. Cell. Probes 8:91 -98 (1994)). The term nucleic acid is used interchangeably with gene, cDNA, and mRNA encoded by a gene.

The phrase "exogenous" or "heterologous nucleic acid" generally denotes a nucleic acid that has been isolated, cloned and ligated to a nucleic acid with which it is not combined in nature, and/or introduced into and/or expressed in a cell or cellular environment other than the cell or cellular environment in which

said nucleic acid or protein may typically be found in nature. The term encompasses both nucleic acids originally obtained from a different organism or cell type than the cell type in which it is expressed, and also nucleic acids that are obtained from the same cell line as the cell line in which it is expressed.

"Nucleic acid probes" may be DNA or RNA fragments. DNA fragments can be prepared, for example, by digesting plasmid DNA, or by use of PCR, or synthesized by either the phosphoramidite method described by Beaucage and Carruthers, Tetrahedron Lett. 22:1859-1862 (1981 ), or by the tπester method according to Matteucci, et al., }. Am. Chem. Soc , 103:31 85 (1981 ), both incorporated herein by reference. A double stranded fragment may then be obtained, if desired, by annealing the chemically synthesized single strands together under appropriate conditions or by synthesizing the complementary strand using DNA polymerase with an appropriate primer sequence. Where a specific sequence for a nucleic acid probe is given, it is understood that the complementary strand is also identified and included. The complementary strand will work equally well in situations where the target is a double-stranded nucleic acid.

The phrase "selectively hybridizing to" refers to a nucleic acid probe that hybridizes, duplexes or binds only to a particular target DNA or RNA sequence when the target sequences are present in a preparation of total cellular DNA or RNA. "Complementary" or "target" nucleic acid sequences refer to those nucleic acid sequences which selectively hybridize to a nucleic acid probe. Proper annealing conditions depend, for example, upon a probe's length, base composition, and the number of mismatches and their position on the probe, and must often be determined empirically. For discussions of nucleic acid probe design and annealing conditions, see, for example, Sambrook et al., Molecular Cloning. A Laboratory Manual (2nd ed.), Vols. 1 -3, Cold Spring Harbor Laboratory (19,89), or Current Protocols in Molecular Biology, F. Ausubel et a/ , ed. Greene Publishing and Wiley- Interscience, New York (1987).

The phrase "a nucleic acid sequence encoding" refers to a nucleic acid which contains sequence information for a structural RNA such as rRNA, a tRNA, or the primary ammo acid sequence of a specific protein or peptide, or a binding site for a trans-acting regulatory agent. This phrase specifically encompasses degenerate codons (/ e., different codons which encode a single ammo acid) of the native

sequence or sequences which may be introduced to conform with codon preference in a specific host cell.

"Nucleic acid probes" may be DNA or RNA fragments. DNA fragments can be prepared, for example, by digesting plasmid DNA, or by use of PCR, or synthesized by either the phosphoramidite method described by Beaucage and Carruthers, Tetrahedron Lett. 22: 1859-1862 (1981 ), or by the tπester method according to Matteucci, et al., ). Am Chem Soc, 103:3185 (1981 ), both incorporated herein by reference. A double stranded fragment may then be obtained, if desired, by annealing the chemically synthesized single strands together under appropriate conditions or by synthesizing the complementary strand using DNA polymerase with an appropriate primer sequence. Where a specific sequence for a nucleic acid probe is given, it is understood that the complementary strand is also identified and included. The complementary strand will work equally well in situations where the target is a double-stranded nucleic acid.

The phrase "selectively hybridizing to" refers to a nucleic acid probe that hybridizes, duplexes or binds only to a particular target DNA or RNA sequence when the target sequences are present in a preparation of total cellular DNA or RNA. "Complementary" or "target" nucleic acid sequences refer to those nucleic acid sequences which selectively hybridize to a nucleic acid probe. Proper annealing conditions depend, for example, upon a probe's length, base composition, and the number of mismatches and their position on the probe, and must often be determined empirically. For discussions of nucleic acid probe design and annealing conditions, see, for example, Sambrook et al., Molecular Cloning: A Laboratory Manual (2nd ed.), Vols. 1-3, Cold Spring Harbor Laboratory (1989), or Current Protocols in Molecular Biology, F. Ausubel et al., ed. Greene Publishing and Wiley- Interscience, New York (1987).

The term "isolated", when applied to a nucleic acid or protein, denotes that the nucleic acid or protein is essentially free of other cellular components with which it is associated in the natural state. It is preferably in a homogeneous state although it can be in either a dry or aqueous solution. Purity and homogeneity are typically determined using analytical chemistry techniques such as polyacrylamide gel electrophoresis or high performance liquid chromatography. A protein which is the predominant species present in a preparation is substantially purified. In

particular, an isolated DNA methyltransferase gene is separated from open reading frames which naturally flank the gene and encode a protein other than methyltransferase. The term "purified" denotes that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel. Particularly, it means that the nucleic acid or protein is at least 85% pure, more preferably at least 95% pure, and most preferably at least 99% pure

The term "recomb ant" or "engineered" when used with reference to a nucleic acid or a protein generally denotes that the composition or primary sequence of said nucleic acid or protein has been altered from the naturallv occurring sequence using experimental manipulations well known to those skilled in the art. It may also denote that a nucleic acid or protein has been isolated and cloned into a vector or a nucleic acid that has been introduced into or expressed in a cell or cellular environment, particularly in a cell or cellular environment other than the cell or cellular environment in which said nucleic acid or protein may be found in nature.

The term "recombmant" or "engineered" when used with reference to a cell indicates that the cell replicates or expresses a nucleic acid, or produces a peptide or protein encoded by a nucleic acid, whose origin is exogenous to the cell. Recombmant cells can express nucleic acids that are not found within the native (noπrecombinant) form of the cell Recombmant cells can also express nucleic acids found in the native form of the cell wherein the nucleic acids are re-introduced into the cell by artificial means.

The following terms are used to describe the sequence relationships between two or more nucleic acids or polynucleotides: "reference sequence", "comparison window", "sequence identity", "percentage of sequence identity", and "substantial identity". A "reference sequence" is a defined sequence used as a basis for a sequence comparison; a reference sequence may be a subset of a larger sequence, for example, as a segment of a full-length cDNA or gene sequence given in a sequence listing, such as the nucleic acid sequence of SEQ ID NO: 1 , 3, 5, or 7, or may comprise a complete cDNA or gene sequence.

Optimal alignment of sequences for aligning a comparison window may be conducted by the local homology algorithm of Smith and Waterman (1981 ) Adv Appl Math 2-482, by the homology alignment algorithm of Needleman and

Wunsch (1970) /. Mol. Biol 48:443, by the search for similarity method of Pearson and Lipman (1988) Proc Natl. Acad Sci (USA) 85-2444, or by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package Release 7 0, Genetics Computer Group, 575 Science Dr., Madison, Wl).

The terms "substantial identity" or "substantial sequence identity", as applied to nucleic acid sequences and as used herein, denote a characteristic of a polynucleotide sequence, wherein the polynucleotide comprises a sequence that has at least 85 percent sequence identity, preferably at least 90 to 95 percent sequence identity, and more preferably at least 99 percent sequence identity as compared to a reference sequence over a comparison window of at least 20 nucleotide positions, frequently over a window of at least 25-50 nucleotides, wherein the percentage of sequence identity is calculated by comparing the reference sequence to the polynucleotide sequence which may include deletions or additions which total 20 percent or less of the reference sequence over the window of comparison. The reference sequence may be a subset of a larger sequence.

As applied to polypeptides, the terms "substantial identity" or "substantial sequence identity" mean that two peptide sequences, when optimally aligned, such as by the programs GAP or BESTFIT using default gap weights, share at least 70 percent sequence identity, preferably at least 80 percent sequence identity, more preferably at least 90 percent sequence identity, and most preferably at least 95 percent ammo acid identity or more. "Percentage ammo acid identity" or "percentage ammo acid sequence identity" refers to a comparison of the ammo acids of two polypeptides which, when optimally aligned, have approximately the designated percentage of the same ammo acids. For example, "95% ammo acid identity" refers to a comparison of the ammo acids of two polypeptides which when optimally aligned have 95% ammo acid identity. Preferably, residue positions which are not identical differ by conservative ammo acid substitutions. For example, the substitution of ammo acids having similar chemical properties such as charge or polarity are not likely to effect the properties of a protein Examples include giutamine for asparagine or glutamic acid for aspartic acid.

The term "substantially identical" in the context of two reaction mixtures refers to reaction mixtures that are considered by those of skill to be

sufficiently similar that scientifically valid comparisons can be made between them so as to compare relative activity due to the presence or absence of an inhibitor molecule.

A cell has been "transformed" by an exogenous nucleic acid when such exogenous nucleic acid has been introduced inside the cell membrane. Exogenous DNA may or may not be integrated (covalently linked) into chromosomal DNA making up the genome of the cell. The exogenous DNA may be maintained on an episomal element, such as a plasmid. A stably transformed or transfected eukaryotic cell is generally one in which the exogenous DNA has become integrated into the chromosome so that it is inherited by daughter cells through chromosome replication, or one which includes stably maintained extrachromosomal plasmids. This stability is demonstrated by the ability of the eukaryotic cell to establish cell lines or clones comprised of a population of daughter cells containing the exogenous DNA.

"Adenine methyltransferase substrate" refers to a nucleic acid that is acted upon by a DNA methyltransferase to undergo a methylation at an adenine residue. The optimum substrate contains at least one GANTC site and is preferably of a length that promotes ease of manipulation and yields easily resolvable methylation and/or restriction products, preferably a 45 base pair or longer oligonucleotide or plasmid.

The phrase "an essential adenine DNA methyltransferase" indicates that, in the absence of this enzyme activity at the appropriate stage in the cell cycle, organisms that normally express adenine DNA methyltransferase at that stage will die. Enzyme activity may be impaired by a mutation in the enzyme, by the use of antisense nucleic acid, by intracellular proteolysis of the enzyme, or by the administration of an inhibitor of the enzyme.

"Restriction" denotes the action of hydrolyzing a single or double stranded nucleic acid at a specific sequence or site. "Restriction enzyme" is a nuclease that recognizes a specific sequence or site of a nucleic acid, and cleaves the nucleic acid at that site. "Restriction site" is the particular sequence or site recognized and hydrolyzed by a restriction enzyme.

The phrase "specifically binds to an antibody" or "specifically immunoreactive with", when referring to a protein or peptide, refers to a binding

reaction which is determinative of the presence of the protein in the presence of a heterogeneous population oi proteins and other biologies. Thus, under designated immunoassay conditions, the specified antibodies bind to a particular protein and do not bind in a significant amount to other proteins present in the sample. Specific binding to an antibody under such conditions may require an antibody that is selected for its specificity for a particular protein. For example, antibodies raised to adenine methyltransferase with the amino acid sequence depicted in SEQ ID NO: 2, 4, 6, or 8 can be selected to obtain antibodies specifically immunoreactive with that adenine methyltransferase and not with other proteins. A variety of immunoassay formats may be used to select antibodies specifically immunoreactive with a particular protein. For example, solid-phase ELISA immunoassays are routinely used to select monoclonal antibodies specifically immunoreactive with a protein. See Harlow and Lane (1988) Antibodies, A Laboratory Manual, Cold Spring Harbor Publications, New York, for a description of immunoassay formats and conditions that can be used to determine specific immunoreactivity.

B. General Background

This invention relates to isolated nucleic acid sequences encoding DNA adenine methyltransferases. DNA methyltransferases are present in gram-negative bacteria such as the free living bacteria Caulobacter, the agriculturally important nitrogen-fixing bacterium Rhizobium and the highly infectious animal pathogen Brucella. The precise sequences and properties of these methyltransferase genes and enzymes are unknown. Prior to the work summarized herein, it was not clear whether the methyltransferases of other organisms would have homologous sequences and properties.

The procedure for obtaining methyltransferase genes from selected organisms generally involves constructing or obtaining gene libraries from selected organisms, detecting and isolating the desired gene, cloning it, and expressing it in a suitable bacterial strain or transformed cell line.

The nucleic acid compositions of this invention, whether RNA, cDNA, genomic DNA, or a hybrid of the various combinations, may be isolated from natural sources or may be synthesized in vitro. The nucleic acids claimed may be present in

transformed or transfected whole cells, in a transformed or transfected cell lysate, or in a partially purified or substantially pure form.

Techniques for nucleic acid manipulation of genes encoding the DNA adenine methyltransferases such as generating libraries, subclonmg into expression vectors, labeling probes, DNA hybridization, and the like are described generally in Sambrook, et a/., Molecular Cloning - A Laboratory Manual (2nd Ed.), Vol. 1-3, Cold Spring Harbor Laboratory, Cold Spring Harbor, New York, 1989, which is incorporated herein by reference. This manual is hereinafter referred to as "Sambrook, et al."

Nucleic acids and proteins are detected and quantified herein by any of a number of means known to those of skill in the art. These include analytical biochemical methods such as spectrophotometry, radiography, electrophoresis, capillary electrophoresis, high performance liquid chromatography (HPLC), thin layer chromatography (TLC), hyperdiffusion chromatography, and the like, and various immunological methods such as fluid or gel precipitin reactions, immunodiffusion (single or double), immunoelectrophoresis, radioimmunoassays (RIAs), enzyme-linked immunosorbent assays (ELISAs), immunofluorescent assays, and the like. The detection of nucleic acids proceeds by well known methods such as Southern analysis, northern analysis, gel electrophoresis, PCR, radiolabeling, scintillation counting, and affinity chromatography.

1. Isolation of nucleic acids encoding DNA adenine methyltransferases

There are various methods of isolating the DNA sequences encoding DNA adenine methyltransferases. For example, DNA is isolated from a genomic or cDNA library using labelled oligonucleotide probes (e.g., probes having sequences complementary to the sequences disclosed herein, such as SEQJD NO: 1 , 3, 5, 7, 9- 1 1). The libraries are generated from DNA and mRNA from cultures of bacteria that are generated from stock cultures. Stock cultures are commercially available from a variety of sources including international depositories such as the American Type Culture Collection.

The probes for surveying the libraries can be used directly in hybridization assays to isolate DNA encoding DNA adenine methyltransferases. Alternatively, probes can be designed for use in amplification techniques such as

PCR, and DNA encoding DNA adenine methyltransferases may be isolated by using methods such as PCR (see below).

Methods for making and screening DNA libraries are well established. See Gubler, U. and Hoffman, B.J. Gene 25:263-269, 1 983 and Sambrook, et al. To prepare a genomic library, the DNA is generally extracted from cells and either mechanically sheared or enzymatically digested to yield fragments of about 12-20 kb. The fragments are then separated by gradient centrifugation from undesired sizes and are subcloned in bacteriophage lambda vectors. These vectors and phage are packaged in vitro, as described in Sambrook, et al. The vector is transformed into a recombinant host for propagation, screening and cloning. Recombinant phage are analyzed by plaque hybridization as described in Benton and Davis, Science, 196:180-182 (1977). Colony hybridization is carried out as generally described in M. Grunstein et al. Proc. Natl. Acad. Sci. USA., 72:3961-3965 (1975).

DNA encoding a DNA adenine methyltransferase is identified in either cDNA or genomic libraries by its ability to hybridize with nucleic acid probes, for example on Southern blots, and these DNA regions are isolated by standard methods familiar to those of skill in the art. See Sambrook, et al. The nucleic acid sequences of the invention are typically identical to or show substantial sequence identity (determined as described below) to the nucleic acid sequence of SEQ ID. No. 1 , 3, 5, or 7. Nucleic acids encoding DNA adenine methyltransferases will typically hybridize to the nucleic acid sequence of SEQ ID NO: 1 , 3, 5, or 7 under stringent conditions. For example, nucleic acids encoding DNA adenine methyltransferases will hybridize to the nucleic acid of sequence ID No. 1 under the hybridization and wash conditions of 50% formamide at 42°C. Other stringent hybridization conditions may also be selected. Generally, stringent conditions are selected to be about 5°C lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength and pH. The Tm is the temperature (under defined ionic strength and pH) at which 50% of the target sequence hybridizes to a perfectly matched probe. Typically, stringent conditions will be those in which the salt concentration is at least about 0.02 molar at pH 7 and the temperature is at least about 60°C. As other factors may significantly affect the stringency of hybridization, including, among others, base composition and size of the complementary strands,

the presence of organic solvents and the extent of base mismatching, the combination of parameters is more important than the absolute measure of any one.

Various methods of amplifying target sequences, such as the polymerase chain reaction, can also be used to prepare DNA encoding DNA adenine methyltransferase. Polymerase chain reaction (PCR) technology is used to amplify such nucleic acid sequences. The isolated sequences encoding DNA adenine methyltransferase may also be used as templates for PCR amplification.

In PCR techniques, oligonucleotide primers complementary to the two 3' borders of the DNA region to be amplified are synthesized. The polymerase chain reaction is then carried out using the two primers. See PCR Protocols: A Guide to Methods and Applications. (Innis, M, Gelfand, D., Snmsky, J. and White, T., eds.), Academic Press, San Diego (1990). Primers can be selected to amplify the entire regions encoding a full-length DNA adenine methyltransferase or to amplify smaller DNA segments as desired.

PCR can be used in a variety of protocols to isolate nucleic acids encoding the DNA adenine methyltransferases. In these protocols, appropriate primers and probes for amplifying DNA encoding DNA adenine methyltransferases are generated from analysis of the DNA sequences listed herein. For example, the oligonucleotides of SEQ ID Nos. 9-1 1 can be used in a PCR protocol as described in example 1 herein to amplify regions of DNA's encoding methyl transferase proteins. Once such regions are PCR-amplified, they can be sequenced and oligonucleotide probes can be prepared from sequence obtained. These probes can then be used to isolate DNA's encoding DNA adenine methyltransferases, similar to the procedure used in examples 1-4 herein. DNA adenine methyltransferases can be isolated from a variety of different cellular sources using this procedure. Other oligonucleotide probes in addition to those of SEQ ID NO: 1 , 3, 5, 7 can also be. used in PCR protocols to isolate cDNAs encoding the DNA adenine methyltransferases. Such probes are subsequences of the full-length coding sequences and can be from 20 bases to full length and preferably 30-50 bases in length.

Oligonucleotides for use as probes are chemically synthesized according to the solid phase phosphoramidite tπester method first described by Beaucage, S.L. and Carruthers, M.H., 1981 , Tetrahedron Lett, 22(20):1859-1862 using an automated synthesizer, as described in Needham-VanDevanter, D.R., et a/.,

1984, Nucleic Acids Res., 12:6159-6168. Purification of oligonucleotides is by either native acrylamide gel electrophoresis or by anion-exchange HPLC as described in Pearson, J.D. and Regnier, F.E., 1983, / Chrom., 255: 137-149. The sequence of the synthetic oligonucleotide can be verified using the chemical degradation method of Maxam, A.M. and Gilbert, W. 1980, in Grossman, L. and Moldave, D., eds. Academic Press, New York, Methods in Enzymology, 65:499-560.

Other methods known to those of skill in the art may also be used to isolate DNA encoding the DNA adenine methyltransferase. See Sambrook, et al. for a description of other techniques for the isolation of DNA encoding specific protein molecules.

2. Expression of methyltransferase

Once DNA encoding DNA adenine methyltransferases is isolated and cloned, one can express the DNA adenine methyltransferases in a variety of recombinantly engineered cells to ascertain that the isolated gene indeed encodes the desired methyltransferase. The expression of natural or synthetic nucleic acids is typically achieved by operably linking a nucleic acid of interest to a promoter (which is either constitutive or inducible), incorporating the construct into an expression vector, and introducing the vector into a suitable host cell. Typical vectors contain transcription and translation terminators, transcription and translation initiation sequences, and promoters useful for regulation of the expression of the particular nucleic acid. The vectors optionally comprise generic expression cassettes containing at least one independent terminator sequence, sequences permitting replication of the cassette in eukaryotes, or prokaryotes, or both (e.g., shuttle vectors), and selection markers for both prokaryotic and eukaryotic systems. Vectors are suitable for replication and integration in prokaryotes, eukaryote ^ or preferably both. See, Gilimaπ and Smith (1979), Gene, 8:81-97; Roberts et al. (1987), Nature, 328:731-734; Berger and Kimmel, Guide to Molecular Cloning Techniques, Methods in Enzymology, volume 152, Academic Press, Inc., San Diego, CA (Berger); Sambrook et al. (1989), MOLECULAR CLONING - A LABORATORY MANUAL (2nd ed.) Vol. 1 -3, Cold Spring Harbor Laboratory, Cold Spring Harbor Press, N.Y., (Sambrook); and F.M. Ausubel et a/., CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, eds., Current Protocols, a joint venture between Greene Publishing Associates, Inc. and John Wiley

& Sons, Inc., (1994 Supplement) (Ausubel). Product information from manufacturers of biological reagents and experimental equipment also provide information useful in known biological methods. Such manufacturers include the SIGMA chemical company (Saint Louis, MO), R&D systems (Minneapolis, MN), Pharmacia LKB Biotechnology (Piscataway, NJ), CLONTECH Laboratories, Inc. (Palo Alto, CA), Chem Genes Corp., Aldrich Chemical Company (Milwaukee, Wl), Glen Research, Inc., GIBCO BRL Life Technologies, Inc. (Gaithersberg, MD), Fluka Chemica-Biochemika Analytika (Fluka Chemie AG, Buchs, Switzerland), and Applied Biosystems (Foster City, CA), as well as many other commercial sources known to one of skill in the art.

The nucleic acids (e.g., promoters and vectors) used in the present method can be isolated from natural sources, obtained from such sources as ATCC or GenBank libraries, or prepared by synthetic methods. Synthetic nucleic acids can be prepared by a variety of solution or solid phase methods. Detailed descriptions of the procedures for solid phase synthesis of nucleic acids by phosphite-triester, phosphotriester, and H-phosphonate chemistries are widely available. See, for example, Itakura, U.S. Pat. No. 4,401 ,796; Caruthers, et a/., U.S. Pat. Nos. 4,458,066 and 4,500,707; Beaucage, et a/., (1981) Tetrahedron Lett, 22:1859-1862; Matteucci, (1981 ) et al., ). Am. Chem. Soc, 103:3185-3191 ; Caruthers, et a/., (1982) Genetic Engineering, 4: 1-1 7; Jones, chapter 2, Atkinson, et al., chapter 3, and Sproat, et al., chapter 4, in Oligonucleotide Synthesis: A Practical Approach, Gait (ed.), IRL Press, Washington D.C. (1984); Froehler, et al., (1986) Tetrahedron Lett, 27:469-472; Froehler, et al., (1986) Nucleic Acids Res., 14:5399-5407; Sinha, et al. (1983) Tetrahedron Lett, 24:5843-5846; and Sinha, et al., (1984) Nud. Acids Res., 12:4539- 4557, which are incorporated herein by reference.

a. In vitro gene transfer

It is expected that those of skill in the art are knowledgeable in the numerous expression systems available for expression of DNA encoding DNA adenine methyltransferases. No attempt to describe in detail the various methods known for the expression of proteins in prokaryotes or eukaryotes is made here.

There are several well established methods of introducing nucleic acids into bacterial and animal cells, any of which may be used in the present invention. These include: calcium phosphate precipitation, fusion of the recipient cells with

bacterial protoplasts containing the DNA, treatment of the recipient cells with liposomes containing the DNA, DEAE dextran, receptor-mediated endocytosis, electroporation, micro-injection of the DNA directly into the cells, infection with viral vectors, etc.

For in vitro applications, the delivery of nucleic acids can be to any cell grown in culture, whether of bacterial, plant or animal origin, vertebrate or invertebrate, and of any tissue or type. Contact between the cells and the genetically engineered nucleic acid constructs, when carried out in vitro, takes place in a biologically compatible medium The concentration of nucleic acid varies widely depending on the particular application, but is generally between about 1 μmol and about 10 mmol. Treatment of the cells with the nucleic acid is generally carried out at physiological temperatures (about 37° C) for about 1 to about 48 hours, preferably about 2 to 4 hours.

In one group of embodiments, a nucleic acid is added to 60-80% confluent plated cells having a cell density of about 10 3 to about 10 5 cells/mL, more preferably about 2 x 10 4 cells/mL. The concentration of the suspension added to the cells is preferably from about 0.01 to 0.2 μgJml, more preferably about 0.1 g/mL.

b. Cells to be transformed

The compositions and methods of the present invention are used to transfer genes into a wide variety of cell types, in vivo and in vitro. Although any prokaryotic or eukaryotic cells may be used, prokaryotic cells such as E coli are preferred.

c. Detection of methyltransferase-encoding nucleic acids

The present invention provides methods for detecting DNA or RNA encoding DNA adenine methyltransferases. A variety of methods for specific DNA and RNA measurement using nucleic acid hybridization techniques are known to those of skill in the art. See Sambrook, et a/.; NUCLEIC ACID HYBRIDIZATION, A PRACTICAL APPROACH, Ed. Hames, B.D. and Higgins, S.J., IRL Press, 1985; Gall and Pardue (1969), Proc. Natl. Acad. Sci., U.S.A., 63:378-383; and John et al (1969) Nature, 223:582-587 The selection of a hybridization format is not critical.

For example, one method for evaluating the presence or absence of DNA encoding DNA adenine methyltransferases in a sample involves a Southern transfer. Briefly, the digested genomic DNA is run on agarose slab gels in buffer and transferred to membranes. Hybridization is carried out using the nucleic acid probes discussed above. As described above, nucleic acid probes are designed based on the nucleic acid sequences encoding methyltransferases (See SEQ ID NOs: 1 , 3, 5, 7.) The probes can be full length or less than the full length of the nucleic acid sequence encoding the methyltransferase. Shorter probes are empirically tested for specificity. Preferably nucleic acid probes are 20 bases or longer in length. (See Sambrook, et al. for methods of selecting nucleic acid probe sequences for use in nucleic acid hybridization.) Visualization of the hybridized portions allows the qualitative determination of the presence or absence of DNA encoding DNA adenine methyltransferases.

Similarly, a Northern transfer may be used for the detection of mRNA encoding DNA adenine methyltransferases. In brief, the mRNA is isolated from a given cell sample using an acid guanidinium-phenol-chloroform extraction method. The mRNA is then electrophoresed to separate the mRNA species and the mRNA is transferred from the gel to a nitrocellulose membrane. As with the Southern blots, labeled probes are used to identify the presence or absence of DNA adenine methyltransferases.

Sandwich assays are commercially useful hybridization assays for detecting or isolating nucleic acid sequences. Such assays utilize a "capture" nucleic acid covalently immobilized to a solid support and a labelled "signal" nucleic acid in solution. The clinical sample will provide the target nucleic acid. The "capture" nucleic acid and "signal" nucleic acid probe hybridize with the target nucleic acid to form a "sandwich" hybridization complex. To be effective, the signal nucleic acid cannot hybridize with the capture nucleic acid.

Typically, labelled signal nucleic acids are used to detect hybridization. Complementary nucleic acids or signal nucleic acids may be labelled by any one of several methods typically used to detect the presence of hybridized polynucieotides. The most common method of detection is the use of autoradiography with 3 H, 125 l, 35 S, 1 C, or 2 P-labelled probes or the like. Other labels include ligands which bind

to labelled antibodies, fluorophores, chemiluminescent agents, enzymes, and antibodies which can serve as specific binding pair members for a labelled ligand.

Detection of a hybridization complex may require the binding of a signal generating complex to a duplex of target and probe polynucleotides or nucleic acids. Typically, such binding occurs through ligand and anti-ligand interactions as between a ligand-conjugated probe and an anti-ligand conjugated with a signal.

The label may also allow indirect detection of the hybridization complex. For example, where the label is a hapten or antigen, the sample can be detected by using antibodies. In these systems, a signal is generated by attaching fluorescent or enzyme molecules to the antibodies or, in some cases, by attachment to a radioactive label. (Tijssen, P., "Practice and Theory of Enzyme Immunoassays," Laboratory Techniques in Biochemistry and Molecular Biology, Burdon, R.H., van Knippenberg, P.H., Eds., Elsevier (1985), pp. 9-20.)

The sensitivity of the hybridization assays may be enhanced through use of a nucleic acid amplification system which multiplies the target nucleic acid being detected. In vitro amplification techniques suitable for amplifying sequences for use as molecular probes or for generating nucleic acid fragments for subsequent subcloning are known. Examples of techniques sufficient to direct persons of skill through such in vitro amplification methods, including the polymerase chain reaction (PCR), the ligase chain reaction (LCR), OjS-replicase amplification and other RNA polymerase mediated techniques (e.g., NASBA), are found in Berger, Sambrook, and Ausubel, as well as Mullis et al. (1987), U.S. Patent No. 4,683,202; PCR Protocols A Guide to Methods and Applications (Innis et al. eds) Academic Press Inc. San Diego, CA (1990) (Innis); Arnheim & Levinson (October 1 , 1990), C&EN 36-47; The journal Of NIH Research (1991 ), 3: 81-94; (Kwoh et al. (1989), Proc. Natl. Acad. Sci. USA, 86:1 1 73; Guatelli et a/. (1990), Proc. Natl. Acad. Sci. USA, 87:1_874; Lomell et al. (1989), ). Clin. Chem., 35:1826; Landegren et al. (1988), Science, 241 :1077-1080; Van Brunt (1990), Biotechnology, 8:291-294; Wu and Wallace (1989), Gene, 4:560; Barringer et al. (1990), Gene, 89:1 1 7, and Sooknanan and Malek (1995), Biotechnology, 13:563-564. Improved methods of cloning in vitro amplified nucleic acids are described in Wallace et al., U.S. Pat. No. 5,426,039. Other methods recently described in the art are the nucleic acid sequence based amplification (NASBA™, Cangene, Mississaυga, Ontario) and Q Beta Replicase systems. These

systems can be used to directly identify mutants where the PCR or LCR primers are designed to be extended or ligated only when a select sequence is present. Alternatively, the select sequences can be generally amplified using, for example, nonspecific PCR primers and the amplified target region later probed for a specific sequence indicative of a mutation.

Oligonucleotides for use as probes, e.g., in in vitro amplification methods, for use as gene probes, or as inhibitor components are typically synthesized chemically according to the solid phase phosphoramidite tπester method described by Beaucage and Caruthers (1981 ), Tetrahedron Letts., 22(20):1859-1862, e.g., using an automated synthesizer, as described in Needham-Van Devanter et a/. (1984), Nucleic Acids Res., 12:6159-6168. Purification of oligonucleotides, where necessary, is typically performed by either native acrylamide gel electrophoresis or by anion-exchange HPLC as described in Pearson and Regnier (1983), /. Chrom., 255:137-149. The sequence of the synthetic oligonucleotides can be verified using the chemical degradation method of Maxam and Gilbert (1980) in Grossman and Moldave (eds.) Academic Press, New York, Methods in Enzymology, 65:499-560.

An alternative means for determining the level of expression of a gene encoding an DNA adenine methyltransferase is in situ hybridization. In situ hybridization assays are well known and are generally described in Angerer, et al., Methods Enzymoi, 152:649-660 (1987). In an in situ hybridization assay, cells are fixed to a solid support, typically a glass slide. If DNA is to be probed, the cells are denatured with heat or alkali. The cells are then contacted with a hybridization solution at a moderate temperature to permit annealing of labeled probes specific to DNA adenine methyltransferases. The probes are preferably labeled with radioisotopes or fluorescent reporters.

d. Detection of methyltransferase gene products

Methyltransferase may be detected or quantified by a variety of methods. Preferred methods involve the use of specific antibodies.

Methods of producing polyclonal and monoclonal antibodies are known to those of skill in the art. See, e.g., Coligan (1991), CURRENT PROTOCOLS IN IMMUNOLOGY, Wiley/Greene, NY; and Harlow and Lane (1989), ANTIBODIES: A LABORATORY MANUAL, Cold Spring Harbor Press, NY; Stites et al. (eds.) BASIC AND

CLINICAL IMMUNOLOGY (4th ed.) Lange Medical Publications, Los Altos, CA, and references cited therein; Goding (1 986), MONOCLONAL ANTIBODIES: PRINCIPLES AND PRACTICE (2d ed.) Academic Press, New York, NY; and Kohler and Milstein (1975), Nature, 256:495-497. Such techniques include antibody preparation by selection of antibodies from libraries of recombinant antibodies in phage or similar vectors. See, Huse et al. (1989), Science, 246: 1275-1281 ; and Ward et al. (1989), Nature, 341 :544-546. For example, in order to produce antisera for use in an immunoassay, the polypeptide of SEQ ID NO: 2, 4, 6, or 8, or a fragment thereof, is isolated as described herein. For example, recombinant protein is produced in a transformed cell line. An inbred strain of mice or rabbits is immunized with the protein of SEQ ID No. 2, 4, 6, or 8, or a fragment thereof, using a standard adjuvant, such as Freund's adjuvant, and a standard immunization protocol. Alternatively, a synthetic peptide derived from the sequences disclosed herein and conjugated to a carrier protein can be used as an immunogen. Polyclonal sera are collected and titered against the immunogen protein in an immunoassay, for example, a solid phase immunoassay with the immunogen immobilized on a solid support. Polyclonal antisera with a titer of 10 4 or greater are selected and tested for their cross reactivity against non-adenine methyltransferases or even other adenine methyltransferases, using a competitive binding immunoassay. Specific monoclonal and polyclonal antibodies and antisera will usually bind with a K D of at least about .1 mM, more usually at least about 1 μM, preferably at least about .1 μM or better, and most preferably, .01 μM or better.

A number of immunogens may be used to produce antibodies specifically reactive with DNA adenine methyltransferases. Recombinant protein is the preferred immunogen for the production of monoclonal or polyclonal antibodies. Naturally occurring protein may also be used either in pure or Impure form. Synthetic peptides made using the DNA adenine methyltransferase sequences described herein may also used as an immunogen for the production of antibodies to the protein. Recombinant protein can be expressed in eukaryotic or prokaryotic cells as described above, and purified as generally described above. The product is then injected into an animal capable of producing antibodies. Either monoclonal or polyclonal antibodies may be generated, for subsequent use in immunoassays to measure the protein.

Methods of production of polyclonal antibodies are known to those of skill in the art. In brief, an immunogen, preferably a purified protein, is mixed with an adjuvant and animals are immunized. The animal's immune response to the immunogen preparation is monitored by taking test bleeds and determining the titer of reactivity to the DNA adenine methyltransferase. When appropriately high titers of antibody to the immunogen are obtained, blood is collected from the animal and antisera are prepared. Further fractionation of the antisera to enrich for antibodies reactive to the protein can be done if desired. (See Harlow and Lane, supra).

Monoclonal antibodies may be obtained by various techniques familiar to those skilled in the art. Briefly, spleen cells from an animal immunized with a desired antigen are immortalized, commonly by fusion with a myeloma cell (See, Kohler and Milstem, Eur j. Immunol 6:51 1-519 (1976), incorporated herein by reference). Alternative methods of immortalization include transformation with Epstein Barr Virus, oncogenes, or retroviruses, or other methods well known in the art. Colonies arising from single immortalized cells are screened for production of antibodies of the desired specificity and affinity for the antigen, and yield of the monoclonal antibodies produced by such cells may be enhanced by various techniques, including injection into the peritoneal cavity of a vertebrate host. Alternatively, one may isolate DNA sequences which encode a monoclonal antibody or a binding fragment thereof by screening a DNA library from human B cells according to the general protocol outlined by Huse, et a/. (1989) Science 246:1275- 1281 .

A particular protein can be measured by a variety of immunoassay methods. For a review of immunological and immunoassay procedures in general, see Basic and Clinical Immunology 7th Edition (D. Stites and A. Terr ed.) 1991. Moreover, the immunoassays of the present invention can be pe /ormed in any of several configurations, which are reviewed extensively in Enzyme Immunoassay, E.T. Maggio, ed., CRC Press, Boca Raton, Florida (1980); "Practice and Theory of Enzyme Immunoassays," P. Tijssen, Laboratory Techniques in Biochemistry and Molecular Biology, Elsevier Science Publishers B.V. Amsterdam (1985); and Harlow and Lane, Antibodies, A Laboratory Manual, supra, each of which is incorporated herein by reference.

Immunoassays to methyltransferases of the present invention may use a polyclonal antiserum which was raised to the protein of SEQ ID NO: 2, 4, 6, or 8, or a fragment thereof. This antiserum is selected to have low crossreactivity against other (non-methyltransferase or methyltransferase) proteins and any such crossreactivity is removed by immunoabsorbtion prior to use in the immunoassay.

In addition, it is possible to produce monospecific antibodies that react to specific DNA methyltransferases from specific species of bacteria as identified herein. Monospecific antibodies are achieved by appropriate cross-absorption with select DNA methyltransferases or by raising antibodies against species specific regions of the amino acid sequence of the transferases. Such unique peptide fragments are routinely identified by sequence comparisons.

In order to produce antisera for use in an immunoassay, the protein of SEQ ID NO: 2, 4, 6, or 8, or a fragment thereof, is isolated as described herein. For example, recombinant protein is produced in a transformed cell line. An inbred strain of mice such as balb/c is immunized with the protein of SEQ ID NO: 2 using a standard adjuvant, such as Freund's adjuvant, and a standard mouse immunization protocol. Alternatively, a synthetic peptide derived from the sequences disclosed herein and conjugated to a carrier protein can be used as an immunogen. Polyclonal sera are collected and titered against the immunogen protein in an immunoassay, for example, a solid phase immunoassay with the immunogen immobilized on a solid support. Polyclonal antisera with a titer of 10 4 or greater are selected and tested for their cross reactivity against non-adenine methyltransferases, using a competitive binding immunoassay such as the one described in Harlow and Lane, supra, at pages 570-573.

Immunoassays in the competitive binding format can be used for the crossreactivity determinations. For example, the protein of SEQJD NO: 2 can be immobilized to a solid support. Proteins (other methyltransferases, or non- methyltransferases) are added to the assay which compete with the binding of the antisera to the immobilized antigen. The ability of the above proteins to compete with the binding of the antisera to the immobilized protein is compared to the protein of SEQ ID NO: 2. The percent crossreactivity for the above proteins is calculated, using standard calculations. Those antisera with less than 10% crossreactivity with each of the proteins listed above are selected and pooled. The

cross-reacting antibodies are optionally removed from the pooled antisera by immunoabsorbtion with the above-listed proteins.

The immunoabsorbed and pooled antisera are then used in a competitive binding immunoassay as described above to compare a second protein to the immunogen protein, in this case, the adenine methyltransferase of SEQ ID NO: 2. In order to make this comparison, the two proteins are each assayed at a wide range of concentrations and the amount of each protein required to inhibit 50% of the binding of the antisera to the immobilized protein is determined. If the amount of the second protein required is less than 10 times the amount of the protein of SEQ ID NO: 2 that is required, then the second protein is said to specifically bind to an antibody generated to an immunogen consisting of the protein of SEQ ID NO: 2.

The presence of a desired polypeptide (including peptide, transcript, or enzymatic digestion product) in a sample may be detected and quantified using Western blot analysis. The technique generally comprises separating sample products by gel electrophoresis on the basis of molecular weight, transferring the separated proteins to a suitable solid support (such as a nitrocellulose filter, a nylon filter, or derivatized nylon filter), and incubating the sample with labeling antibodies that specifically bind to the analyte protein. The labeling antibodies specifically bind to analyte on the solid support. These antibodies are directly labeled, or alternatively are subsequently detected using labeling agents such as antibodies (e.g., labeled sheep anti-mouse antibodies where the antibody to an analyte is a murine antibody) that specifically bind to the labeling antibody.

3. Purification of DNA adenine methyltransferases

The polypeptides of this invention may be purified to substantial purity by standard techniques, including selective precipitation with su_ςh substances as ammonium sulfate, column chromatography, immunopurification methods, and others. See, for instance, R. Scopes, Protein Purification: Principles and Practice, Springer-Verlag: New York (1982), incorporated herein by reference. For example, the methyltransferase proteins and polypeptides produced by recombinant DNA technology may be purified by a combination of cell lysis (e.g., sonication) and affinity chromatography or immunoprecipitation with a specific antibody to methyltransferase. For fusion products, subsequent digestion of the fusion protein

with an appropriate proteolytic enzyme releases the desired polypeptide. The proteins may then be further purified by standard protein chemistry techniques. A specific protocol for purifying the methyltransferases of this invention is provided in Example 1 (e).

4. Screening for inhibitors of methyltransferase or associated gene expression

The methyltransferase genes identified herein provide novel targets for screening for agents that attenuate, inhibit, or interfere with the viability of the pathogens bearing with the gene. Inhibition (i.e. blocking) or complete elimination of the expression of the methyltransferase gene or genes described herein results in a mitigation or elimination of the ability of the subject bacteria to infect and/or grow and/or proliferate in an animal or plant host as compared to the same stain of bacteria (or virus) in which there is no inhibition or elimination of the virulence- related gene or gene product.

Having provided herein genes whose expression is required for viability of pathogenic bacteria, it is possible to screen for agents and/or for drugs that, by blocking the activity of the methyltransferase gene, mitigate the virulence of the target pathogen.

Antibiotics and other synthetic drugs targeted to specific proteins generally act by interacting with and inhibiting the activity of the target protein. The methyltransferase enzymatic activity assays provided herein are useful to identify inhibitors of that activity. To do so, the enzymes capacity to methylate a nucleic acid is assayed in the presence and absence of a test substance, such as a synthetic or isolated naturally occurring chemical inhibitor (in particular peptides or other ligands that bind to the active site or to allosteric sites of the methyltransferase enzyme). An inhibitor of the transferase depresses the activity of enzyme at least 50%, preferably at least 90%, and most preferably at least 99%.

The methyltransferase genes or gene product (i.e., mRNA) is preferably detected and/or quantified in a biological sample. As used herein, a biological sample is a sample of biological tissue or fluid that, in a healthy and/or pathological state, contains methyltransferase encoding nucleic acid or the polypeptide. Such samples include, but are not limited to, sputum, amniotic fluid, blood, blood cells

(e g , white cells), tissue or fine needle biopsy samples, urine, peritoneal fluid, and pleural fluid, or cells therefrom. For plants, root tissue or leaf tissue can be used. Biological samples may also include sections of tissues such as frozen sections taken for histological purposes.

The present invention encompasses developing antisense protocols, antibiotics and antagonists that specifically inhibit the methyltransferase activity of the identified enzymes or the expression of the genes of this invention. The detection and testing of such inhibitors is made possible by the ability to make and obtain the claimed enzyme using methods described herein.

Antisense agents are used to reduce or eliminate methyltransferase activity Antisense agents include fragments or the methyltransferase genes that are operably linked in reverse orientation to an efficient promoter. Also included in antisense agents are πbozymes such as the hairpin or hammerhead types. For antisense agents suitable assays involve detecting the presence, absence, or quantity or amount of transcript of the gene or gene product. Northern blots, quantitative PCR or immunoassays are all suitable for detection of the effectiveness of antisense agents.

In still another embodiment, bacterial reporter strains are used to evaluate candidate anti-transferase agents. In such assays, recombinant bacteria are modified to include a reporter gene attached to a nucleic acid encoding the methyltransferase gene. When the genes are expressed, the reporter gene is also expressed and provides a detectable signal indicating the expression of the gene. Anti-methyltransferase agent screens then involve contacting the reporter strains and/or cells, tissues, or organisms prior to or after infection with the reporter strains and subsequently detecting expression levels of the reporter gene.

In addition to screening for antisense agents, this invention provides for methods that facilitate the identification of non-antisense drug candidates especially under conditions of high throughput. The screening for such non-nucleic acid based inhibitory agents commonly involves contacting the target pathogen (e.g. Brucella abortus), and /or a tissue containing the pathogen, and/or an animal, with one or more candidate anti-methyltransferase agents and detecting the presence absence, quantity of the gene product. Alternatively, candidate anti-methyltransferase agents

can be identified simply by their ability to bind to the gene or gene product and inhibit its biological activity.

Methods for detecting the biological activity of the methyltransferases are provided herein and include reaction conditions and suitable substrates for methylation. These assays can be used to screen for anti-methyltransferase agents. Absence of the activity of the gene during and/or after contacting of the bacteria, a cell, a tissue, and/or an organism with an anti-transferase agent of interest will indicate that the particular test compound is a likely candidate for an antibiotic.

In view of the foregoing, preferred assays for detection anti- methyltransferase agents fall into the following categories: i) Detection of gene or gene-derived nucleic acid presence, absence, or quantity; ii) Screening for agents that bind to a gene or gene derived nucleic acid; iii) Detection of a virulence gene derived polypeptide; iv) Detection of binding of a prospective agent to gene derived polypeptides; v) Use of bacterial reporter strains; and, vi) Detection of the biological activity of the transferase gene.

5. High-Throughput Screening of Candidate Agents that Block Methyltransferase Activity.

Conventionally, new chemical entities with useful properties are generated by identifying a chemical compound (called a "lead compound") with some desirable property or activity, creating variants of the lead compound, and evaluating the property and activity of those variant compounds... However, the current trend is to shorten the time scale for all aspects of drug discovery. Because of the ability to test large numbers quickly and efficiently, high throughput screening (HTS) methods are replacing conventional lead compound identification methods.

In one preferred embodiment, high throughput screening methods involve providing a library containing a large number of potential therapeutic compounds (candidate compounds). Such "combinatorial chemical libraries" are then screened in one or more assays, as described herein, to identify those library

members (particular chemical species or subclasses) that display a desired characteristic activity. The compounds thus identified can serve as conventional "lead compounds" or can themselves be used as potential or actual therapeutics.

a. Combinatorial chemical libraries

Recently, attention has focused on the use of combinatorial chemical libraries to assist in the generation of new chemical compound leads. A combinatorial chemical library is a collection of diverse chemical compounds generated by either chemical synthesis or biological synthesis by combining a number of chemical "building blocks" such as reagents. For example, a linear combinatorial chemical library such as a polypeptide library is formed by combining a set of chemical building blocks called amino acids in every possible way for a given compound length {i.e., the number of amino acids in a polypeptide compound). Millions of chemical compounds can be synthesized through such combinatorial mixing of chemical building blocks. For example, one commentator has observed that the systematic, combinatorial mixing of 100 interchangeable chemical building blocks results in the theoretical synthesis of 100 million tetrameric compounds or 10 billion pentameric compounds (Gallop et a/. (1994) 37(9): 1233-1250).

Preparation and screening of combinatorial chemical libraries is well known to those of skill in the art. Such combinatorial chemical libraries include, but are not limited to, peptide libraries (see, e.g., U.S. Patent 5,010,1 75, Furka (1991 ) Int. J. Pept. Prot Res., 37: 487-493, Houghton et al. (1991 ) Nature, 354: 84-88). Peptide synthesis is by no means the only approach envisioned and intended for use with the present invention. Other chemistries for generating chemical diversity libraries can also be used. Such chemistries include, but are noLlimited to: peptoids (PCT Publication No WO 91/19735, 26 Dec. 1991 ), encoded peptides (PCT Publication WO 93/20242, 14 Oct. 1993), random bio-oligomers (PCT Publication WO 92/00091 , 9 Jan. 1992), benzodiazepines (U.S. Pat. No. 5,288,514), diversomers such as hydantoins, benzodiazepines and dipeptides (Hobbs et a/., (1993) Proc. Nat. Acad. Sci. USA 90: 6909-6913), vinylogous polypeptides (Hagihara et al. (1992) ;. Amer. Chem. Soc. 1 14: 6568), nonpeptidal peptidomimetics with a Beta- D- Glucose scaffolding (Hirschmann et al., (1992) /. Amer. Chem. Soc. 1 14: 921 7-9218),

analogous organic syntheses of small compound libraries (Chen et al. (1994) /. Amer. Chem. Soc. 1 16: 2661 ), oligocarbamates (Cho, et al., (1 993) Science 261 : 1 303), and/or peptidyl phosphonates (Campbell et al., (1994) /. Org. Chem. 59: 658). See, generally, Gordon et al., (1994) /. Med. Chem. 37: 1385, nucleic acid libraries, peptide nucleic acid libraries (see, e.g., U.S. Patent 5,539,083) antibody libraries (see, e.g., Vaughn et al. (1996) Nature Biotechnology, 14(3): 309-314), and PCT/US96/10287), carbohydrate libraries (see, e.g., Liang et al. (1996) Science, 274: 1 520-1 522, and U.S. Patent 5,593,853), and small organic molecule libraries (see, e.g. t benzodiazepines, Baum (1993) C&EN, Jan 18, page 33, isoprenoids U.S. Patent 5,569,588, thiazolidinones and metathiazanones U.S. Patent 5,549,974, pyrrolidines U.S. Patents 5,525,735 and 5,519,134, morpholino compounds U.S. Patent 5,506,337, benzodiazepines 5,288,514, and the like).

Devices for the preparation of combinatorial libraries are commercially available (see, e.g., 357 MPS, 390 MPS, Advanced Chem Tech, Louisville KY, Symphony, Rainin, Woburn, MA, 433A Applied Biosystems, Foster City, CA, 9050 Plus, Millipore, Bedford, MA).

A number of well known robotic systems have also been developed for solution phase chemistries. These systems include automated workstations like the automated synthesis apparatus developed by Takeda Chemical Industries, LTD. (Osaka, Japan) and many robotic systems utilizing robotic arms (Zymate II, Zymark Corporation, Hopkinton, Mass.; Orca, Hewlett-Packard, Palo Alto, Calif.) which mimic the manual synthetic operations performed by a chemist. Any of the above devices are suitable for use with the present invention. The nature and implementation of modifications to these devices (if any) so that they can operate as discussed herein will be apparent to persons skilled in the relevant art. In addition, numerous combinatorial libraries are themselves commercially available (see, e.g., ComGenex, Princeton, N.J., Asinex, Moscow, Ru, Tripos, Inc., St. Louis, MO, ChemStar, Ltd, Moscow, RU, 3D Pharmaceuticals, Exton, PA, Martek Biosciences, Columbia, MD, etc.).

b. High throughput assays of chemical libraries

Any of the assays for compounds inhibiting the virulence described herein are amenable to high throughput screening. As described above, having identified the nucleic acid associated with virulence, likely drug candidates either inhibit expression of the gene product, or inhibit the activity of the expressed protein. Preferred assays thus detect inhibition of transcription (i.e., inhibition of mRNA production) by the test compound(s), inhibition of protein expression by the test compound(s), or binding to the gene (e.g., gDNA, or cDNA) or gene product (e.g v mRNA or expressed protein) by the test compound(s). Alternatively, the assay can detect inhibition of the characteristic activity of the gene product or inhibition of or binding to a receptor or other transduction molecule that interacts with the gene product.

High throughput assays for the presence, absence, or quantification of particular nucleic acids or protein products are well known to those of skill in the art. Similarly, binding assays are similarly well known. Thus, for example, U.S. Patent 5,559,410 discloses high throughput screening methods for proteins, U.S. Patent 5,585,639 discloses high throughput screening methods for nucleic acid binding (z ' .e., in arrays), while U.S. Patents 5,576,220 and 5,541 ,061 disclose high throughput methods of screening for ligand/antibody binding.

In addition, high throughput screening systems are commercially available (see, e.g., Zymark Corp., Hopkinton, MA; Air Technical Industries, Mentor, OH; Beckman Instruments, Inc. Fullerton, CA; Precision Systems, Inc., Natick, MA, etc.). These systems typically automate entire procedures including all sample and reagent pipetting, liquid dispensing, timed incubations, and final readings of the microplate in detector(s) appropriate for the assay. These configurable systems provide high thruput and rapid start up as well as a high degree,of flexibility and customization. The manufacturers of such systems provide detailed protocols the various high throughput. Thus, for example, Zymark Corp. provides technical bulletins describing screening systems for detecting the modulation of gene transcription, ligand binding, and the like.

6. Methyltransferase activity.

This protocol exemplifies a method for assaying for methyltransferase activity. It is a particularly good method because it allows for the detection of processivity but it need not be so used.

A hemimethylated DNA substrate containing two (2) GANTC methylation sites, for example the N 6 60/66-mer described in Example 5(b) below, is used to address the processivity of CcrM. The GANTC sites are resistant to Hinfl digestion but susceptible to Hindi I digestion when hemimethylated. However, upon enzymatic methylation, the GANTC sites become fully methylated and resistant to Hindll digestion. The methylation sites in the hemimethylated N 6 60/66-mer substrate are asymmetrically spaced so that DNA fragments of differing sizes are obtained upon Hindll digestion. Thus, one can address the preference for initial methylation by the enzyme during processive DNA methylation.

The N 6 60/66-mer was 5'-labeled using T4 polynucleotide kinase and [ 32 P]-ATP according to the manufacturer's protocol (U.S.Biochemical). Unreacted [ 32 P]-ATP and T4 polynucleotide kinase were separated from labeled duplex DNA by eluting the DNA through a 1-mL G-25 gel filtration column. Methylation assays were performed using 250 nM CcrM, 2 μM 5'-labeled N 6 60/66-mer, 6 μM [ 3 H]-SAM in the appropriate reaction buffer at 30°C. 5 μl of reaction was quenched with 500 μl 10% perchloric acid, 200 μl saturated sodium pyrophosphate, and 20 μl single- stranded DNA at times varying from 15 seconds to 20 minutes. These reactions were placed on ice for at least 30 minutes, and then were subjected to the filter binding assay monitoring [ 3 H]-CH 3 incorporation from [ 3 H]-SAM into duplex DNA as described in Example 5.

Concomitantly, 20 μl reaction aliquots were quenched by either heat denaturation of CcrM or by the addition of 50 μl phenol/chloroform at times varying from 15 seconds to 20 minutes. The quenched reactions were then subjected to Hindll digestion. Typically, these reactions consisted of 10 μl of the quenched DNA in a 20 μl reaction with the appropriate reaction buffer and 1 μl of Hindll. After three hours of Hindll digestion at 37°C, 10 μl of this reaction was quenched with 10 μl of gel loading dye. DNA fragments were then resolved by 16% denaturing gel electrophoresis followed by Phosphorlmaging to identify cleavage patterns.

Results from the [ 3 H]-SAM assay indicate that two mole equivalents of [ 3 H]-CH 3 were incorporated into the N 6 60/66-mer after 20 minutes. By direct contrast, only one moie equivalent of [ 3 H]-CH 3 is incorporated into the N 6 23/30-mer or N 6 45/50-mer after 20 minutes under identical conditions. Results from the Hindll digestion assay reveal fully protected DNA substrate (N 6 60/66-mer) after 20 minutes, indicating that DNA had been methylated at both GANTC sites. Furthermore, no intermediate products were obtained, i.e., methylation at a single GANTC site, indicating that under the assay conditions used the enzyme processively methylated both GANTC sites on the same DNA substrate. Approximately 250 nM of processively methylated DNA was detected after Phosphorlmaging quantitation, consistent with results from the tritium incorporation assay.

EXAMPLES

The examples provided herein are provided by way of illustration only and not by way of limitation. Those of skill will readily recognize a variety of noncritical parameters which could be changed or modified to yield essentially similar results.

Example 1. SEQ ID NO:1: Rhizobium methyltransferase sequence a. Isolation

The Rhizobium meliloti ccrM gene (Rhizobium ccrM) was isolated by generating specific probes to Rhizobium ccrM using the Polymerase Chain Reaction (PCR) and using them to screen a R. meliloti lambda library. The primers used to generate the probe had the following sequence:

Forward primer (IFADDPPY): 5'-ATY TTY GCB GAY CCB CCB TA (SEQ ID NO:9) Forward primer 1 (LDPFFG): 5'-CCR AAR AAV GGR TCS AG (SEQ ID NO:10) Forward primer 2 (IGIERE): 5'-TCV CGY TCR ATV CCR AT (SEQ ID NO:11) Forward primer and reverse primer 1 amplify a 570 bp fragment. Forward primer and reverse primer 2 amplify a 635 bp fragment. The R. meliloti lambda library was obtained and subsequent screening was accomplished as described in Sambrook et al.

Three positive clones were isolated from the library. The complete Rhizobium ccrM gene was isolated as a 3.0 kb Notl fragment and has been

completely sequenced in both directions (SEQ ID NO: 1 ). The gene encodes a protein having SEQ ID NO:2.

b. Homology between the Caulobacter and Rhizobium ccrM methyltransferase genes

The deduced sequences of the Rhizobium and Caulobacter ccrM genes were compared, revealing 61 % identity and 74% similarity. Figure 9. The homology is present throughout the two sequences, particularly around regions which had been previously identified as important to the function of other known adenine DNA methyltransferases. However, there are regions of divergence, especially around the N- and C- termini.

The DNA methyltransferase M. Hinfl from Haemophilus influenzae has the same recognition sequence (GANTC) as CcrM and is part of a restriction modification system in this bacteria (Chandrasegaran et al., Gene 70:387-392, 1988). It should be noted that H. influenzae is not part of the alpha subdivision of gram negative bacteria and therefore it is likely that this DNA methyltransferase evolved separately from the ccrM family. The deduced sequences derived from the Rhizobium and Caulobacter ccrM genes were compared to the M. Hinfl sequence and it was found, as predicted, that the Caulobacter and Rhizobium genes are much more closely related to each other than to the M. Hinfl DNA methyl-transferase. % similarity between the Rhizobium (Rh), Caulobacter (Cc) Brucella, Hp = Helicobacter pylori and M. Hinfl (Hf) CcrM proteins

Cc Rh Br Hf Hp Cc 100 74 82 Rh 90

Br Hf c. Rhizobium ccrM is essential in Rhizobium

Previous work by Stephens et al., Proc. Natl. Acad. Sci. 93: 1210-1 214, (1996) has demonstrated that the Caulobacter ccrM is essential for viability in Caulobacter. Therefore it is of interest to determine whether other ccrM homologs are also essential.

The coding sequence of the Rhizobium ccrM was disrupted by insertion of the gene encoding kanamycin/neomycin resistance (a selectable marker) into the middle of the gene. This construct was cloned into a suicide plasmid that under selection integrates into the Rhizobium ccrM locus. The result of this integration is that the wild-type copy is separated from the disrupted copy by the vector sequence, which includes the sacβ gene. Growth of Rhizobium containing an active sacB gene on sucrose is lethal (Hynes et al., Gene 78:1 1 1-1 20, 1989). This enables selection for the second recombination event between the disrupted and wild-type copy of ccrM by growth on sucrose. Selection for the event in which only the disrupted copy remained at the ccrM locus occurred only in the presence of a functional copy of ccrM on a replicating plasmid. Thus the Rhizobium ccrM gene is essential for viability in Rhizobium.

The Rhizobium ccrM locus can only be disrupted if ccrM is present in trans.

d. Overexpression of the Rhizobium ccrM gene results in defects in cell division and cell morphology

Caulobacter goes to great lengths to ensure that CcrM is presently only at a specific time of the cell cycle, by regulating the availability of CcrM at two levels: transcription and protein turnover (Stephens et al., j. Bacteriol. 1 77:1662- 1669, 1995; Wright et al., Genes and Development 10:1532-1542, 1996). If this regulation is perturbed by expressing ccrM throughout the cell cycle, the cells exhibit defects in cell division, cell morphology, and the initiation of DNA replication (Zweiger et al., ]. Mol. Biol. 235: 472-485, 1994; Wright et al., Genes and Development 10:1532-1 542, 1 96). Thus it is important to ensure that CcrM is only

present in predivisional stage of the Caulobacter cell cycle. We were therefore interested to determine what would happen if the Rhizobium ccrM gene were expressed at high levels in Rhizobium.

The 3.0 kb Notl fragment encompassing the Rhizobium ccrM gene was ligated into a high copy number plasmid and this construct was mated into wild-type Rhizobium. The phenotype of the resulting strain is clearly abnormal compared to wild-type. Wild type Rhizobium is a short rod-shaped cell; however, the cells of the strain in which ccrM was overexpressed are much larger and are highly branched. The branching points appear to occur randomly and vary dramatically between cells. This phenotype is similar to that observed when the cell division gene ftsZ is overexpressed in Rhizobium (B. Margolin, personal communication).

Interestingly, if the Rhizobium ccrM gene is placed in the high copy number plasmid such that it is driven by an additional promoter from the plasmid, no transformants were obtained in Rhizobium. This suggests that the cells can tolerate, to a certain extent, an elevated level of CcrM, but there is a point at which the level of ccrM in the cell becomes lethal.

As CcrM is only present at a specific time in the Caulobacter cell cycle, hemimethylated DNA can be detected in mixed cell cultures. When ccrM is expressed throughout the ceil cycle, whether in a Ion null mutant or from expression from a constitutively transcribed promoter, only fully methylated DNA can be detected. It was of interest to determine whether hemimethylated DNA could be detected in Rhizobium, which would suggest that the Rhizobium ccrM is also cell cycle regulated. A naturally occurring restriction site which overlaps a Hinfl site and is sensitive to adenine methylation was identified in Rhizobium. The DNA methylation state at that site was determined and hemimethylated DNA was detected. For a detailed explanation of this experiment see Zwejger et al., J. Mol. Biol. 235: 472-485, (1994). The detection of hemimethylated DNA could be due to either protection from being methylated by a protein binding at that site or the Rhizobium CcrM being present only at a specific time in the cell cycle.

e. Enzyme purification

BL2KDE3) hosting pCS255b was streaked from glycerol stock onto an SB (30 g tryptone, 20 g yeast extract, 10 g MOPS, pH 7.5) agar plate containing 200

//g/ml amp, and maintained at 37°C. Each 1 L SB/amp (200 μg/mL) culture was inoculated with one single colony at 37°C until OD 600 ~ 0.8. Each cell culture was then induced with 0.5 mM IPTG at 37°C for 1 .5-2 hours.

The cells were harvested by centrifugation at 12000 rpm at 4°C for 20 minutes. Approximately 20 grams of cell paste was obtained from 5 liters of culture. The cells were resuspended in a 25 mM HEPES, pH 7.5, 1 mM EDTA, 5 mM j?- mercaptoethanol, 1 mg/mL lysozyme, and 0.1 % PMSF 10% glycerol, and lysed by sonication using a 50% duty cycle. The process involved sonicating for 30 seconds, stirring the ceils for 90 seconds, and repeating the process until the solution was very viscous. This solution was then ceπtrifuged at 12,000 rpm for 20 minutes at 4°C, followed by ultracentrification at 40,000 rpm at 4°C for 2 hours.

The supernatant was diluted 5-fold with Buffer A (25 mM HEPES, pH 7.5, 5 mM 0-ME, 1 mM EDTA, 10% glycerol) and applied to a 30 x 2.5 cm DEAE- Sephacel connected to a P1 1 phosphocellulose column pre-equilibrated with 1 L of buffer A. CcrM does not bind to DEAE-Sephacel while 90% of the proteins from the cell lysate do. The two connected columns were washed with 500 mL buffer A. The PI 1 column was then disconnected from the DEAE column and eluted with a linear gradient of 1 L buffer A with 25 to 750 mM NaCl. CcrM was eluted at - 300 mM NaCl. Fractions were collected and analyzed for protein content by Abs280 as well as by SDS-PAGE.

After elution of the protein from the phosphocellulose column, the enzyme was concentrated using an Amicon apparatus employing a YM-30 molecular weight cut-off membrane. After concentration, the protein was determined to be > 95% pure based upon SDS-polyacrylamide gel electrophoresis. The concentration of the protein was first measured using the Bradford colorimetric technique (Bradford, Anal. Biochem. 72, 248-254 (1976)). The second method for determining the concentration of CcrM utilizes measuring the ultraviolet-visible spectroscopy absorbance of the protein at a wavelength of 280 nm. The extinction coefficient of the protein was determined from the predicted amino acid composition (Zweiger et al., j. Mol. Biol. 245, 472-485 (1994)) using the method of Gill and von Hippei Anal. Biochem. 182, 319-326 (1989)). The concentration of CcrM based upon this method is in excellent agreement with the concentration based on the Bradford method.

f. Rhizobium CcrM is degraded in a Lon protease-dependent process as has been shown in Caulobacter (Wright et al., Genes and Development 10:1532-1542, 1996).

Lon is a conserved phylogenetically widespread serine protease involved in the degradation of abnormal proteins. We generated a Lon null mutation in Caulobacter crescentus and demonstrated that ccrM transcription is still temporally regulated, but that it is present throughout the cell cycle, resulting in a fully methylated chromosome throughout the cell cycle, causing developmental defects (Wright et al., Genes and Development 10:1532-1 542, 1996). Using similar methods as described in Wright et al., we expect that Rhizobium CcrM is degraded in a Lon protease-dependent process as has been shown in Caulobacter.

Example 2. Brucella abortus methyltransferase sequence

The Brucella ccrM gene was isolated using the same strategy and primers as that described for isolating the Rhizobium ccrM gene, but using a Brucella gene library. A specific probe to the Brucella ccrM gene generated by PCR using the above mentioned primers was used to screen a Brucella lambda library and three clones were isolated.

Restriction mapping of these clones demonstrated that they all contained the full length ccrM gene. A 2.0 kb Hindll fragment isolated from one of the positive clones which contained the complete Brucella ccrM gene was sequenced (Figures 3 and 4). As with the Rhizobium ccrM gene, the deduced sequence of the Brucella gene exhibits very high homology to both the Caulobacter and Rhizobium ccrM genes and lower homology to the M. Hinfl DNA methyltransferase (Figures 9).

Example 3. Agrobacterium tumefaciens methyltransferase sequence

The Agrobacterium tumefaciens ccrM gene was isolated using the same strategy as that described for isolating the Rhizobium and Brucella ccrM gene, but using an Agrobacterium gene library. A partial gene and protein sequence are summarized in Figs. 5 and 6.

Example 4. Helicobacter pylori methyltransferase sequence

Helicobacter pylori is a small, microaerophilic Gram-negative organism which can colonize the human stomach. It is a causative agent of chronic gastritis and peptic ulcer disease, and H. pylori infection has also been epidemiologically correlated with increased risk of gastric carcinoma and lymphoma.

H. pylori belongs to the epsilon subdivision of proteobacteria, and is thus evolutionarily separated from Caulobacter crescentus, Rhizobium meliloti, and Brucella abortus, all of which belong to the alpha subdivision.

The gene for the H. pylori homolog of CcrM has been cloned and sequenced. Unlike the other ccrM homologs cloned so far, the H. pylori gene has a large open reading frame located immediately downstream. The sequencing of this open reading frame is still in progress. There is high homology between the H. pylori CcrM homolog and the M. Hinfl methyltransferase from Haemophilus influenzae. Because there is extensive precedent for finding close genetic linkage between methyltransferases and their cognate restriction endonucleases in Type II restriction-modification systems such as Hinfl, it is likely that this open reading frame encodes a restriction endonuclease.

Because of the function of methyltransferases in such restriction- modification systems (i.e. protecting native host DNA from digestion by the cognate restriction endonuclease), it is also likely that absence of the functional methyltransferase will prove lethal to H. pylori.

The Helicobacter pylori ccrM gene was isolated using the same strategy as that described for isolating the above ccrM genes, but using a Helicobacter library. The gene and protein sequence are provided in Figs. 7 and 8.

Example 5. Assay for methyltransferase

The present invention also comprises efficient assays for determining methyltransferase activity.

a. Materials

[ 3 H]-S-Adenosyl methionine ([ 3 H]-SAM), - 32 P]ATP, and [σ- 32 P]-dATP were from New England Nuclear. Phosphoramidites for DNA synthesis were obtained from Glenn Research with the exception of the N 6 -methyl-deoxyadenosine

phosphoramidite which was obtained from Pharmacia. Restriction and DNA- modifying enzymes used during molecular cloning and DNA manipulation experiments were generally from New England Biolabs, Promega, United States Biochemical, or Boehringer Mannheim. All other materials were obtained from commercial sources and were of the highest available quality.

The CcrM used in the following assays was obtained by the purification protocol described essentially in Example I .e.

b. In vitro assays

Methyltransferase activity of CcrM was assayed by two distinct methods. In the first method, restriction assays were used to test methylation of restriction sites. The amount of DNA that is resistant to cleavage by restriction enzyme digest due to hemi- or full methylation of either the small DNA substrate or the pUC18 plasmid can be accurately monitored. If the DNA is hemi- or fully methylated by CcrM, the restricted enzyme is unable to cleave the DNA molecule and full length starting material will be obtained. If the DNA is cleaved by the restriction enzyme, smaller DNA fragments will be obtained and indicate a lack of methyl incorporation into the oligonucleotide.

The sequences of the DNA substrates were derived from the upstream sequence from the dnaA promoter. The sequence of the dnaA promoter has been published (Zweiger et al., J. Mol. Biol. 235: 472-485, 1994).

The following is a list of substrates that were used (this list is not meant to be exhaustive):

1 7/23 mer DNA substrate: (SEQ ID NO: 12)

5 ' ac cciccraqtcaacaqa 3 '

3 ' qaqcqctcaqttqtctttatcgg 5 '

23/30-mer ( SEQ ID NO : 13 )

5'- TCC TCT CGC GAG TCA ACA GAA AT

3'- AGG AGA GCG CTC AGT TGT CTT TAT AGG CGC

N<>23/30-mer ( SEQ ID NO : 14 ) CH3

5 '- TCC TCT CGC GAG TCA ACA GAA AT

V- AGG AGA GCG CTC AGT TGT CTT TAT AGG CGC

N< 23/N630-mer ( SEQ ID NO : 15 )

CH3

5'- TCC TCT CGC GAG TCA ACA GAA AT 3'- AGG AGA GCG CTC AGT TGT CTT TAT AGG CGC CH3

45/50-mer (SEQ ID NO:16)

5'-ATC CTC TCG CGA GTC AAC AGA AAT ATC CGC TCA TCA CCG CAA GTT

3'- AG GAG AGC GCT CAG TTG TCT TTA TAG GCG AGT AGT GGC GTT CAA TAG GCA A

N<i45/S0-mer (SEQ ID NO: 17)

CH 3 S'-ATC CTC TCG CGA GTC AAC AGA AAT ATC CGC TCA TCA CCG CAA GTT 3'- AG GAG AGC GCT CAG TTG TCT TTA TAG GCG AGT AGT GGC GTT CAA AAG GCA A

60/66-mer (SEQ ID NO: 18)

5' -ATC CTC TCG CGA GTC AAC AGA AAT ATC CGC GAG TCA CCG CAA GTT TTC CGT TTG ACC GGC

3'- AG GAG AGC GCT CAG TTG TCT TTA TAG GCG CTC AGT GGC GTT CAA AAG GCA AAC TGG CCG TGG GAG G

N«60/66-m,r (SEQ ID NO: 19)

CH 3 CH3

5' -ATC CTC TCG CGA GTC AAC AGA AAT ATC CGC GAG TCA CCG CAA GTT TTC CGT TTG ACC GGC 3'- AG GAG AGC GCT CAG TTG TCT TTA TAG GCG CTC AGT GGC GTT CAA AAG GCA AAC TGG CCG TGG GAG G

All synthetic oligonucleotides were synthesized using a DNA synthesizer and were purified as previously described by Capson et a/., Biochemistry 31, 10984-10994 (1992)). Small duplex DNA substrates (23/30-mer) were prepared by the protocol of Kuchta et a/., Biochemistry 26, 8410-841 7 (1987)).

Larger DNA substrates (60/66-mer and N 6 60/66-mer) were prepared using a modification of the protocol established by Kaboord and Benkovic, Proc. Natl. Acad. Sci. USA 90, 10881 -10885 (1993). Briefly, each single-strand DNA component was constructed by first 5' labeling one oligonucleotide After ensuring that the labeling reaction was greater than 95% complete, the labeled oligonucleotide was annealed with the second oligonucleotide and a small linker oligonucleotide to bridge the gapped region. The two oligonucleotides were then ligated in the presence of T4 DNA ligase and MgATP. The linker oligonucleotide was separated from the ligated oligonucleotide by denaturing gel electrophoresis. The complementary large strand was constructed in an identical manner. Following purification of each respective large oligonucleotide, the two strands were annealed and purified by nondenatuπng gel electrophoresis described by Capson et al., Biochemistry 31, 10984-10994 (1992). All duplex DNA were quantitated as described by Kuchta et al., Biochemistry 26, 8410-841 7 (1987).

Analysis of DNA cleavage depends upon the nature of the DNA substrate. Small duplex DNA substrates can be 5' end-labeled using bacteriophage T4 polynucleotide kinase and [ - 32 P]ATP as the phosphate source. Both cleaved and uncleaved DNA are resolved by 20% denaturing gel electrophoresis followed by phosphoπmaging techniques to analyze for product formation, i.e., cleavage of the larger duplex DNA. Furthermore, accurate quantitation of the reaction products was obtained by manipulation of the Phosphorlmager software.

A typical assay for the methyltransferase activity otCcrM was performed incubating 50 nM CcrM with 1 μM 5'-labeled DNA while maintaining the concentration of S-adenosyl methionine (SAM) at 20 μM. The reaction was performed in a buffer consisting of 50 mM Tπs-HCI, pH 7.5 and 5 mM β- mercaptoethanol (β-ME) with 1 50 mM potassium acetate at 30°C. 10 μl aliquots of the methylation reaction were quenched at variable times from 30 seconds to 10 minutes with 10 μl 1 N HCI, extracted with 40 μl of phenol/chloroform, and neutralized with 3 M NaOH in 1 M Tris. The methylated DNA was then subjected

to restriction digest by either Hint) or HindW. Each reaction contained a final concentration of 100 nM reacted DNA in the presence of 1 unit/μL of Hint] or HindW in the appropriate reaction buffer supplied by the manufacturer at 37°C. After 30 minutes, 10 μl of reaction mixture was quenched with 10 μl of gel loading buffer (10% formamide, 0.25% bromophenol blue, and 0.25% xylene cyanol FF). 10 μl of this solution was then run on a 20% sequencing gel to visualize both protection and degradation of the 23/30-mer DNA as a function of time Product formation was quantitated by measuring the ratio of uncleaved substrate and cleaved product. The ratios of substrate protection are corrected for substrate in the absence of CcrM. Corrected ratios are then multiplied by the concentration of total DNA used in each assay to yield the amount of DNA protected.

Enzymatic assays were also performed using plasmid pUC18 DNA substrate under similar reaction conditions described above Reaction products using the larger pUC18 substrate were resolved by agarose gel electrophoresis (1 % agarose gels). Cleaved and uncleaved DNA are easily visualized under ultraviolet light after staining the gel with 0.5 μg/mL of ethidium bromide. Quantitation of the reaction products for kinetic analysis were performed by densitometry measurements.

A second method involves direct measurement of the incorporation of [ 3 H]-CH 3 from [ 3 H]-SAM into DNA. A typical assay consists of 250 nM CcrM, 5 μM DNA (hemi- or unmethylated) and 6 μM [ 3 H]-SAM in the appropriate reaction buffer 5 μL aliquots of the reaction are quenched in solution containing 500 μL 10% perchloric acid, 200 μL saturated potassium pyrophosphate, and 20 μL 1 mg/mL single-stranded DNA at times ranging from 15 seconds to 30 minutes. The quenched samples are placed on ice for 30 minutes to precipitate all DNA. The precipitated DNA is then recovered by filtration using glass fiber filters and washed, first with cold 0.1 N HCI (five times with 1 .5 mL) and then with cold 95%_ ethanol (four times with 1 .5 mL). The filters are then dried at 90°C for 10 minutes and counted by standard liquid scintillation techniques. The specific activity of the reaction is determined by measuring the counts per minute present in a fixed quantity of the original reaction in the absence of washing.

Specific activity (SA) was determined by measuring the CPMs present in 5 μL of original reaction. SA = CPMs/pmol SAM The amount of methyl incorporation was determined as follows:

(CPM 5ample - CPM rero )

= pmol product

Specific Activity The amount of methyl incorporation into the DNA substrate is determined by dividing the counts per minute of the washed reaction samples by the specific activity of the total reaction mixture. This yields product formation in terms of mole quantities. All data are corrected for nonspecific binding of [ 3 H]-SAM to the washed filter.

Alternatively, following the enzymatic incorporation of [ H]-CH 3 from [ 3 H]^SAM into DNA, a 5 μl aliquot of the reaction is spotted at variable times onto DES anion-exchange filter paper. The filters are then washed 3 times for 10 minutes with 200 mL 0.3 M ammonium formate, pH 8 to remove unreacted [ 3 H]-SAM. The filters are then briefly washed twice with 95% ethanol and then washed once with anhydrous ether. The filters are then air dried and counted by standard liquid scintillation techniques. The specific activity of the reaction is determined by measuring the radioactivity present in 5 μl of the reaction spotted on glass filter fibers without washing. The amount of methyl incorporation into the DNA substrate is determined by diving the counts per minute of the washed samples by the specific activity of the total reaction mixture, yielding product formation in terms of pmol quantities, all data are corrected for nonspecific binding of [ 3 H]-SAM to the washed filter.

During the course of performing the above assays, it was observed that: the N 6 -23/30-mer N 6 45/50-mer, and the N 6 -60/66-mer are preferred substrates by ratios of 10:1 and 2:1 ; the tested methyltransferases are processive under the assay conditions used; optimal activity was at 30° C rather than 37° C; and the tested enzymes are DNA-dependent (i.e., they become inactivated in the solutions used after about 20 minutes in the absence of DNA substrate). The Toss of activity in the absence of a substrate does not appear to involve proteolytic degradation.

c. In vivo assay

A single colony of BL2KDE3) or DH5σ hosting pCS255b was used to inoculate a 5 mL SB/amp (200 μg/ml) overnight culture at 37°C. The BL2KDE3) culture was divided into two aliquots at OD 600 -1 . One aliquot was induced with 1 mM IPTG at 37°C overnight while the other was allowed to grow without

induction. Cell cultures were centrifuged, from which cell pellets were subjected to mini plasmid prep. The recovered plasmids from DH5σ and BL2KDE3) (with and without IPTG induction) were digested with Hinfl and the restriction digests were analyzed by 1 % agarose gels. In all cases, controls containing the undigested plasmid were included. Plasmid recovered from DH5σ was susceptible to Hinfl digestion while plasmids from BL2I (DE3) with and without induction were resistant to Hinfl digestion. It appears that even uninduced BL2KDE3) expresses ccrM. To ascertain that BL2KDE3) did not have intrinsic methyltransferase specific for the GANTC sites, pUC18 was introduced into BL2 KDE3). pUC18 recovered from BL2KDE3) was susceptible to Hinfl digestion, thereby excluding the possibility of BL2KDE3) host cells containing intrinsic M. Hinfl methyltransferase activity.

Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, it will be obvious that certain changes and modifications may be practiced within the scope of the appended claims. All publications, patents and patent applications mentioned in this specification are hereby incorporated by reference for all purposes, to the same extent as if each individual publication, patent or patent application had been specifically and individually indicated to be incorporated by reference.

TABLE 1

Alignment of the Agrobacterium tumefaciens(At) ,

Brucella abortus (Ba) Rhizobium meliloti (Rm) ,

Caulobacter crescentus (Cc) and Helicobacter pylori (Hp)

CcrM DNA methyltransferase homologs

At IFADPPYNLQ CGNVHRP

Ba MSLVΪUJtflELPI.tAPRTAWIΛSIIKGIxnrsAL Rm MSS SIiAEISRAARPIJWLDSIIKGrxnrAAX- ^ cc. HKFΌPETZXHGΓXIEQI^A PE SV IFAOPPYN CILGGDLLRP hp MDF iKENLNTIIEGDCLEKLKDFPNKSVDFIFADPPYFMςϊ^ΕGE KRF

At I^SLVDAVDDEWDQFASFDAYDAFTRAWLI^CRRVTJζp^

Ba MSMVSAVDDHVDQFESFQAYDAFTRAWLlACrø

Rffl TCSLVDAVDDD DQFASFEAYDAPrRA LLACRR^KPTGT VIGSYHNIFRVGAI QD

Cc D SKVDAVDDHWDQFESFAAYDKFTRE KAARRVLKDIXAI VIGSYHNIFRVGVAVQD

Hp EGTKFOQVEDHWDKFCSFEEYDTFCLGW KECQRILKDNCSSICVIGSFQNIFRIGFH QN

, * . * **.* •* «* * ♦ * . * . *» *.. +***,.»•»*.* . » .

At LDF I N

Ba CFWT-J J ^IΛWRKTNPMPOTRGRRFQNAHET IWASRE

Rm LHF V NDI XWRK QPDAI^OSRRFQNAHE IWATANAKAKCYTFIJYEAMKAANDDVQM

Cc LGFWiLirørvwκsNPMPOTπcτ FA AHEτ^^

Hp LGFWIUTOIH/WYKSNPVPMFAGKRLCNAHETL^

Ba RSW^FPICTOSER KDEtraDKVHPTQKPEA rJΛIMMASSKPCl^IIΛPFFGSσT GAV

Rm RSDWLFPICSGSER KGD∞KRΛrøPTO^PEJu^I ΛIl^^

Cc RSD TIPLC GEERIKGADGOKAHPTQKPEAI^YRVII^TTKPGDVIIJ-tPFFGWGTro

Hp KSVWQIPICMGNERLKDAQGKKVHSTQKPEA LKKIILSATKPrøll DPFFC CT GAV

* .*. w #*.* .* » * **+•*••* ...., ..** *..•***•» »•»★»*

Ba A RLGRHFVG1I»EQPYIDAATARINAVEPLGKAE TVM GKRAEPRVAF SVMEAGL R

Rm AKR GRHl?VGIE^^QDYIDAAAERIAAVEPLGKATLSVmGKKAEPRVAFNT VESG IK

Cc AKRJJGRKFIGIEREAEYLEHAKARIAKVVPIAPED DVMCSKRAEPRVPFGTIVEAGL S

Hp AKSMNRYFIGIEKDSFYIKEAA RIiNSTRDKS-DFITNLDLETKPPKIPMSL ISKQLLK

* • . *** .

Ba PGTVLCDERRRFAAI\ AI»TLTAN-σi^σSIHRIGARVQGFDACNβWTFWHFEENπVIiK

Rm PGT^TOAXRRYSAIVRA1X.TLASG-GEAGS IHRLGAKVQCiLDACNG TFWHFEEGSV K

Cc PGi i,YCSKGTHVAKVRPrXSSITVG-DLSGSIHKIGAIVQSAPACNGWTYWHFKTDAG A

Hp IGDFLYSSNKEKICQVLENGQVRD ENYETS ∑HKMSAKY NKTNHNGWKFFYAYYQNQF

Ba PIDA RKIIREQMAAAGA

Rm PIDE RSVIRNDLAK N

Cc PIDVLRAQVRAG N

Hp LLDELRYICQRDS . * *•» .

Note: * indicates the identical residue is present in all f ve sequences : or . indicates the amino acid at that position is conserved in all sequences-