REGULATORS OF PORPHYRIN AND INTERMEDIATES FIELD OF THE INVENTION The present invention relates to nitrogen containing cyclic compounds and salts thereof, to methods of using such compounds in treating diseases and disorders related to abnormal metabolism such as porphyrias and immunological disorders and to the pharmaceutical compositions containing such compounds. BACKGROUND OF THE INVENTION The porphyrias are a life-threatening class of diseases often characterized by genetic deficiencies in the enzymes of the heme biosynthetic pathway (porphyrin pathway). These diseases are characterized by potentially life-threatening acute attacks and, in some patients, chronic debilitating symptoms (Lombardelli, S. et al, Adv. Ther.2022 Jul 30. Doi.10.1007/S12325-022-02172-8 and references cited therein). Deficiency in the enzymes of the porphyrin pathway may lead to a toxic accumulation of heme metabolites resulting in the formation of excruciating pain, neurovisceral attacks, tachycardia and paralysis. The ability to rapidly block these events would have substantial value as a medical intervention. The porphyrias are a group of autosomal dominant diseases based on inborn errors in the heme biosynthetic pathway (Bonkovsky, H.L. et al, Hepatol. Commun.2018 Dec 20;3(2): 193-206 and references cited therein). Typically, this disease is manifested by an inability to complete the synthesis of this important biomolecule, resulting in the corresponding accumulation of toxic intermediates. The porphyrias can be divided into different disease states and include acute intermittent porphyria (AIP), variegate porphyria (VP) and hereditary coproporphyria (HCP). A fourth type is the autosomal recessive 5-aminolevulinic acid (ALA) dehydratase deficiency known as ADP. Life threatening and acute symptoms of porphyrias are initiated by exposure to hormonal changes, p450-inducing drugs and other stressors. The first committed enzymatic step to heme biosynthesis is catalyzed by the enzyme 5- aminolevulinic acid synthase (ALAS). ALAS1 is the predominant isoform and is rapidly upregulated in response to the environmental stressors mentioned above. Because ALAS1 is the rate-limiting step in this process, reduction in ALAS1 prevents the accumulation of toxic intermediates and reverses the symptoms of porphyria. The current standard treatment of acute porphyrias involves intravenous administration of hemin, which reduces ALAS1 protein and the accumulation of toxic heme metabolites. Recently, small-interfering RNA (siRNA) therapy targeting ALAS1 was developed and commercialized by Alnylam Pharmaceuticals ² . siRNA molecules targeting ALAS1 (givosiran (Givlaari ^TM )), were shown to effectively reduce the expression of ALAS1 in porphyria patients (Desnick R.J. et al, PNAS 2014111(21):7777-7782 and references cited therein, and U.S. Pat. No.11,028,392 is incorporated herein by reference in its entirety). The reduction in ALAS1 expression in a subject/cell by technologies described in US 11,028,382, and references cited herein, provides therapeutic benefit to subjects presenting with a porphyria and/or in the prevention of acute attacks related to the porphyria. However, despite the promise of this treatment, siRNAs are limited by the route of administration, in vivo stability and are not optimal for the rapid treatment of acute episodic symptoms. In addition, other therapies are Panhematin and hemin often have a particularly slow onset of 2-4 days. Development of rapidly acting small molecules that decrease ALAS1 is greatly needed for treating the acute symptoms of porphyria (Furuyama, K. et al J. Biol. Chem.2016 Sep 23;291(39):20516- 29 and references cited therein). In addition, heme has regulatory effects on cellular metabolism with utility for the treatment of immunological diseases, neurological diseases and cancer (Lu, Jia-Jing. et al Biomolecules 2023, 13, 1097 is incorporated by reference in its entirety). SUMMARY OF THE INVENTION Compounds of the present invention modulate the activity and/or the expression of ALAS1 affecting biological functions. For example, the accumulation of toxic intermediates in the heme biosynthetic pathway thereby treating various porphyrias. In addition, compounds of the present invention function to regulate the heme biosynthetic pathway and would treat other diseases where this pathway’s various intermediates contribute to the initiation or propagation of a disease state. Compounds of the invention have specific properties that enhance efficacy and/or patient compliance including the possibility of various routes of administration including oral and i.v. Also provided are pharmaceutical compositions and medicaments, comprising the compounds or salts of the invention, alone or in combination with other therapeutic agents or palliative agents. The present invention also provides, in part, novel compounds and pharmaceutically acceptable salts and in part, methods for preparing the novel compounds, salts and compositions thereof, and methods of using the foregoing. In embodiments, the effective dose is determined based on the dose required to obtain a reduction of a level in either or both urine and plasma ALA and/or PBG. In embodiments, the effective dose is determined based on the dose required to obtain a particular treatment effect described in this disclosure, such as the prevention of or reduction of signs and/or symptoms associated with porphyrias. In other embodiments, a compound of the present invention may be administered to a patient in need of such treatment and ALAS1 levels may be monitored to determine the compound’s biological effect. Also, ALAS1 levels may be evaluated from a tissue of a patient to determine if that patient would likely benefit from treatment of compounds of the present invention or from continued treatment of compounds of the present invention. BRIEF DESCRIPTION OF THE FIGURES Figure 1: Kinetics of ALAS1 cell expression with drug exposure. Time course study with Ex.51 and Ex.88 in SUM159 cells. ALAS1 protein level determined by Western blot. Arrow designates the mature mitochondrial form of ALAS1 (64.4 kDa). Degradation products of ALAS1 (<64.4 kDA) are detected. Figure 2A and 2B: Ex.51 results in degradation of ALAS1 in non-cancer cells (HUMEC) over time. A) Ex.51 at 225 nM and ALAS1 changes over 24 hrs; B) Ex.51 at a range of concentrations (75-750 nM) and ALAS1 changes over 24 hrs. Figure 3: ALAS1 is rapidly degraded after exposure to either Ex.51 or Ex.88. Experiments were performed as described in the experimental section. Figure 4: ALAS1 is degraded with exposure to Ex.85 (50 nM) and this result is compared to Ex.51 treatment. Figure 5: ALAS1 degradation is sustained from exposure to either Ex.51 or Ex.88. The effect of extended exposure (48 hrs) to Ex.51 or Ex.88 was compared by Western blotting as described in the experimental section. ALAS1 protein is not restored after incubation with either agent for 48 hrs. Figure 6: ALAS1 is degraded in SUM159 cells from exposure to: Ex.88, Ex.89, Ex.2, Ex.51, Ex.14, Ex.62, Ex.84A, Ex.85, Ex.86, Ex.90 and Ex.91 for a time period of 24 hrs. Ex.88, Ex.89 and Ex.2 were tested at a concentration of 3.0 uM and Ex.51, Ex.14, Ex.62, Ex.84A, Ex.85, Ex.86, Ex.90, and Ex.91 were tested at a concentration of 0.15 uM. Western blotting and evaluation relative to vinculin is as described in the experimental section. DETAILED DESCRIPTION OF THE INVENTION The present invention describes chemical matter and its use to treat porphyrias and or conditions that relate to ALAS1 expression and/or function in a mammal. The invention relates to administering to a subject in need of treatment a compound of Formula I. Porphyrias are a series of disorders that are inherited or acquired that may be caused by changes in enzyme activity of the heme biosynthetic pathway (US 11,028,392 and references cited therein). In addition, US 11,028,392 teaches the importance of the modulation of ALAS1 by RNA interference (RNAi) in the treatment of porphyrias both for prophylaxis and in acute settings (clinical trials report: Orphanet J Rare Disease 2022 Aug26;17(1):327 and references cited therein). The present invention relates to methods of using an agent described by Formula I for the treatment of porphyrias and related sequalae. In addition, new chemical matter is described that may be used to treat porphyrias, immunological diseases, neurodegenerative diseases and cancer. The present invention also describes the use of the agents, as described in Formula I, to reduce ALAS1 expression and/or to treat a disease, disorder, or pathological process that is related to ALAS1 expression. In certain embodiments, expression of ALAS1 is reduced using agents as described in Formula I. Reduced expression of the ALAS1 gene may reduce the levels of porphyrin precursors, porphyrin products, porphyrins and their metabolites and/or products and intermediates of the heme pathway. This reduction in porphyrin-related and/or ALAS1 related products can be useful in the treatment of diseases and disorders related to ALAS1 expression. A number of diseases, disorders and pathological processes are described in US 11,029,392 that are treated by a reduction of ALAS1 (this is not meant to be limiting). In addition, to porphyrias, neurological diseases, autoimmune diseases and cancer may be treated with a reduction in ALAS1 (Porphyrin overdrive rewires pan-cancer cell metabolism, Adapa, S. R. bioRxiv, 2022, dio.org/10.1101/2022.02.18.481061 and references cited therein and The multifaceted Role of Heme in Cancer, Fiorito, V. et al, Frontiers in Oncology, 2020, 9,1 and references cited therein). Examples of porphyrias and diseases of heme metabolism that may be treated by the use of the agents, as described in Formula I, are given as the following (these examples are not meant to be limiting): 1. 5-Aminolevulinic Acid Dehydratase Porphyria (ADP)- disorder originating from homozygous or compound heterozygous deficiency of 5-aminolevulinic acid dehydratase, the second enzyme in the heme biosynthetic pathway. Believed to be hepatic in origin with acute neurovisceral symptoms. 2. Acute Intermittent Porphyria (AIP)- disorder resulting from mutations associated with loss of activity of porphobilinogen deaminase, the third enzyme in the heme biosynthetic pathway. Autosomal dominant, often asymptomatic, believed to hepatic in origin with acute neural visceral symptoms. 3. Congenital Erythropoietic Porphyria (Gunther Disease)- congenital disease resulting from homozygous or compound heterozygous mutations of the uroporphyrinogen III cosynthase gene, the fourth enzyme in the heme biosynthetic pathway. Erythropoietic with cutaneous symptoms. 4. Porphyria Cutanea Tarda- disorder resulting from deficiency of hepatic uroporphyrinogen decarboxylase, the fifth enzyme of the heme biosynthetic pathway. Hepatic in origin with cutaneous symptoms. 5. Hepatoerythropoietic Porphyria- disorder resulting from mutations of the gene encoding uroporphyrinogen decarboxylase, the fifth enzyme of the heme biosynthetic pathway. Origin is homozygous or compound heterozygous mutations, the origin is hepatic or erythropoietic and the symptoms are cutaneous. 6, 7. Hereditary Coproporphyria (HCP) and Variegate Porphyria (VP)- disorder resulting from functional deficiencies in coproporphyrinogen oxidase or protoporphyrinogen oxidase, the sixth and seventh enzyme of the heme biosynthetic pathway, respectively. Origin is hepatic with acute neurovisceral or cutaneous symptoms. 8. Erythropoietic Protoporphyria- disorder resulting from deficiency in ferrochelatase, the final enzymatic step in the heme biosynthetic pathway. This an inherited disorder of erythropoietic origin and cutaneous symptoms. 9. Transient erythroporphyria of infancy. 10. X-linked sideroblastic anemia (XLSA). Additional references for description of porphyrias and diseases of heme metabolism are found in: Disorders of Heme Biosynthesis. Inborn Metabolic Diseases pp 451– 464, 2006 ISBN: 978-3-540-28783-4 and references cited therein; Clinically Important Features of Porphyrin and Heme Metabolism and the Porphyrias. Metabolites 2014, 4, 977-1006; doi:10.3390/metabo4040977 Metabolites ISSN 2218- 1989 and references cited therein. Examples neurodegenerative diseases of heme metabolism that may be treated by the use of the agents, as described in Formula I, are given as the following (these examples are not meant to be limiting): 1. Neuropathic porphyrias – disorder resulting from mutations in delta- aminolevulinate dehydratase or the enzymes associated with acute intermittent porphyria, hereditary coproporphyria and variegate porphyria as described above. 2. Posterior Column Ataxia and Retinitis Pigmentosa (PCARP)- disorder resulting from a deficiency in the heme exporter FLVR1 and subsequent heme export. Results in degeneration of posterior columns of the spinal cord or retinal photoreceptor (PCARP). 3. Hereditary Sensory and Autonomic Neuropathy (HSAN)- a neurodegenerative disorder resulting from mutations in the FLVR1 protein and deficiency in heme export. Loss of nociception is associated with this disease. Additional references for description of heme and neurodegeneration are found in: Unraveling the Role of Heme in Neurodegeneration. Front. Neurosci., 09 October 2018 Sec. Neurodegeneration https://doi.org/10.3389/fnins.2018.00712 and references cited therein, and Fiorito, V. et al Pharmaceuticals 2018, 11, 87 and references cited therein Regulation of heme and heme precursors via ALAS1 regulation would have various uses in the treatment of disease (Furuyama, K. et al Tohoku J. Exp. Med, 2007, 213, 1-16 and references cited therein. Tumor initiation and propagation, including changes required for metastasis, require changes to a cancer cell’s metabolism. In addition, changes to a cancer cell’s metabolism impacts normal cells, especially those proximal to the tumor. For a review see: Pavlova, N. N. Cell Metabolism 2022, 34, 355 and references cited therein. Literature reports porphyrin pathway excessive production and dysregulated function, recent termed porphyrin overdrive, is central to cancer and is absent is normal tissues (Adapa, S. R. bioRxiv, 2023: doi: https://doi.org/10.1101/2022.02.18.481061 and references cited therein). Also, uterine endometrial cancer is an estrogen-related tumor where there is an abnormal level of ALAS1 vs normal tissue. Estrogen is shown to increase the levels of ALAS1 in uterine endometrial cancer cells (Lu, Jia-Jing et al Biomolecules 2023, 13, 1097 and references cited therein). Compounds of the present invention reduce ALAS1 levels thereby treating cancer patients. Once determined, ALAS1 levels can be used to select cancer patients suitable for treatment with a compound of the present invention (see Lu, Jia-Jing et al, Biomolecules 2023, 13, 1097). In addition, once treated with a compound of the present invention, ALAS1 levels may be monitored to determine drug effect including suitability of drug dose and schedule. The invention herein allows for the selection of patients that will benefit from the administration of a compound of Formula I, by evaluating ALAS1 cellular levels in a tissue of interest and comparing those levels to reference levels. One aspect of the invention relates to the treatment of porphyrias through the administration of a therapeutically effective amount of a compound of Formula I. One aspect of the invention relates to the treatment of neurological complications resulting from a porphyria through the administration of a therapeutically effective amount of a compound of Formula I. One aspect of the invention relates to the treatment of cutaneous symptoms resulting from a porphyria through the administration of a therapeutically effective amount of a compound of Formula I. One aspect of the invention relates to the treatment of hepatic symptoms resulting from a porphyria through the administration of a therapeutically effective amount of a compound of Formula I. One aspect of the invention relates to the treatment of pain and the treatment and/or prevention of neuropathies as aspects/sequalae of porphyrias through the administration of a therapeutically effective amount of a compound of Formula I. One aspect of the invention relates to the prevention of the acute episodes of porphyria through the administration of a therapeutically effective amount of a compound of Formula I. One aspect of the invention relates to the treatment of 5-aminolevuline acid dehydrogenase porphyria (ADP) through the administration of a therapeutically effective amount of a compound of Formula I. One aspect of the invention relates to the treatment of acute neurovisceral symptoms through the administration of a therapeutically effective amount of a compound of Formula I. One aspect of the invention relates to the treatment of acute intermittent porphyria (AIP) through the administration of a therapeutically effective amount of a compound of Formula I. One aspect of the invention relates to the treatment of congenital erythropoietic porphyria (Gunther Disease) through the administration of a therapeutically effective amount of a compound of Formula I. One aspect of the invention relates to the treatment of porphyria cutanea tarda through the administration of a therapeutically effective amount of a compound of Formula I. One aspect of the invention relates to the treatment of hepatoerythropoietic porphyria through the administration of a therapeutically effective amount of a compound of Formula I. One aspect of the invention relates to the treatment of hereditary coproporphyria (HCP) through the administration of a therapeutically effective amount of a compound of Formula I. One aspect of the invention relates to the treatment of hereditary variegate porphyria (VP) through the administration of a therapeutically effective amount of a compound of Formula I. One aspect of the invention relates to the treatment of erythropoietic protoporphyria through the administration of a therapeutically effective amount of a compound of Formula I. One aspect of the invention relates to the treatment of transient erythroporphyria of infancy through the administration of a therapeutically effective amount of a compound of Formula I. One aspect of the invention relates to the treatment of X-linked sideroblastic anemia (XLSA) through the administration of a therapeutically effective amount of a compound of Formula I. One aspect of the invention relates to the treatment of neuropathic porphyrias through the administration of a therapeutically effective amount of a compound of Formula I. One aspect of the invention relates to the treatment of posterior column ataxia and retinitis pigmentosa (PCARP)-disorder through the administration of a therapeutically effective amount of a compound of Formula I. One aspect of the invention relates to the treatment of the degeneration of posterior columns of the spinal cord through the administration of a therapeutically effective amount of a compound of Formula I. One aspect of the invention relates to the treatment of the degeneration of the retinal photoreceptor through the administration of a therapeutically effect amount of a compound of Formula I. One aspect of the invention relates to the treatment of hereditary sensory and autonomic neuropathy (HSAN) through the administration of a therapeutically effective amount of a compound of Formula I. One aspect of the invention relates to the treatment of the loss of nociception through the administration of a therapeutically effective amount of a compound of Formula I. One aspect of the invention relates to the treatment of acute intermittent porphyria (AIP), also referred to as porphobilinogen (PBG) deaminase deficiency or hydroxymethylbilane synthase (HMBS) deficiency through the administration of a therapeutically effective amount of a compound of Formula I. One aspect of the invention relates to the treatment of the cutaneous and erythropoietic aspects/sequalae of porphyrias through the administration of a therapeutically effective amount of a compound of Formula I. One aspect of the invention relates to the treatment of hereditary spastic paraplegia through the administration of a therapeutically effective amount of a compound of Formula I. In one embodiment treatment of a subject with an agent of Formula I reduces the expression of ALAS1 and/or the level of one or more porphyrins or porphyrin precursors and/or their metabolites. Examples include: delta-aminolevulinic acid (ALA), porphopilinogen (PBG), hydroxymethylbilane (HMB), uroporphyrinogen I or III, coproporphyrinogen I or III, protoporphrinogen IX, and proporphyrin IX,or porphyrin products or metabolites. The reduction in level may be at least 5%, 10%, 15%, 20%, 25%, less than 50% or more than 50% compared to reference. These examples are not meant to be limiting. ^ In additional aspects, the invention provides methods for treating, preventing or managing pathological processes related to ALAS1 expression that is pathological processes that involve porphyrins, porphyrin precursors, and/or defects of the porphyrin pathway. For example, porphyrias, immunological diseases, neurological diseases and cancers, this example is not meant to be limiting. One aspect of the invention is a method of treating and/or preventing a disorder related to ALAS1 expression comprising administering to a subject in need of such treatment a therapeutically effective amount of a compound of Formula I. One aspect of the invention is a method for inhibiting ALAS1 expression in a cell. This method involves exposing the cell to an agent of Formula I and maintaining exposure to the agent until ALAS1 is degraded. One aspect of the invention is a method for inhibiting ALAS1 expression in a cell isolated from a patient at risk of presenting with a porphyria or previously diagnosed with a porphyria. This method involves exposing the cell to an agent of Formula I and maintaining exposure to the agent until ALAS1 is degraded. One aspect of the invention is a method for inhibiting ALAS1 expression in a cell isolated from a patient at risk of presenting with a disease related to ALAS1 expression or previously diagnosed with a disease related to ALAS1 expression. This method involves exposing the cell to an agent of Formula I and maintaining exposure to the agent until ALAS1 is degraded. In certain embodiments, a compound of Formula I when administered to a subject in need, leads to a decrease in ALAS1 expression (cell) and thereby provides therapeutic benefit to the subject for the following conditions: porphyria, 5- Aminolevulinic Acid Dehydratase Porphyria (ADP), or Acute Intermittent Porphyria (AIP), or Congenital Erythropoietic Porphyria (Gunther Disease), or Porphyria Cutanea Tarda, or Hepatoerythropoietic Porphyria, or Hereditary Coproporphyria (HCP), or Variegate Porphyria (VP), or Erythropoietic Protoporphyria, or Transient erythroporphyria of infancy, or X-linked sideroblastic anemia (XLSA). In certain embodiments, a compound of Formula I when administered to a subject in need, leads to a decrease in ALAS1 expression (cell) and thereby provides therapeutic benefit to the subject for the following conditions: neuropathic porphyrias, or Posterior Column Ataxia and Retinitis Pigmentosa (PCARP), or Hereditary Sensory and Autonomic Neuropathy (HSAN). In certain embodiments, a compound of Formula I when administered to a subject in need, leads to a decrease in ALAS1 expression (cell) and thereby provides therapeutic benefit to the subject for the following conditions: acute hepatic porphyria (e.g., acute intermittent porphyria (AIP), variegated porphyria (VP), hereditary coproporphyria (HCP) and ALA-dehydratase deficient porphyria (ADP)). In certain embodiments, a compound of Formula I when administered to a subject in need, leads to a decrease in ALAS1 expression (cell) and thereby provides therapeutic benefit to the subject for the following conditions/symptoms/presentations: pain, neuropathy, nerve damage, headache, nausea, vomiting, tachycardia, hypertension, cardiac arrhythmias, insomnia, anxiety, confusion, seizure, hallucinations, disorientation and/or paranoia. In certain embodiments, a compound of Formula I when administered to a subject in need, leads to a decrease in ALAS1 expression (cell) and thereby provides therapeutic benefit to the subject by the reduction in porphyrin and/or porphyrin precursors (e.g., ALA and PBG) in a subject’s sample (e.g., urine and/or serum). In embodiments the cell treated with an agent of Formula I is a mammalian hepatocyte or erythroid cell. In embodiments cellular ALAS1 expression is reduced >30% or >50% by an agent of Formula I. In embodiments, the method for inhibition of ALAS1 expression in a cell is used to determine an individual patient’s sensitivity to an agent of Formula I. In embodiments the foregoing methods of inhibiting ALAS1 expression in a cell, by agents of Formula I, the cell is treated in vivo, in vitro or ex vivo. In embodiments the subject is a human at risk or diagnosed with a porphyria, for example: X-linked sideroblastic anemia (XLSA), ALA dehydratase deficiency porphyria (ADP or Doss porphyria), acute intermittent porphyria (AIP), congenital erythropoietic porphyria (CEP), porphyria cutanea tarda (PCT), hereditary coproporphyria (HCP), variegate porphyria (VP), erythropoietic protoporphyria, or transient erythroporphyria of infancy. In embodiments the porphyria is a hepatic porphyria such as, acute intermittent porphyria (AIP), hereditary coproporphyria (HCP), variegate porphyria (VP), ALA dehydratase deficiency porphyria (ADP) and hepatoerythropoietic porphyria. In embodiments the subject has, or is at risk for developing a porphyria. In embodiments the subject has, or is at risk for developing a disease from elevated levels of ALAS1. In embodiments the method of administering a subject in need a therapeutically effective amount of a compound of Formula I, ameliorates pain and/or chronic pain and/or progressive neuropathy and/or nerve damage. In embodiments the method of administering a subject in need a therapeutically effective amount of a compound of Formula I, prevents pain and/or chronic pain and/or progressive neuropathy and/or nerve damage. In embodiments the porphyria is a dual porphyria. In embodiments the subject is treated for a porphyria and/or a cancer. In embodiments the subject is treated for an autoimmune disease. One aspect of the present invention relates to novel methods for the detection of ALAS1 as a biomarker of pharmacological effect of compounds of Formula I. One aspect of the present invention relates to novel methods for the selection of a patient with a porphyria via genetic testing and/or the evaluation of biomarkers in the urine, bodily fluids or tissues that would benefit from treatment with a compound of Formula I. One aspect of the present invention provides methods of treatment of a patient with a porphyria via a determination of the patient in need due to genetic testing, or urine or other bodily fluids levels of porphyrins, porphyrin precursors, (e.g. ALA and/or PBG). In certain embodiments, a compound of Formula I when administered to a subject in need, leads to a decrease in ALAS1 expression (in a cell) and provides therapeutic benefit to the subject for the following conditions: cancer or other proliferative disease. Another aspect of the present invention relates novel detection of ALAS1 as a biomarker of cancer, immunological diseases, neurological diseases and porphyrias. Another aspect of the present invention relates novel detection of ALAS1 as a biomarker of cancer, immunological diseases, neurological diseases and porphyrias in patient samples. Comparison of levels of ALAS1 in patient samples to reference levels. These biological samples may be acquired from the mammal before or after treatment with compounds of the present invention and/or Formula I. In addition, these samples may also be treated with compounds described by Formula I and the response to the compounds may be determined by changes in ALAS1 levels, changes in porphyrins, porphyrin precursors, porphyrin products and their metabolites, or other related marker to ALAS1. Another aspect of the present invention are methods of selecting a patient having a cancer, immunological disease, neurological disease or porphyria for treatment with a compound of the present invention, the methods comprising a) determining the ALAS1 level in the patient’s biological sample, and b) selecting the patient for treatment with a compound of the present invention if the ALAS1 level is higher than a reference level. Another aspect of the present invention are methods of treating a patient having a cancer, immunological disease, neurological disease or porphyria for treatment with a compound of the present invention, the methods comprising a) detecting whether a patient’s biological sample has a ALAS1 level that is higher than a reference level by: 1) obtaining or having obtained a biological sample from the patient, and 2) performing, or having performed, an assay on the biological sample to determine an ALAS1 level; b) selecting the patient for treatment with a compound of Formula I when the biological sample has an ALAS1 level that is higher than a reference level; and c) administering to the patient a therapeutically effective amount of a compound of Formula I. Another aspect of the present invention relates to the sensitivity of a patient’s biological sample to a compound of Formula I. To determine the sensitivity of a patient’s biological sample to a compound of Formula I, this biological sample is exposed to a compound of Formula I while monitoring ALAS1 levels prior to, during and after exposure to the compound. In addition, other markers of therapeutic potential may also be monitored in addition to ALAS1 such as, cell viability, proliferation rate, markers of porphyrias described herein, heme levels, ClpP levels, ClPX levels, glycine mitochondrial transporter SLCA25A38, HMOX1, NOCA1, HOXC11, ADAM12, Myc, integrin alpha5, MAPK, interleukin-1beta, IL6, tumor necrosis factor-alpha, and mitochondrial enzyme levels. Additional protein markers may include ATF4, NIBAN1, ASNS, SLC7A11 (XCT), GDF15, TRIB3, S100P and gene markers TNRC18, FLRT1, ADM2, UNC5B, NMRAL2P, SKIL, MT-RNR1, SLC25A6, IL1RL1, GDF15, PCDH1, TRIB3. Cell markers of senescence IL8, IL10, IL12, B-galactosidase may also be measured. Cell surface markers including calreticulin, calnexin, TAPBP, PDIA3, P4HB, TAP1, TAP2 may also be monitored as a measure of sensitivity to a compound of Formula I. Another aspect of the present invention are methods of treating a patient having an estrogen-related cancer (breast cancer, ovarian cancer or endometrial cancer) with a compound of Formula I, the methods comprising a) detecting whether a patient’s biological sample has a ALAS1 level that is higher than a reference level by: 1) obtaining or having obtained a biological sample from the patient, and 2) performing, or having performed, an assay on the biological sample to determine an ALAS1 level; b) selecting the patient for treatment with a compound of Formula I when the biological sample has an ALAS1 level that is higher than a reference level; and c) administering to the patient a therapeutically effective amount of a compound of Formula I. Optionally, additional treatment with a compound of Formula I may be administered and subsequent evaluation of cellular ALAS1 levels may occur. Another aspect of the present invention relates to the identification of other chemical matter as regulators of ALAS1. In addition to direct effects on ALAS, the rate-limiting step in heme biosynthesis, compounds of the present invention can be used to reduce the levels of other mitochondrial heme biosynthetic enzymes. This includes: CPO: coproporphyrinogen oxidase; PPO: protoporphyrinogen oxidase; FECH: ferrochelatase, all three of these enzymes that are required for heme synthesis and the levels of these enzymes can be used to evaluate a drug’s biological action. Another aspect of the present invention, compounds of the present invention can be utilized to reduce mitochondrial enzymes responsible for the formation of succinyl- COA, a required substrate for the production of 5- amino levulinic acid (5-ALA). These enzymes are succinate--CoA ligase [GDP-forming] subunit beta, (SUCLG2) and succinate--CoA ligase [ADP-forming] subunit beta, (SUCLA2). All three of these enzymes that are required for heme synthesis and the levels of these enzymes can be used to evaluate a drug’s biological action. Another aspect of the present invention, compounds of the present invention can be used to reduce incorporation of pyridoxal phosphate (PLP) into ALAS, a required co- factor of ALAS. Compounds of the present invention can be used to reduce the levels of mitochondrial ClpX, a required protein for the insertion of PLP into ALAS1 (Kardon et al, 2020). Another aspect of the present invention, compounds of the present invention can be used to reduce mitochondrial enzymes required for the synthesis of glycine, a required substrate for the production of 5-ALA and heme biosynthesis. This includes the mitochondrial enzyme SHMT2, an enzyme involved in glycine synthesis from serine. This can be used to evaluate a drug’s biological function. All publications, patents and patent applications cited in this specification are herein incorporated by reference as if each individual publication, patent or patent application were specifically and individually indicated to be incorporated by reference. The term: “and references cited therein” following a specific citation, be it a publication, patent or patent application, indicates all citations within that specific citation are also herein incorporated. In addition, the materials, methods, and examples are not intended to be limiting. Definitions The terms used herein have their ordinary meaning and the meaning of such terms is independent at each occurrence thereof. That notwithstanding and except where stated otherwise, the following definitions apply throughout the specification and claims. a) Biology Related Definitions and Classifications The term “subject” or “patient” as used herein refers to any individual to which the subject methods are performed or may be performed. Generally, the patient is human but may also be another mammal. The term “treatment” refers to administration or application of a therapeutic agent to a subject or performance of a procedure or modality on a subject for the purpose of obtaining a therapeutic benefit. The term “therapeutic benefit” or “therapeutically effective” as used herein refers to anything that promotes or enhances the well-being of the subject with respect to the medical treatment of this condition. This includes, but is not limited to, a reduction in the frequency or severity of the signs and symptoms of disease. The term “cell” as used herein may be an isolated cell, a cell together with cells of similar origin, a cell together with cells of the same species, a cell in a tissue, a cell in an organ, and/or a cell in an animal (e.g., such as a mammal, especially a human). This includes a cell in cell culture media, either presented as a monoculture, spheroid, organelle or similar 2-dimensional or 3-dimensional format. A compound of the present invention may provide therapeutic benefit to a subject by having a response in a cell (as described herein) within the subject. Biological sample. The term “sample” with respect to an individual encompasses blood and other liquid samples of biological origin, solid tissue samples such as a biopsy specimen and the progeny thereof. The definition also includes samples that have been manipulated in any way after their procurement, such as by treatment with reagents; washed; or enrichment for certain cell populations, such as cancer cells. The definition also includes samples that have been enriched for particular types of molecules, e.g., nucleic acids, polypeptides, etc. The term “biological sample” encompasses a clinical sample. The types of “biological samples” include, but are not limited to: tissue obtained by surgical resection, tissue obtained by biopsy, cells in culture, cell supernatants, cell lysates, tissue samples, organs, bone marrow, blood, plasma, serum, fine needle aspirate, lymph node aspirate, cystic aspirate, a paracentesis sample, a thoracentesis sample and the like. A “biological sample” can include cells (e.g., target cells, normal cells, blood cells, tissue cells, etc.) can be suspected of comprising such cells, or can be devoid of cells. A biological sample can include biological fluids derived from cells (e.g., a cancerous cell, an infected cell, etc.), e.g., a sample comprising polynucleotides and/or polypeptides that is obtained from such cell (e.g., a cell lysate or other cell extract comprising polynucleotides and/or polypeptides). A biological sample comprising an infected cell from a patient can also contain non-infected cells. In some embodiments the biological sample is blood or a derivative thereof, e.g. plasma, serum, etc. Obtaining and assaying a sample. The term “assaying” is used herein to include the physical steps of manipulating a biological sample to generate data related to the sample. As will be readily understood by one of ordinary skill in the art, a biological sample must be “obtained” prior to assaying the sample. This, the term “assaying” implies that the sample has been obtained. The terms “obtained” or “obtaining” as used herein encompass the act of receiving an extract or isolated biological sample. For example, a testing facility can “obtain” a biological sample in the mail (or via delivery, etc.) prior to assaying the sample. In some cases, the biological sample was “extracted” or “isolated” from an individual by another party prior to mailing (i.e., delivery, transfer, etc.), and then “obtained” by the testing facility upon arrival of the sample. This, a testing facility can obtain the sample and then assay the sample, thereby producing data related to the sample. The terms “obtained” or “obtaining” as used herein can also include the physical extraction or isolation of a biological sample from the subject. Accordingly, a biological sample can be isolated from a subject (and thus “obtained”) by the same person or same entity that subsequently assays the sample. When a biological sample is “extracted” or “isolated” from a first party or entity and then transferred (e.g., delivered, mailed, etc.) to a second party, the sample was obtained by the first party (and also “isolated” by the first party), and then subsequently “obtained” (but not “isolated”) by the second party. Accordingly, in some embodiments, the step of obtaining does not comprise the step of isolating a biological sample. In some embodiments, the step of obtaining comprises the step of isolating a biological sample (e.g., a pre-treatment biological sample, a post-treatment biological sample, etc.). Methods and protocols for isolating various biological samples (e.g., a blood sample, a serum sample, a plasma sample, a biopsy sample, an aspirate, etc.) will be known to one of ordinary skill in the art and any convenient method may be used to isolate a biological sample. It will be understood by one of ordinary skill in the art that in some cases, it is convenient to wait until multiple samples (e.g., a pre-treatment biological sample and a post-treatment biological sample) have been obtained prior to assaying the samples. Accordingly, in some cases an isolated biological sample (e.g., a pre- treatment biological sample, a post-treatment biological sample, etc.) is stored until all appropriate samples have been obtained. One of ordinary skill in the art will understand how to appropriately store a variety of different types of biological samples and any convenient method of storage may be used (e.g., refrigeration) that is appropriate for the particular biological sample. In some embodiments, a pre- treatment biological sample and a post-treatment are assayed in parallel. In some cases, multiple different post-treatment biological samples and/or a pre-treatment biological sample are assayed in parallel. In some cases, biological samples are processed immediately or as soon as possible after they are obtained. In subject methods, the concentration (i.e., “level”), or expression level of a gene product, which may be an RNA, a protein, etc., (which will be referenced herein as a bio-marker), in a biological sample is measured (i.e., “determined”). By “expression level” (or “level”) it is meant the level of gene product (e.g., the absolute and/or normalized value determined for the RNA expression level of a biomarker or for the expression level of the encoded polypeptide, or the concentration of the protein in a biological sample). The term “gene product” or “expression product” are used herein to refer to the RNA transcription products (RNA transcripts, e.g., mRNA, an unspliced RNA, a splice variant mRNA, and/or fragmented RNA) of the gene, including mRNA, and the polypeptide translation products of such RNA transcripts. A gene product can be, for example, an unspliced RNA, an mRNA, a splice variant mRNA, a microRNA, a fragmented RNA, a polypeptide, a post-translationally modified polypeptide, a splice variant polypeptide, etc. The terms “determining”, “measuring”, “evaluating”, “assessing”, “assaying”, and “analyzing” are used interchangeably herein to refer to any form of measurement, and include determining if an element is present or not. These terms include both quantitative and/or qualitative determinations. Assaying may be relative or absolute. For example, “assaying” can be determining whether the expression level is less than or “greater than or equal to” a particular threshold, (the threshold can be pre- determined or can be determined by assaying a control sample). On the other hand, “assaying to determine the expression level” can mean determining a quantitative value (using any convenient metric) that represents the level of expression (i.e., expression level, e.g., the amount of protein and/or RNA, e.g., mRNA) of a particular biomarker. The level of expression can be expressed in arbitrary units associated with a particular assay (e.g., fluorescence units, e.g., mean fluorescence intensity (MFI)), or can be expressed as an absolute value with defined units (e.g., number of mRNA transcripts, number of protein molecules, concentration of protein, etc.). Additionally, the level of expression of a biomarker can be compared to the expression level of one or more additional genes (e.g., nucleic acids and/or their encoded proteins) to derive a normalized value that represents a normalized expression level. The specific metric (or units) chosen is not crucial as long as the same units are used (or conversion to the same units is performed) when evaluating multiple biological samples from the same individual (e.g., biological samples taken at different points in time from the same individual). This is because the units cancel when calculating a fold-change (i.e., determining a ratio) in the expression level from one biological sample to the next (e.g., biological samples taken at different points in time from the same individual). For measuring RNA levels, the amount or level of an RNA in the sample is determined, e.g., the level of an mRNA. In some instances, the expression level of one or more additional RNAs may also be measured, and the level of biomarker expression compared to the level of the one or more additional RNAs to provide a normalized value for the biomarker expression level. Any convenient protocol for evaluating RNA levels may be employed wherein the level of one or more RNAs in the assayed sample is determined. A number of exemplary methods for measuring RNA (e.g., mRNA) expression levels (e.g., expression level of a nucleic acid biomarker) in a sample are known by one of ordinary skill in the art, and any convenient method can be used. Exemplary methods include, but are not limited to: hybridization-based methods (e.g., Northern blotting, array hybridization (e.g., microarray); in situ hybridization; in situ hybridization followed by FACS; and the like) (Parker & Barnes, Methods in Molecular Biology 106:247-283(1999)); RNAse protection assays (Hod et al, Biotechniques, 1992, 13 852-854 and references cited therein); PCR-based methods (e.g., reverse transcription PCR (RT-PCR), quantitative RT-PCR (qRT-PCR), real-time RT-PCR, etc.)(Weis et al, Trends in Genetics 1992, 8263-264 and references cited therein); nucleic acid sequencing methods (e.g., Sanger sequencing, Next Generation sequencing (i.e., massive parallel high throughput sequencing, e.g., Illumina’s reversible terminator method, Roche’s pyrosequencing method (454), Life Technologies’ sequencing by ligation (the SOLiD platform), Life Technologies’ Ion Torrent platform, single molecule sequencing, etc.); and the like. In some embodiments, the biological sample can be assayed directly. In some embodiments, nucleic acid of the biological sample is amplified (e.g., by PCR) prior to assaying. As such, techniques such as PCR (Polymerase Chain Reaction), RT-PCR (reverse transcriptase PCR), qRT-PCR (quantitative RT-PCR), etc. can be used prior to the hybridization methods and/or the sequencing methods discussed above. For measuring mRNA levels, the starting material is typically total RNA or poly A+ RNA isolated from a biological sample (e.g., suspension of cells from a peripheral blood sample, a bone marrow sample, etc., or from a homogenized tissue, e.g., a homogenized biopsy sample, an aspirate, a homogenized paraffin- or OCT- embedded sample, etc.). General methods for mRNA extraction are well known in the art and are disclosed in standard textbooks of molecular biology, including Ausubel et al., Current Protocols of Molecular Biology, John Wiley and Sons (1997). RNA isolation can also be performed using a purification kit, buffer set and protease form commercial manufacturers, according to the manufacturer’s instructions. For example, RNA from cell suspensions can be isolated using Qiagen RNeasy mini- columns, and RNA from cell suspensions or homogenized tissue samples can be isolated using the TRIzol reagent-based kits (Invitrogen), MasterPure ^TM Complete DNA and RNA Purification Kit (EPICENTRE ^TM , Madison, Wis.), Paraffin Block RNA Isolation Kit (Ambion, Inc.) or RNA Stat-60 kit (Tel-Test). A variety of different manners of measuring mRNA levels are known in the art, e.g., as employed in the field of differential gene expression analysis. One representative and convenient type of protocol for measuring mRNA levels is array-based gene expression profiling. Such protocols are hybridization assays in which a nucleic acid that displays “probe” nucleic acids for each of the genes to be assayed/profiled in the profile to be generated is employed. In these assays, a sample of target nucleic acids is first prepared from the initial nucleic acid sample being assayed, where preparation may include labeling of the target nucleic acids with a label, e.g., a member of signal producing system. Following target nucleic acid sample preparation, the sample is contacted with the array under hybridization conditions, whereby complexes are formed between target nucleic acids that are complementary to probe sequences attached to the array surface. The presence of hybridized complexes is then detected, either qualitatively or quantitatively. Specific hybridization technology which may be practiced to generate the expression profiles employed in the subject methods includes the technology described in U.S. Pat. Nos.5,143,854; 5,288,644; 5,324,633; 5,432,049; 5,470,710; 5,492,806; 5,503,980; 5,510,270; 5,525,464; 5,547,839; 5,580,732; 5,661,028; 5,800,992; the disclosures of which are herein incorporated by reference; as well as WO 95/21265; WO 96/31622; WO 97/10365; WO 97/27317; EP373203; and EP 785280. In these methods, an array of “probe” nucleic acids that includes a probe for each of the phenotype determinative genes whose expression is being assayed is contacted with target nucleic acids as described above. Contact is carried out under hybridization conditions, e.g., stringent hybridization conditions, and unbound nucleic acid is then removed. The term “Stringent assay conditions” as used herein refers to conditions that are compatible to produce binding pairs of nucleic acids, e.g., surface bound and solution phase nucleic acids, of sufficient complementarity to provide for the desired level of specificity in the assay while being less compatible to the formation of binding pairs between binding members of insufficient complementarity to provide for the desired specificity. Stringent assay conditions are the summation or combination (totality) of both hybridization and wash conditions. The resultant pattern of hybridized nucleic acid provides information regarding expression for each of the genes that have been probed, where the expression information is in terms of whether or not the gene is expressed and, typically, at what level, where the expression data, i.e., expression profile (e.g., in the form of transcriptosome), may be both qualitative and quantitative. Alternatively, non-array-based methods for quantitating the level of one or more nucleic acids in a sample may be employed. These include those based on amplification protocols, e.g., Polymerase Chain Reaction (PCR)-based assays, including quantitative PCR, reverse-transcription PCR (RT-PCR), real-time PCR, and the like, e.g., TaqMan® RT-PCR, MassARRAY® System, BeadArray® technology, and Luminex® technology; and those that rely upon hybridization of probes to filters, e.g., Northern blotting and in situ Examples of some of the nucleic acid sequencing methods listed above are described in the following references: Margulies et al, Nature 2005, 437, 376-80 and references cited therein; Ronaghi et al, Analytical Biochemistry 1996, 242, 84-89 and references cited therein; Shendure et al, Science 2005, 3091728 and references cited therein; Imelfort et al, Brief Bioinform.2009, 10, 609-618 and references cited therein; Fox et al, Methods Mol Biol.2009, 553, 79-108 and references cited therein; Appleby et al, Methods Mol Biol.2009; 513, 19-39 and references cited therein and Morozova et al, Genomics 2008, 92, 255-264 and references cited therein, which are incorporated by reference for the general descriptions of the methods and the particular steps of the methods, including all starting products, reagents, and final products for each of the steps. For measuring protein levels, the amount or level of a polypeptide in the biological sample is determined. In some embodiments, the extracellular protein level is measured. For example, in some cases, the protein (i.e., polypeptide) being measured is a secreted protein (e.g., a cytokine or chemokine) and the concentration can therefore be measured in the extracellular fluid of a biological sample (e.g., the concentration of a protein can be measured in the serum). In some embodiments the concentration is a relative value measured by comparing the level of one protein relative to another protein. In other embodiments the concentration is an absolute measurement of weight/volume or weight/ weight hybridization. In some cases, the cells are removed from the biological sample (e.g., via centrifugation, via adhering cells to a dish or to plastic, etc.) prior to measuring the concentration. In some cases, the intracellular protein level is measured by lysing the removed cells of the biological sample to measure the level of protein in the cellular contents. In some cases, both the extracellular and intracellular levels of protein are measured by separating the cellular and fluid portions of the biological sample (e.g., via centrifugation), measuring the extracellular level of the protein by measuring the level of protein in the fluid portion of the biological sample, and measuring the intracellular level of protein by measuring the level of protein in the cellular portion of the biological sample (e.g., after lysing the cells). In some cases, the total level of protein (i.e., combined extracellular and intracellular protein) is measured by lysing the cells of the biological sample to include the intracellular contents as part of the sample. In some instances, the concentration of one or more additional proteins may also be measured, and biomarker concentration compared to the level of the one or more additional proteins to provide a normalized value for the biomarker concentration. Any convenient protocol for evaluating protein levels may be employed wherein the level of one or more proteins in the assayed sample is determined. While a variety of different manners of assaying for protein levels are known to one of ordinary skill in the art and any convenient method may be used, one representative and convenient type of protocol for assaying protein levels is ELISA, an antibody- based method. In ELISA and ELISA-based assays, one or more antibodies specific for the proteins of interest may be immobilized onto a selected solid surface, preferably a surface exhibiting a protein affinity such as the wells of a polystyrene microtiter plate. After washing to remove incompletely adsorbed material, the assay plate wells are coated with a non-specific "blocking" protein that is known to be antigenically neutral with regard to the test sample such as bovine serum albumin (BSA), casein or solutions of powdered milk. This allows for blocking of non-specific adsorption sites on the immobilizing surface, thereby reducing the background caused by non-specific binding of antigen onto the surface. After washing to remove unbound blocking protein, the immobilizing surface is contacted with the sample to be tested under conditions that are conducive to immune complex (antigen/antibody) formation. Following incubation, the antisera-contacted surface is washed so as to remove non-immunocomplexed material. The occurrence and amount of immunocomplex formation may then be determined by subjecting the bound immunocomplexes to a second antibody having specificity for the target that differs from the first antibody and detecting binding of the second antibody. In certain embodiments, the second antibody will have an associated enzyme, e.g. urease, peroxidase, or alkaline phosphatase, which will generate a color precipitate upon incubating with an appropriate chromogenic substrate. After such incubation with the second antibody and washing to remove unbound material, the amount of label is quantified, for example by incubation with a chromogenic substrate such as urea and bromocresol purple in the case of a case of a peroxidase label or 2,2'-azino-di-(3- ethyl-benzthiazoline)-6-sulfonic acid (ABTS) and H2O2, in the case of a peroxidase label. Quantitation is then achieved by measuring the degree of color generation, e.g., using a visible spectrum spectrophotometer. The preceding format may be altered by first binding the sample to the assay plate. Then, primary antibody is incubated with the assay plate, followed by detecting of bound primary antibody using a labeled second antibody with specificity for the primary antibody. The solid substrate upon which the antibody or antibodies are immobilized can be made of a wide variety of materials and in a wide variety of 30 shapes, e.g., microtiter plate, microbead, dipstick, resin particle, etc. The substrate may be chosen to maximize signal to noise ratios, to minimize background binding, as well as for ease of separation and cost. Washes may be affected in a manner most appropriate for the substrate being used, for example, by removing a bead or dipstick from a reservoir, emptying or diluting a reservoir such as a micro-titer plate well, or rinsing a bead, particle, chromatographic column or filter with a wash solution or solvent. Alternatively, non-ELISA based-methods for measuring the levels of one or more proteins in a sample may be employed. Representative exemplary methods include but are not limited to antibody-based methods (e.g., Western blotting, proteomic arrays, xMAP™ microsphere technology (e.g., Luminex® technology), immunohistochemistry, flow cytometry, and the like) as well as non-antibody-based methods (e.g., mass spectrometry). Biomarkers. The term "biomarker" as used herein means a gene product, i.e. protein or RNA, whose concentration (i.e., "level") and enzymatic activity (function) reports the activity of an administered agent (both level and/or function). The level of any combination of the above positive biomarkers can be measured and utilized in the subject methods. The terms: “a disorder related to ALAS1 expression”, “a disease related to ALAS1 expression”, “pathological process related to ALAS1 expression”, or alike, includes any condition, disorder, or disease in which ALAS1 expression is altered (particularly elevated and/or with enhanced function), the level of one or more porphyrins is altered (commonly elevated), the level and/or activity of one or more enzymes in the heme biosynthetic pathway is altered, or other mechanisms that lead to pathological changes in the heme biosynthetic pathway. The term “subject” to be treated or evaluated includes mammals (human and non- human). The mammal may be human, non-human primate, dog, rodent and alike. Classification of porphyrias is described in Blawani, M. and Desnick, R.J. Blood, 2012, 120(23): 4496-4504 and references cited therein. In the discussion of “levels”, “X” may be used to denote the deviation from another “level”. For example, “2X” is a level two times as large as the comparison level. b) Chemistry Related Definitions Chemical names, common names, and chemical structures may be used interchangeably to describe the structure. If a chemical structure and a chemical name, and an ambiguity exists between the structure and the name, the structure predominates. These definitions apply regardless of whether a term is used by itself or in combination with other terms, unless otherwise indicated. Hence, the definition of “alkyl” applies to “alkyl” portions of “hydroxyalkyl,” “fluoroalkyl,” “-O-alkyl,” etc. As used herein, and throughout this disclosure, the following terms, unless otherwise indicated, shall be understood to have the following meanings: The term “therapeutically effective amount” as used herein, refers to an amount of the compound of Formula (I) and/or additional therapeutic agent, or a composition thereof that is effective in producing the desired therapeutic, ameliorative, inhibitory or preventative effect when administered to a patient suffering from a porphyria, cancer or another disease or disorder of undesirable cell proliferation. In the combination therapies of the present invention, a therapeutically effective amount can refer to each individual agent or to the combination as a whole, wherein the amounts of all agents administered are together effective, but wherein the component agent of the combination may not be present individually in an effective amount. In reference to the treatment of a porphyria and/or a porphyria related sequalae, a therapeutically effective amount, refers to that amount which has the effect of (1) reducing the amount of ALA and/or PBG concentrations in the body or in bodily fluids or tissues, (2) reducing autonomic, peripheral and central nervous symptoms, (3) reducing the expression and/or function of ALAS1, (4) reducing the accumulation of porphyrin precursors and porphyrins and/or (5) relieving to some extent (or preferably, eliminating) one or more signs or symptoms associated with a porphyria. In reference to the treatment of cancer, a therapeutically effective amount, refers to that amount which has the effect of (1) reducing the size of the tumor, (2) inhibiting (that is, slowing to some extent, preferably stopping) tumor metastasis, (3) inhibiting to some extent (preferably stopping) tumor growth or tumor invasiveness and/or (4) relieving to some extent (or preferably, eliminating) one or more signs or symptoms associated with cancer. The term “preventing” as used herein with respect to cancer or a disease or disorder of undesirable cell proliferation, refers to reducing the likelihood or rate of disease or disorder progression. Definitions of the various cancers and/or proliferative diseases to be treated are found in US20220089596A1 and references cited therein. The use of a dashed or dotted line signifies a single bond between said molecular fragment and another defined molecular fragment. For example, the selection of Q1 for Q in Formula (I) yields the following structure: . In another example, the selection of Q2 for Q in Formula (I) yields the following structure: . In another example, the selection of Q3 for Q in Formula (I) yields the following structure: . In another example, the selection of Q4 for Q in Formula (I) yields the following structure: In another example, the selection of Q5 for Q in Formula (I) yields the following structure: In another example, the selection of Q6 for Q in Formula (I) yields the following structure: In another example, the selection of Q7 for Q in Formula (I) yields the following structure: In another example, the selection of Q8 for Q in Formula (I) yields the following structure: In another example, the selection of Q9 for Q in Formula (I) yields the following structure: In another example, the selection of Q10 for Q in Formula (I) yields the following structure: In another example, the selection of Q11 for Q in Formula (I) yields the following structure: In another example, the selection of Q12 for Q in Formula (I) yields the following structure: _. In another example, the selection of Q13 for Q in Formula (I) yields the following structure: In another example, the selection of Q14 for Q in Formula (I) yields the following structure: In another example, the selection of Q15 for Q in Formula (I) yields the following structure: In another example, the selection of Q15 for Q in Formula (I) yields the following structure: In another example, the selection of Q16 for Q in Formula (I) yields the following structure: In another example, the selection of Q17 for Q in Formula (I) yields the following structure: In another example, the selection of Q18 for Q in Formula (I) yields the following structure: In another example, the selection of Q19 for Q in Formula (I) yields the following structure: In another example, the selection of Q20 for Q in Formula (I) yields the following structure: . In another example, the selection of Q21 for Q in Formula (I) yields the following structure:

In another example, the selection of Q22 for Q in Formula (I) yields the following structure: In another example, the selection of Q23 for Q in Formula (I) yields the following structure: The term “alkyl” as used herein, refers to an aliphatic hydrocarbon group having one of its hydrogen atoms replaced with a bond having the specified number of carbon atoms. The alkyl group may be straight chain or branched chain groups. In addition to the term “alkyl”, alkyl groups may be further defined by the number of carbon atom. Alkyl substituents typically contain 1 to 20 carbon atoms “(C1-C20)alkyl”, preferably 1-12 carbon atoms “(C1-C12)alkyl”, more preferably 1 to 8 carbon atoms “(C1- C8)alkyl”, or 1 to 6 carbon atoms “(C1-C6)alkyl”, or 1 to 4 carbon atoms “(C1- C4)alkyl”. In different embodiments, an alkyl group contains from 7-12 carbon atoms “(C7-C12)alkyl” or from 7 to 20 carbon atoms “(C7-C20)alkyl”. Non-limiting examples of alkyl groups include methyl, ethyl, n-propyl, isopropyl, n-butyl, sec-butyl, isobutyl, tert-butyl, n-pentyl, neopentyl, isopentyl, n-hexyl, isohexyl and neohexyl. All alkyl groups described herein may be optionally substituted by one or more substituent groups, which are selected independently unless otherwise indicated. Alkyl groups described herein as substituted alkyl (“substituted alkyl”) will be substituted with one or more substituent groups, which are selected independently unless otherwise indicated. The total number of substituent groups may equal the total number of hydrogen atoms on the alkyl moiety, to the extent such substitution makes chemical sense. Optionally substituted alkyl groups (“optionally substituted alkyl”) typically contain from 1 to 6 optional substituents, preferably from 1 to 4 optional substituents and more preferably from 1 to 3 optional substituents. For example, an optionally substituted ethyl group is “optionally substituted (C2)alkyl” or “(C2)optionally substituted alkyl” and a substituted ethyl group is “substituted (C2)alkyl” or “(C2)substituted alkyl”. Suitable substituent groups for alkyl, “alkyl”, “optionally substituted alkyl” and “substituted alkyl” include, but are not limited to (C3-C8)cycloalkyl, 3-12 membered heterocyclyl, (C6-C12)aryl, 5-12 membered heteroaryl, halo, =O (oxo), =S (thiono), =N-CN, =N-OR ^X , =NR ^X , -CN, -C(O)R ^X , -CO ₂ R ^X , -C(O)NR ^X R ^Y , -SR ^X , -SOR ^X , -SO ₂ R ^X , -SO2NR ^X R ^Y , -NO ₂ , -NR ^X R ^Y , -NR ^X C(O)R ^y , -NR ^X C(O)NR ^X R ^Y , -NR ^X C(O)OR ^X , - NR ^X SO2R ^Y , -NR ^X SO2NR ^X R ^Y , -OR ^X , -OC(O)R ^X and -OC(O)NR ^X R ^Y ; where in each R ^X and R ^Y is independently hydrogen, (C1-C6)alkyl, (C2-C6)alkenyl, (C2-C6)alkynyl, (C3-C6)cycloalkyl, 3-12 membered heterocyclyl, (C6-C12)aryl, or 5-12 membered heteroaryl, or R ^X and R ^Y may be taken together with the nitrogen atom to which they are attached to form a 3-12 membered heterocyclyl or 5-12 membered heteroaryl system, each optionally containing 0, 1 or 2 additional heteroatoms; each R ^X and R ^Y is optionally substituted with 1 to 3 substituents independently selected from the group consisting of halo, =O, -CN, -C(O)R’, -CO ₂ R’, -C(O)NR’ ₂ , -SO ₂ R’, -NR’ ₂ , -OR’, wherein each R’ is independently hydrogen, (C1-C6)alkyl, (C3-C6)cycloalkyl, or 3-12 membered heterocyclyl. However, suitable substituent for “substituted alkyl” does not include hydrogen. “Alkenyl” refers to an alkyl group, as defined herein, consisting of at least two carbon atoms and at least one carbon-carbon bond. Typically, alkenyl groups have 2 to 20 carbon atoms “(C2-C20)alkenyl”, preferably 2 to 12 carbon atoms “(C2-C12)alkenyl”, more preferably 2 to 8 carbon atoms “(C2-C8)alkenyl”, or 2 to 6 carbon atoms “(C2- C6)alkenyl”, or 2 to 4 carbon atoms “(C2-C4)alkenyl”. Representative examples include, but are not limited to, ethenyl, 1-propenyl, 2-propenyl, 1-, 2-, or 3-butenyl, and the like. An alkenyl group may be optionally substituted (“optionally substituted alkenyl”). Suitable substituent groups for alkenyl are as described herein for, “optionally substituted alkyl”, “substituted alkyl” and alkyl. “Alkynyl” refers to an alkyl group, as defined herein, consisting of at least two carbon atoms and at least one carbon-carbon triple bond. Alkynyl groups have 2 to 20 carbon atoms “(C2-C20)alkynyl”, preferably 2 to 12 carbon atoms “(C2-C12)alkynyl”, more preferably 2 to 8 carbon atoms “(C2-C8)alkynyl”, or 2 to 6 carbon atoms “(C2- C6)alkynyl”, or 2 to 4 carbon atoms “(C2-C4)alkynyl”. Representative examples include, but are not limited to, ethynyl, 1-propynyl, 2-propynyl, 1-, 2-, or 3-butynyl, and the like. Any alkynyl groups may be optionally substituted. Suitable substituent groups for alkynyl are as described herein for, “optionally substituted alkyl”, “substituted alkyl” and alkyl. The term “fluoroalkyl,” as used herein, refers to an alkyl group as defined above, wherein one or more of the alkyl group’s hydrogen atoms has been replaced with a fluorine. In one embodiment, a fluoroalkyl group has from 1 to 6 carbon atoms. In another embodiment, a fluoroalkyl group has from 1 to 3 carbon atoms. In another embodiment, a fluoroalkyl group is substituted with from 1 to 3 fluorine atoms. Non- limiting examples of fluoroalkyl groups include -CH ₂ F, -CHF ₂ , and -CF ₃ . The term “(C1-C3) fluoroalkyl” refers to a fluoroalkyl group having from 1 to 3 carbon atoms. The term “(C1)fluoroalkyl” refers to -CH ₂ F, -CHF ₂ , and -CF ₃ . The term “aryl” as used herein, refers to an aromatic monocyclic or multicyclic ring system comprising from 6 to about 14 carbon atoms. In one embodiment, an aryl group contains from about 6 to 10 carbon atoms (C6-C10)aryl. In another embodiment, an aryl group is phenyl. Non-limiting examples of aryl groups include phenyl and naphthyl. Aryl groups may be optionally substituted. Suitable substituent groups for aryl are as described herein for, “optionally substituted alkyl”, “substituted alkyl” and alkyl. The term “cycloalkyl,” as used herein, refers to a saturated ring containing the specified number of ring carbon atoms, and no heteroatoms. Cycloalkyl substituents typically contain 3 to 8 carbon atoms “(C3-C8)cycloalkyl”, preferably 3-7 carbon atoms “(C3-C7)cycloalkyl”, more preferably 3 to 6 carbon atoms “(C3-C6)cycloalkyl”, or 3 to 5 carbon atoms “(C3-C5)cycloalkyl”. Non-limiting examples of monocyclic cycloalkyls include cyclopropyl, cyclobutyl, cyclopentyl, and cyclohexyl. All cycloalkyl groups described herein may be optionally substituted by one or more substituent groups, which are selected independently unless otherwise indicated. Cycloalkyl groups described herein as optionally substituted (“optionally substituted cycloalkyl”) may be substituted by one or more substituents groups, which are selected independently unless otherwise indicated. Cycloalkyl groups described herein as substituted cycloalkyl (“substituted cycloalkyl”) will be substituted with one or more substituent groups, which are selected independently unless otherwise indicated. The total number of substituent groups may equal the total number hydrogen atoms on the cycloalkyl moiety, to the extent such substitution makes chemical sense. Optionally substituted cycloalkyl groups typically contain from 1 to 6 optional substituents, preferably from 1 to 4 optional substituents and more preferably from 1 to 3 optional substituents. For example, an optionally substituted cyclopropyl group is “optionally substituted (C3)cycloalkyl” and a substituted cyclopropyl group is “substituted (C2)cycloalkyl”. In one embodiment a cycloalkyl group contains 3 to 9 carbon atoms, “(C3-C9)cycloalkyl”. In another embodiment a substituted cycloalkyl group contains 3 to 9 carbon atoms, “substituted (C3-C9)cycloalkyl”. Suitable substituent groups for cycloalkyl are as described herein for, “optionally substituted alkyl”, “substituted alkyl” and alkyl. The term “cycloalkenyl” as used herein, refers to partially unsaturated carbocyclic ring system containing the specified number of carbon atoms. Cycloalkenyl substituents typically contain 4 to 8 carbon atoms “(C4-C8)cycloalkenyl” and preferably 5-6 carbon atoms “(C5-C6)cycloalkenyl”. Non-limiting examples of monocyclic cycloalkenyls include cyclobutenyl, cyclopentenyl, cyclohexenyl, and cycloheptenyl. Cycloalkenyl groups described herein may be optionally substituted with one or more substituent groups, which are selected independently unless otherwise indicated. The total number of substituent groups may equal the total number of hydrogen atoms on the cycloalkenyl moiety, to the extent such substitution makes chemical sense. Optionally substituted cycloalkenyl groups typically contain from 1 to 6 optional substituents, preferably from 1 to 4 optional substituents and more preferably from 1 to 3 optional substituents. For example, a cyclopentenyl group is “(C5)cycloalkenyl” and an optionally substituted cyclopentenyl group is “optionally substituted (C5)cycloalkenyl”. In one embodiment a cycloalkenyl group contains 4 to 8 carbon atoms, “(C4-C8)cycloalkenyl”. Suitable substituent groups for cycloalkenyl are as described herein for, “optionally substituted alkyl”, “substituted alkyl” and alkyl. The term “cycloalkylalkyl” as used herein, refers to a cycloalkyl ring, typically a (C3- C9)cycloalkyl, which is connected to the base molecule through an alkylene linker of 1 to 6 carbon atoms “(C1-C6)alkylene”. Cycloalkylalkyl groups are described by the number of carbon atoms in the carbocyclic ring and the number of carbon atoms in the linker. Cycloalkylalkyl groups described herein may be optionally substituted with one or more substituents groups, which are selected independently unless otherwise indicated. Cycloalkylalkyl groups described herein as optionally substituted (“optionally substituted cycloalkylalkyl”) may be substituted by one or more substituent groups, which are selected independently unless otherwise indicated. Cycloalkylalkyl groups described herein as substituted cycloalkylalkyl (“substituted cycloalkylalkyl”) will be substituted with one or more substituent groups, which are selected independently unless otherwise indicated. The total number of substituent groups may equal the total number of hydrogen atoms on the cycloalkylalkyl moiety, to the extent such substitution makes chemical sense. Optionally substituted cycloalkylalkyl groups typically contain from 1 to 6 optional substituents, preferably from 1 to 4 optional substituents and more preferably from 1 to 3 optional substituents. In one embodiment a cycloalkyl group contains 3 to 9 carbon atoms and the linker alkyl group contains 1 to 6 carbon atoms, “(C3-C9)cycloalkyl(C1-C6)alkyl”. For example, cyclopropylethyl group is “(C3)cycloalkyl(C2)alkyl” and an optionally substituted cyclopropylethyl group is “optionally substituted (C3)cycloalkyl(C2)alkyl”. In addition, a substituted cyclopropylethyl group is “substituted (C3)cycloalkyl(C2)alkyl”. Suitable substituent groups for cycloalkylalkyl are as described herein for, “optionally substituted alkyl”, “substituted alkyl” and alkyl. The term “cycloalkenylalkyl” as used herein, refers to a cycloalkenyl ring, typically a (C4-C8)cycloalkenyl, which is connected to the base molecule through an alkylene linker of 1 to 6 carbon atoms “(C1-C6)alkylene”. Cycloalkenylalkyl groups are described by the number of carbon atoms in the carbocyclic ring and the number of carbon atoms in the linker. Thus a “(C5)cycloalkyenyl(C1)alkyl” group is a cyclopentenyl group connected to the base molecule though a methylene group (- CH ₂ -). Cycloalkenylalkyl groups described herein may be optionally substituted with one or more substituent groups, which are selected independently unless otherwise indicated. The total number of substituent groups may equal the total number of hydrogen atoms on the cycloalkenylalkyl moiety, to the extent such substitution makes chemical sense. Optionally substituted cycloalkenylalkyl groups typically contain from 1 to 6 optional substituents, preferably from 1 to 4 optional substituents and more preferably from 1 to 3 optional substituents. In one embodiment a cycloalkenyl group contains 4 to 8 carbon atoms and the linker alkyl group contains 1 to 6 carbon atoms, “(C4-C8)cycloalkenyl(C1-C6)alkyl”. For example, cyclopentenylethyl group is “(C5)cycloalkenyl(C2)alkyl” and an optionally substituted cyclopentenylethyl group is “optionally substituted (C5)cycloalkenyl(C2)alkyl”. Suitable substituent groups for cycloalkenylalkyl are as described herein for, “optionally substituted alkyl”, “substituted alkyl” and alkyl. In some instances, substituted alkyl groups may be specifically named with reference to the substituent group. For example “haloalkyl” refers to an alkyl group having the specified number of carbon atoms that is substituted by one or more halo substituents, and typically contain 1 to 6 carbon atoms and 1, 2 or 3 halo atoms (i.e., “(C1-C6)haloalkyl”). Thus, a (C1-C4)haloalkyl group includes trifluoromethyl (-CF ₃ ) and difluoromethyl (-CF ₂ H). Haloalkyl groups described herein may be optionally substituted with one or more substituent groups, which are selected independently unless otherwise indicated. The total number of substituent groups (the sum of the number of halo and any other substituents defined herein) may equal the total number of hydrogen atoms on the unsubstituted parent alkyl moiety, to the extent such substitution makes chemical sense. For example, for -CH ₂ CH ₂ CH(OH)CH ₂ CF ₃ the parent alkyl moiety is N-pentyl (-(CH ₂ ) ₄ CH ₃ ) with 11 possible positions for substitution. This example is not meant to be limiting. Haloalkyl groups described herein as optionally substituted (“optionally substituted haloalkyl”) may be substituted by one or more substituent groups, which are selected independently unless otherwise indicated. Haloalkyl groups described herein as substituted haloalkyl (“substituted haloalkyl”) will be substituted with one or more substituent groups, which are selected independently unless otherwise indicated. The total number of substituent groups may equal the total number hydrogen atoms on the haloalkyl moiety, to the extent such substitution makes chemical sense. Optionally substituted haloalkyl groups typically contain from 1 to 6 optional substituents, preferably from 1 to 4 optional substituents and more preferably from 1 to 3 optional substituents. For example, an optionally substituted halopropyl group is “optionally substituted (C3)haloalkyl” and a substituted halopropyl group is “substituted (C3)haloalkyl”. In one embodiment a cycloalkyl group contains 1 to 6 carbon atoms, “(C1-C6)haloalkyl”. In another embodiment a substituted haloalkyl group contains 1 to 6 carbon atoms, “substituted (C1-C6)haloalkyl”. Suitable substituent groups for haloalkyl are as described herein for, “optionally substituted alkyl” and “substituted alkyl”. “Alkoxy” refers to a monovalent -O-alkyl group, wherein the alkyl portion has the specified number of carbon atoms. The alkyl portion of the alkoxy group, may be straight chain or branched chain groups. Alkoxy groups typically contain 1 to 8 carbon atoms “(C1-C8)alkoxy”, or 1 to 6 carbon atoms “(C1-C6)alkoxy” or 1 to 4 carbon atoms “(C1-C4)alkoxy”. Non-limiting examples of alkoxy groups include methoxy, ethoxy, n-propoxy, isopropoxy, n-butoxy and t-butoxy. All alkoxy groups described herein may be optionally substituted with one or more substituent groups, which are selected independently unless otherwise indicated. Alkoxy groups described herein as optionally substituted (“optionally substituted alkoxy”) may be substituted by one or more substituent groups, which are selected independently unless otherwise indicated. Alkoxy groups described herein as substituted alkoxy (“substituted alkoxy”) will be substituted with one or more substituent groups, which are selected independently unless otherwise indicated. The total number of substituent groups may equal the total number of hydrogen atoms on the alkoxy moiety, to the extent such substitution makes chemical sense. Optionally substituted alkoxy groups typically contain from 1 to 6 optional substituents, preferably from 1 to 4 optional substituents and more preferably from 1 to 3 optional substituents. For example, an optionally substituted ethoxy group is “optionally substituted (C2)alkoxy” and a substituted butoxy group is “substituted (C4)alkoxy”. In one embodiment an alkoxy group contains 1 to 6 carbon atoms, “(C1-C6)alkoxy”. In another embodiment a substituted alkoxy group contains 1 to 6 carbon atoms, “substituted (C1-C6)alkoxy”. Suitable substituent groups for alkoxy are as described herein for, “optionally substituted alkyl”, “substituted alkyl” and alkyl. “Cycloalkoxy” refers to a monovalent -O-cycloalkyl group, wherein the cycloalkyl portion has the specified number of carbon atoms. The cycloalkyl portion of the alkoxy group, typically contain 3 to 9 carbon atoms “(C3-C9)cycloalkoxy”, or 3 to 6 carbon atoms “(C3-C6)cycloalkoxy”. Non-limiting examples of cycloalkoxy groups include cyclopropoxy, cyclobutoxy and cyclopentoxy. All cycloalkoxy groups described herein may be optionally substituted with one or more substituent groups, which are selected independently unless otherwise indicated. The total number of substituent groups may equal the total number of hydrogen atoms on the cycloalkoxy moiety, to the extent such substitution makes chemical sense. Optionally substituted cycloalkoxy groups typically contain from 1 to 6 optional substituents, preferably from 1 to 4 optional substituents and more preferably from 1 to 3 optional substituents. Suitable substituent groups for cycloalkoxy are as described herein for, “optionally substituted alkyl”, “substituted alkyl” and alkyl. The term “haloalkoxy” refers to a monovalent -O-haloalkyl group wherein the alkyl portion has the specified number of carbon atoms that are substituted by one or more halo substituents, and typically contain 1 to 6 carbon atoms and 1, 2 or 3 halo atoms (i.e., “(C1-C6)haloalkoxy”) In some instances, substituted alkyl groups may be specifically named with reference to the substituent group. For example “haloalkoxy” refers to an alkyl group having the specified number of carbon atoms. Thus, a (C1- C4)haloalkoxy group includes trifluoromethoxy (-OCF ₃ ). Haloalkoxy groups described herein may be substituted by one or more substituent groups, which are selected independently unless otherwise indicated. The total number of substituent groups may equal the total number of hydrogen atoms on the haloalkyl moiety, to the extent such substitution makes chemical sense. Optionally substituted haloalkoxy groups typically contain from 1 to 3 optional substituents and preferably from 1 to 2 optional substituents. In one embodiment a haloalkoxy group contains 1 to 6 carbon atoms, “(C1-C6)haloalkoxy”. An example of a substituted haloalkoxy group contains 1 to 6 carbon atoms, “(C1-C6)haloalkoxy”. Suitable substituent groups for haloalkyloxy are as described herein for, “optionally substituted alkyl” and “substituted alkyl”. The term “halo” as used herein, means -F, -Cl, -Br or -I. In one embodiment, a halo group is -Cl. In another embodiment, a halo group is -Br. The term “halogen” as used herein, means -F, -Cl, -Br or -I. In one embodiment, a halogen group is -Cl. In another embodiment, a halogen group is -Br. The term “acyl” as used herein means -C(O)alkyl or -C(O)cycloalkyl. The alkyl group may be straight chain or branched chain groups. Alkyl substituent of an acyl group typically contain 1 to 20 carbon atoms, preferably 1-12 carbon atoms, more preferably 1 to 8 carbon atoms, 1 to 6 carbon atoms, or 1 to 4 carbon atoms. The cycloalkyl substituent of an acyl group typically contain 3 to 8 carbon atoms, preferably 3-7 carbon atoms, more preferably 3 to 6 carbon atoms, or 3 to 5 carbon atoms. The alkyl and cycloalkyl moieties of an acyl group may be substituted. Suitable substituent groups are as described herein for, “optionally substituted alkyl”, “substituted alkyl” and alkyl. The term “aryl” or “aromatic” refer to an optionally substituted monocyclic biaryl or fused bicyclic ring systems, having the well-known characteristics of aromaticity, wherein at least one ring contains a completely conjugated pi-electron system. Typically, aryl groups contain 6 to 20 carbon atoms, “(C6-20)aryl” as ring members, preferably 6 to 14 carbon atoms “(C6-C14)aryl” or more preferably 6 to 12 carbon atoms “(C6-C12)aryl”. Fused aryl groups may include an aryl ring (e.g., a phenyl ring) fused to another aryl ring, or fused to a saturated or partially unsaturated carbocyclic or heterocyclic ring. The point of attachment to the base molecule on such fused aryl ring systems may be a carbon atom of the aromatic portion or a carbon or nitrogen atom of the non-aromatic portion of the ring system. Example, without limitation, of aryl groups include phenyl, biphenyl, naphthyl, anthracenyl, phenanthrenyl, indanyl, indenyl, and tetrahydronaphthyl. Aryl groups described herein may be optionally substituted with one or more substituents groups, which are selected independently unless otherwise indicated. Suitable substituent groups for the aryl group are further described herein. The term “heteroaryl” or heteroaromatic” may be used interchangeably herein, to refer to an aromatic monocyclic or multicyclic ring system comprising about 5 to about 14 ring atoms, wherein from 1 to 4 of the ring atoms is independently N, O, or S and the remaining ring atoms are carbon atoms. These systems having the well- known characteristics of aromaticity. Heteroaryl rings are attached to the base molecule via a ring atom of the heteroaromatic ring, such that aromaticity is maintained. The inclusion of a heteroatom permits aromaticity in 5-membered rings as well as 6 membered rings. In one embodiment, a heteroaryl group has 5 to 10 ring atoms. In another embodiment, a heteroaryl group is a monocyclic ring system and has 5 to 6 ring atoms. In another embodiment, a heteraryl group is a bicyclic ring system. The term “heteroaryl” also includes a heteroaryl, as defined above, fused to a heterocyclyl as defined below. The term “heteroaryl” also encompasses a heteroaryl group, as defined above, which is fused to a benzene, a cyclohexadiene or a cyclohexane ring. Non-limiting examples of heteroaryls include pyridyl, pyrazinyl, furanyl, thienyl, pyrimidinyl, pyridine (including N-substituted pyridines), isoxazolyl, isothiazolyl, oxazolyl, oxadiazolyl, thiazolyl, pyrazonyl, furyl, pyrrolyl, triazolyl, 1,2,4-thiadiazolyl, pyrazinyl, pyridazinyl, indolyl, quinoxalinyl, phthalazinyl, oxindolyl, imidazo[1,2-a]pyridinyl, imidazo[2,1-b]thiazolyl, and alike. Heteroaryl or heteroaromatic groups described herein may be optionally substituted with one or more substituents groups, which are selected independently unless otherwise indicated. Suitable substituent groups for the heteroaryl or heteroaromatic groups are further described herein. The terms “heterocyclyl”, “heterocyclic” or “heteroalicyclic” may be used interchangeably herein, to refer to a non-aromatic saturated or partially saturated monocyclic or multicyclic ring system containing 3 to 11 ring atoms, wherein from 1 to 4 of the ring atoms are independently O, S, or N and the remainder of the ring atoms are carbon atoms. In one embodiment, a heterocyclic group is monocyclic and has 6 ring atoms, “6-membered heterocyclic ring”. In another embodiment, a heterocyclic group is monocyclic and has 6 ring atoms with either 1 or 2 ring atoms being a heteroatom, “6-membered heterocyclic ring containing 1 or 2 heteroatoms”. In another embodiment, a heterocyclic group is monocyclic and has either 4 or 5 ring atoms, “4- or 5-membered heterocyclic ring”. In another embodiment, a heterocyclic group has 7, 8 or 9 ring atoms, “7-, 8- or 9-membered heterocyclic ring”. In another embodiment, a heterocyclic group is bicyclic. A heterocyclic group can be joined to the rest of the molecule via a ring carbon or ring nitrogen atom. The nitrogen or sulphur atom of the heterocyclyl can be optionally oxidized to the corresponding N- oxide, S-oxide or S,S-dioxide. Any carbon atom bearing two hydrogens may be optionally oxidized to the corresponding carbonyl. Non-limiting examples of the monocyclic heterocyclic rings include oxetanyl, piperidyl, pyrrolidinyl, piperazinyl, morpholinyl, thiomorpholinyl, thiazolidinyl, dihydropyranyl, pyran, 1,4-dioxanyl, tetrahydrofuranyl, tetrahydrothiophenyl, delta-lactam, delta-lactone and the like. Heterocyclic groups described herein may be optionally substituted with one or more substituents groups, which are selected independently unless otherwise indicated. Suitable substituent groups for the heterocyclic groups are further described herein. Heterocyclic groups may be unsubstituted or substituted by the same groups suitable for alkyl, aryl or heteroaryl. In one embodiment a heterocyclic ring contains 6 atoms and is substituted with 1 to 4 groups as defined herein, “6-membered heterocyclic ring substituted with one to four groups”. In addition, ring nitrogen atoms may be optionally substituted, when specified, by groups suitable for an amine, e.g., alkyl, acyl, carbamoyl, sulfonyl substituents, etc., and ring S atoms may be optionally substituted by 1 or 2 oxo groups (i.e., S(O) _q , where q is 0, 1 or 2). In one embodiment a 4 or 5 membered heterocyclic ring is optionally substituted, as given above, “optionally substituted 4- or 5-membered heterocyclic ring”. In another embodiment, a 7, 8- or 9-membered heterocyclic ring is optionally substituted, as given above, “optionally substituted 7-, 8- or 9-membered heterocyclic ring”. Aryl, heteroaryl and heterocyclic moieties described herein as optionally substituted (“optionally substituted”) may be substituted by one or more substituent groups, which are selected independently unless otherwise indicated. Aryl, heteroaryl and heterocyclic moieties described herein as substituted (“substituted”) are substituted by one or more substituent groups, which are selected independently unless otherwise indicated. Optionally substituted aryl, heteroaryl or heterocyclic groups typically contain from 1 to 5 optional substituents, sometimes 1 to 4 optional substituents, preferably 1 to 3 optional substituents, or more preferably 1-2 optional substituents. Substituted aryl, heteroaryl or heterocyclic groups contain at least one substituent as described herein and may optionally contain up to 5 total substituents each independently selected. The substituent groups used are the substituent groups suitable for use as described herein. Substituent groups suitable for aryl, heteroaryl and heterocyclic rings include, but are not limited to: (C1-C8)alkyl, (C2-C8)alkenyl, (C2-C8)alkynyl, (C3-C8)cycloalkyl, 3-12 membered heterocyclyl, (C6-C12)aryl, 5-12 membered heteroaryl, halo, =O (oxo), =S (thiono), =N-CN, =N-OR ^X , =NR ^X , -CN, -C(O)R ^X , -CO ₂ R ^X , -C(O)NR ^X R ^Y , -SR ^X , -SOR ^X , -SO2R ^X , -SO2NR ^X R ^Y , -NO ₂ , -NR ^X R ^Y , -NR ^X C(O)R ^y , -NR ^X C(O)NR ^X R ^Y , -NR ^X C(O)OR ^X , - NR ^X SO2R ^Y , -NR ^X SO2NR ^X R ^Y , -OR ^X , -OC(O)R ^X and -OC(O)NR ^X R ^Y ; where in each R ^X and R ^Y is independently hydrogen, (C1-C6)alkyl, (C2-C6)alkenyl, (C2-C6)alkynyl, (C3-C6)cycloalkyl, 3-12 membered heterocyclyl, (C6-C12)aryl, or 5-12 membered heteroaryl, or R ^X and R ^Y may be taken together with the nitrogen atom to which they are attached to form a 3-12 membered heterocyclyl or 5-12 membered heteroaryl system, each optionally containing 0, 1 or 2 additional heteroatoms; each R ^X and R ^Y is optionally substituted with 1 to 3 substituents independently selected from the group consisting of halo, =O, -CN, -C(O)R’, -CO ₂ R’, -C(O)NR’ ₂ , -SO ₂ R’, -NR’ ₂ , -OR’, wherein each R’ is independently hydrogen, (C1-C6)alkyl, (C3-C6)cycloalkyl, or 3-12 membered heterocyclyl. However, suitable substituent for “substituted alkyl” does not include hydrogen. “Unsubstituted amino” refers to a group -NH ₂ . Where the amino is described as substituted or optionally substituted, the term includes groups of the form -NR _X R _Y , where each R _X and R _Y is independently selected from hydrogen, (C1-C8)alkyl, (C3- C9)cycloalkyl, alkynyl, heterocyclyl, acyl, aryl, heteroaryl, thioacyl, cycloalkylalkyl, arylalkyl, or heteroalkylalkyl, in each case having the specified number of atoms and optionally substituted as described herein. Typically, alkyl substituents on amines contain 1 to 8 carbon atoms, preferably 1 to 6 carbon atoms, or more preferably 1 to 4 carbon atoms. The term also includes forms wherein R _X and R _Y are taken together with the nitrogen to which they are attached to form a 3-12 membered heterocyclyl or 5-12 membered heteroaryl ring, each of which may be optionally substituted as described herein for heterocyclyl or heteroaryl rings and which may contain 1 to 3 additional heteroatoms selected from N, O, and S as ring members, provided that such rings do not contain contiguous oxygen atoms or contiguous sulphur atoms. The term, as described above, extends to the amino residue of another functional group (for example, -C(O)NR _X R _Y , -S(O) ₂ NR _X R _Y , and alike). In one embodiment, R _X and R _Y of -NR _X R _Y ; of -C(O)NR _X R _Y , may be taken together with the nitrogen to which they are attached (“taken together with the nitrogen to which they are attached”) to form a ring (a 3-12 membered heterocyclyl or 5-12 membered heteroaryl ring, each of which may be optionally substituted as described herein for heterocyclyl or heteroaryl rings and which may contain 1 to 3 additional heteroatoms selected from N, O, and S as ring members, provided that such rings do not contain contiguous oxygen atoms or contiguous sulphur atoms). In another embodiment, R _X and R _Y of - NR _X R _Y ; of -S(O) ₂ NR _X R _Y , may be taken together with the nitrogen to which they are attached to form a ring (a 3-12 membered heterocyclyl or 5-12 membered heteroaryl ring, each of which may be optionally substituted as described herein for heterocyclyl or heteroaryl rings and which may contain 1 to 3 additional heteroatoms selected from N, O, and S as ring members, provided that such rings do not contain contiguous oxygen atoms or contiguous sulphur atoms). Two adjacent substituents on a ring may be taken together, with the atoms to which they are attached, to form a ring. The term “together with the carbon atoms to which they are attached may form a ring” is defined herein to mean two adjacent residues residing on a ring may be combined together with the carbon atoms to which they are attached to form a 4-6 membered heterocyclyl, a 4-6 membered carbocyclyl, or a 4-6 membered heteroaryl ring, each of which may be optionally substituted as described herein for heterocyclyl or heteroaryl rings. Thus formed heterocyclyl and heretoaryl rings may contain 1 to 3 additional heteroatoms selected from N, O, and S as ring members, (provided that such rings do not contain contiguous oxygen atoms or contiguous sulphur atoms). Representative examples derived from a phenyl moiety include, but are not limited to, benzofuranyl, benzothiophenyl, indolyl, benzimidazolyl, indazolyl, benzotrizolyl, indazolyl, quinolinyl, isoquinolinyl, cinnolinyl, azaquinazoline, quinoxalinyl, 2,3-dihydro-1H-indenyl, phthalanyl, 2,3-dihydrobenzofuryl, benzodioxoyl, benzodioxanyl, and the like. Representative examples thus formed hetereocyclyl rings include, but are not limited to: and alike. Representative examples thus formed carbocyclyl rings include, but are not limited to: and alike. Two substituents bound to a common carbon may be taken together with the carbon to which they are attached to form a ring. The term “together with the carbon to which they are attached may form a nonaromatic ring having 2 oxygen atoms” is defined herein to mean two alkoxy or two oxygen substituted alkyl groups may be combined with the carbon atom to which they are attached to form a ring of 4 to 7 atoms containing two oxygen atoms. Representative examples thus formed heterocyclic rings include but are not limited to:

and alike. Two substituents bound to a common nitrogen atom may be taken together, with the nitrogen to which they are attached, to form a ring. The term “together with the nitrogen atom to which they are attached may form a ring” is defined herein to mean two residues residing on a nitrogen atom may be combined together to form a 3-12- membered heterocyclyl, a 3-7-membered carbocyclyl, or a 5-12-membered heteroaryl ring, each of which may be optionally substituted as described herein for heterocyclyl or heteroaryl rings. Thus formed heterocyclyl and heteroaryl rings may contain 1 to 3 additional heteroatoms selected from N, O, and S as ring members, (provided that such rings do not contain contiguous oxygen atoms or contiguous sulphur atoms). Non-limiting examples derived from a nitrogen atom include the following moieties: azetidinyl, pyrrolidinyl, piperidinyl, morpholinyl, 1,4-azathianyl, 1,3,4-triazolyl, tetrazolyl, imidazolyl and alike. Two substituents may be taken together to form an oxo residue (=O). “R5 and R6 may be taken together to form =O” means an oxygen atom is double bonded to the carbon atom that had both R5 and R6 residues. For 1A that would result in the following substructure, see 1AA. In addition, for “R7 and R8 may be taken together to form =O” means an oxygen atom is double bonded to the carbon atom that had both R7 and R8 residues, see 1AB. The term “substituted” means that one or more hydrogen atoms of the designated are replaced with a selection from the indicated group, provided that the atoms’ normal valencies under the existing circumstances are not exceeded, and that the substitution results in a stable compound. By “stable compound” or “stable structure” means a compound that is sufficiently robust to survive isolation to a useful degree of purity from a reaction mixture, and formulation into an efficacious therapeutic agent. When any substituent or variable occurs more than one time in any constituent or the compound of Formula (I), its definition on each occurrence is independent of its definition at every other occurrence, unless otherwise indicated. The term “in purified form” as used herein, refers to the physical state of a compound after the compound is isolated from a synthetic process (e.g., from a reaction mixture), a natural source, or a combination thereof. The term “in purified form” also refers to the physical state of a compound after the compound is obtained from a purification process or processes described herein or well-known to the skilled artisan (e.g., chromatography, recrystallization and the like). It should be noted that any carbon as well as heteroatom with unsatisfied valences in the text, schemes, examples and tables herein is assumed to have the sufficient number of hydrogen atom(s) to satisfy the valences. Compounds may be known by one or more designations. For example, ONC201 is also TIC10. Other compounds may be referred to by a designation that begins with “TR”. With regard to these agents the following example shows the nomenclature that refers to the same chemical compound. For example, the following refer to the same compound: TR57, TR-57, Tr57, Tr-57, tr-57 and tr57. One or more compounds of the invention may exist in unsolvated as well as solvated forms with pharmaceutically acceptable solvents such as water, ethanol, and the like, and it is intended that the invention embrace both solvated and unsolvated forms. The compounds of Formula (I) may contain one or more stereogenic centers and can thus occur as racemates, racemic mixtures, single enantiomers, diastereomeric mixtures and individual diastereomers. Each such asymmetric center will independently produce two optical isomers and it is intended that all of the possible optical isomers and diastereomers in mixtures and as pure or partially purified compounds are included within the ambit of this invention. As used herein, the term “composition” is intended to encompass a product comprising the specified ingredients in the specified amounts, as well as any product which results, directly or indirectly, from combination of the specified ingredients in the specified amounts. In the compounds of generic Formula (I) and compounds of the generic formulas, 1A, 2A, 3A, 4A, 5A, 6A, 7A, 8A, 9A, 10A, 11A, 12A, 13A, 14A, 15A, 16A, 17A, 18A, 19A, 20A, 21A, 22A, 23A, 24A and A25 the atoms may exhibit their natural isotopic abundances, or one or more of the atoms may be artificially enriched in a particular isotope having the same atomic number, but an atomic mass or mass number different from the atomic mass or mass number predominantly found in nature. The present invention is meant to include all suitable isotopic variations of the compounds of generic Formula (I) and compounds of the generic formulas, 1A, 2A, 3A, 4A, 5A, 6A, 7A, 8A, 9A, 10A, 11A, 12A, 13A, 14A, 15A, 16A, 17A, 18A, 19A, 20A, 21A, 22A, 23A, 24A and A25 Enriching in a particular isotope may provide an advantageous characteristic(s), for example enriching for deuterium may afford certain therapeutic advantages, such as increasing in vivo half-life or reducing dosages. In addition, isotopic enrichment may also enrich a compound’s usefulness in the characterization of biological samples. Compounds enriched in a specific isotope may be prepared via synthetic methods described herein and methods known to those skilled in the art by using reagents and starting material enriched with the specific isotope. Prodrugs of the compounds of the invention are contemplated herein. The term “prodrug”, as employed herein, denotes a compound which upon administration to a subject, undergoes chemical conversion by metabolic or chemical processes to yield a compound of Formula (I). Prodrugs may have beneficial properties, such as but not limited to, the enhancement of absorption and/or oral bioavailability. The compounds of Formula (I) may in some cases form salts which are also with the scope of this invention. Reference to a compound of the formula (I) herein is understood to include reference to salts thereof, unless otherwise noted. The term “salt(s)” as used herein denotes acidic and/or basic salts formed with inorganic and/or organic acids and bases. Zwitterionic (internal or inner salts) are included within the term “salt(s)” as used herein (and may be formed, for example, where the R substituents comprise an acid moiety such as a carboxyl group). Also included herein are quaternary salts ammonium salts such as alkylammonium salts. Pharmaceutically acceptable (i.e., non-toxic, physiologically acceptable) salts are preferred, although other salts are useful, for example, in isolation or purification steps which may be employed during preparation. Salts of the compounds of the Formula (I) may be formed, for example, by reacting a compound of Formula (I) by reacting a compound of Formula (I) with an equivalent amount of an acid or base in a medium such as one the allows for the precipitation of the salt (example, ether) or in an aqueous medium followed by lyophilization. Exemplary acid addition salts include acetates, ascorbates, benzoates, benzenesulfonates, bisulfates, borates, butyrates, citrates, camphorates, camphorsulfonates, fumarates, hydrochlorides, hydrobromides, hydroiodides, lactates, maleates, methanesulfonates, naphthalenesulfonates, nitrates, oxalates, phosphates, propionates, salicylates, succinates, sulfates, tartarates, thiocyanates, toluenesulfonates (also known as tosylates), and the like. Additionally, acids which are generally considered suitable for the formation of pharmaceutically useful salts from basic pharmaceutical compounds are discussed, for example by P. Stahl et al, Camille G. (eds.) Handbook of Pharmaceutical Salts. Properties, Selection and Use. (2002) Zurich: Wiley-VCH. This disclosure is incorporated herein by reference. Exemplary basic salts include ammonium salts, alkali metal salts such as sodium, lithium, and potassium salts, alkaline earth metal salts such as calcium and magnesium salts, salts with organic bases (for example, organic amines) such as dicyclohexylamines, t-butyl amines, and salts with amino acids such as arginine, lysine and the like. Basic nitrogen-containing groups may be quarternized with agents such as lower alkyl halides (e.g., methyl, ethyl, and butyl chlorides, bromides and iodides), dialkyl sulfates (e.g., dimethyl, diethyl, and dibutyl sulfates), long chain halides (e.g., decyl, lauryl, and stearyl chlorides, bromides and iodides), aralkyl halides (e.g., benzyl and phenethyl bromides), and others. The present invention further includes compounds of Formula (I) in all their isolated forms. This invention provides a method to decrease ALAS1 protein expression levels in a cell by exposing the cell to a compound of Formula I, or a pharmaceutically acceptable salt thereof. In addition, this invention provides a method to treat a subject in need of such treatment with a compound of Formula I, or a pharmaceutically acceptable salt thereof. This invention also provides methods of determining whether a subject is a candidate for treatment with a compound of Formula I or a pharmaceutically acceptable salt, and whether the subject is responsive and/or provided therapeutic benefit from a compound of the general Formula I, or a pharmaceutically acceptable salt thereof, the method comprising: administering the compound of Formula I, or pharmaceutically acceptable salt, to an individual after isolating a pre-treatment biological sample, and before isolating a post-treatment biological sample of the sample type of biological sample, wherein the biological sample is selected from a blood sample, a urine sample, a sample of a bodily fluid, a serum sample, a plasma sample, a bone sample, a biopsy sample, a fine needle aspirate, a lymph node aspirate, a cystic aspirate, a paracentesis sample, a thoracentesis sample; assaying the pre-treatment and post-treatment biological samples to determine the level of the biomarker (such as porphyrins or porphyrin precursors such as ALA and/or PBG or ALAS1 (this is not meant to be limiting)), and determining that the individual is a candidate for treatment with a compound of Formula I when the level of the pre-treatment biomarker is greater than normal levels and/or reference levels, or determining if the individual is responsive to treatment with a compound of Formula I, or pharmaceutically acceptable salt, when the level of the biomarker is reduced relative to the level of the pre-treatment biomarker and/or reference level. Alternatively, it can be determined that an individual is a candidate for treatment with a compound of Formula I when the level of the pre-treatment biomarker is less than than normal levels and/or reference levels, and/or if the individual is responsive to treatment with a compound of Formula I, or pharmaceutically acceptable salt, when the level of the biomarker is increased relative to the level of the pre-treatment biomarker and/or reference level. This invention provides compounds of Formula I, or a pharmaceutically acceptable salt thereof, wherein: ; Q is independently selected from the group consisting of: ,

Ar1 and Ar2 are independently selected from aryl, heteroaryl, thiophenyl and phenyl; Ar1 may be optionally substituted with from 1 to 5 J groups; Ar2 is optionally substituted with from 1 to 5 JJ groups; J is independently selected from halogen, -CN, (C1-C6)optionally substituted alkyl, (C3-C9)optionally substituted cycloalkyl, (C3-C9)cycloalkyl(C1-C6)alkyl, (C1- C6)haloalkyl, -CF ₃ , -NH ₂ , -NO ₂ , -SH, -SR15, -OH, (C1-C6)optionally substituted alkoxy, -NR17R18, substituted (C3-C9)cycloalkyl(C1-C6)alkyl, (C3- C9)cycloalkyl(C2-C6)alkynyl, (C4-C8)cycloalkenyl, (C4-C8)cycloalkenyl(C1- C6)alkyl, aryl, heteroaryl, heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclyl, -C(O)OH, -C(O)OR15, - OC(O)OR15, (C2-C6)alkynyl, (C2-C8)alkenyl, (C1-C6)haloalkyoxy, -S(O) ₂ OR15, - SO ₂ NR17R18, -S(O) ₂ R15, -NR15S(O) ₂ R16, -C(O)NR17R18, -C(O)R15, and - NR15C(O)R16; JJ is independently selected from hydrogen, halogen, -CN, (C1-C6)optionally substituted alkyl, (C3-C9)optionally substituted cycloalkyl, (C3-C9)cycloalkyl(C1- C6)alkyl, (C1-C6)haloalkyl, -CF ₃ , -NH ₂ , -NO ₂ , -SH, -SR15, -OH, (C1-C6)optionally substituted alkoxy, -NR17R18, substituted (C3-C9)cycloalkyl(C1-C6)alkyl, (C3- C9)cycloalkyl(C2-C6)alkynyl, (C4-C8)cycloalkenyl, (C4-C8)cycloalkenyl(C1- C6)alkyl, aryl, heteroaryl, -C(O)OH, -C(O)OR15, -OC(O)OR15, (C2-C6)alkynyl, (C2-C8)alkenyl, (C1-C6)haloalkyoxy, -S(O) ₂ OR15, -SO ₂ NR17R18, -S(O) ₂ R15, - NR15S(O) ₂ R16, -C(O)NR17R18, -C(O)R15, and -NR15C(O)R16; R1, R2, R3, R4, R5, R6, R7 and R8 are each independently selected from hydrogen, halogen and (C1-C3)optionally substituted alkyl; R9, R10, R11 and R12 are each independently selected from the group consisting of hydrogen, halogen, (C3-C6)cycloalkyl and (C1-C6)optionally substituted alkyl; R10 and R11 together with the carbons atoms to which they are attached may form a nonaromatic ring having 3 to 6 carbon atoms; R13 is independently selected from the group consisting of hydrogen, (C1- C6)optionally substituted alkyl, (C3-C6)optionally substituted cycloalkyl, (C1- C6)haloalkyl, (C2-C6)optionally substituted alkenyl, (C2-C6)optionally substituted alkynyl, -CN, -S(O) ₂ R15, -NR17R18, -S(O) ₂ R15, -C(NH)NH ₂ , -C(O)R15, ZW, and - C(O)OR15; R14 is independently selected from hydrogen, (C1-C6)optionally substituted alkyl, (C3- C6)cycloalkyl, (C1-C6)haloalkyl, (C2-C6)optionally substituted alkenyl, (C2- C6)optionally substituted alkynyl, -CN, -CF ₃ , -OCF ₃ , -SR15, -OR15, -S(O) ₂ R15, - NR17R18, -S(O) ₂ R15, -C(NH)NH ₂ , -C(O)R15, -C(O)OR15 and heterocyclyl; R15, R16, R17, R18, R19, R28 and R29 are independently selected from hydrogen and (C1-C6) optionally substituted alkyl; R17 and R18 together with nitrogen to which they are attached may form a ring of 3 to 6 atoms; ZW is an (C1-C6)optionally substituted alkyl with dye; W1 and W2 are independently selected from: nitrogen and W3 is independently selected from oxygen, -N(R15)-, and sulphur; W4 is independently selected from the group consisting of =C(R14)- and nitrogen; W5 is independently selected from the group consisting of a single bond, SS and ; W6 is independently selected from the group consisting of oxygen, sulphur, and -NR ₁₄ ; A is independently selected from the group consisting of SS and ; G is independently selected from the group consisting of SS and ; M is independently selected from the group consisting of SS and E is independently selected from the group consisting of a single bond, SS, and SS is independently selected from the group consisting of: SpA is independently selected from the group consisting of heterocyclyl, heteroaryl, 5- membered heterocyclyl, 5-membered heteroaryl, optionally substituted 5- membered heterocyclyl and optionally substituted 5-membered heteroaryl; R20, R21, R26 and R27 are each independently selected from the group consisting of hydrogen, halogen and (C1-C6)optionally substituted alkyl; R22, R23, R24 and R25 are each independently selected from the group consisting of hydrogen, halogen, -CN, (C1-C6)optionally substituted alkyl, (C3-C9)optionally substituted cycloalkyl, (C3-C9)cycloalkyl(C1-C6)alkyl, (C1-C6)haloalkyl, -NH ₂ , - NO ₂ , -SH, -SR15, -OH, (C1-C6)optionally substituted alkoxy, -NR17R18, substituted (C3-C9)cycloalkyl(C1-C6)alkyl, (C3-C9)cycloalkyl(C2-C6)alkynyl, (C4- C8)cycloalkenyl, (C4-C8)cycloalkenyl(C1-C6)alkyl, aryl, heteroaryl, -C(O)OH, - C(O)OR15, -OC(O)OR15, (C2-C6)alkynyl, (C2-C8)alkenyl, (C1-C6)haloalkyoxy, - S(O) ₂ OR15, -SO ₂ NR17R18, -S(O) ₂ R15, -NR15S(O) ₂ R16, -C(O)NR17R18, - C(O)R15, and -NR15C(O)R16; R22 and R23 together with the carbon to which they are attached may form a nonaromatic ring having 3 to 6 carbon atoms; R22 and R23 together with the carbon to which they are attached may form a nonaromatic ring having 1-2 oxygen atoms; R24 and R25 together with the carbon to which they are attached may form a nonaromatic ring having 1-2 oxygen atoms; R24 and R25 together with the carbon to which they are attached may form a nonaromatic ring having 3 to 6 carbon atoms; R30 and R31 are each is independently selected from the group consisting of hydrogen and (C1-C6)optionally substituted alkyl. This invention provides a method of decreasing ALAS1 protein expression levels in a cell or a mammal or a subject by exposing the cell or mammal or a subject to a compound of Formula I or a pharmaceutically acceptable salt thereof, comprising (a) providing the compound in a form comprising: Z1-Q Formula I. Embodiments of this invention include other biomarkers as described in this invention. These include the use of positive biomarkers described herein. In addition, this invention may use negative biomarkers. Also, negative biomarkers described herein may be used. This invention provides compounds of Formula 1A: or pharmaceutically acceptable salt thereof. This invention provides compounds of Formula 2A: or pharmaceutically acceptable salt thereof. This invention provides compounds of Formula 3A: or pharmaceutically acceptable salt thereof. This invention provides compounds of Formula 4A: or pharmaceutically acceptable salt thereof. This invention provides compounds of Formula 5A: . or pharmaceutically acceptable salt thereof. This invention provides compounds of Formula 6A: or pharmaceutically acceptable salt thereof. This invention provides compounds of Formula 7A: or pharmaceutically acceptable salt thereof. This invention provides compounds of Formula 8A: or pharmaceutically acceptable salt thereof. This invention provides compounds of Formula 9A: 9A or pharmaceutically acceptable salt thereof. This invention provides compounds of Formula 10A: or pharmaceutically acceptable salt thereof. This invention provides compounds of Formula 11A: or pharmaceutically acceptable salt thereof. This invention provides compounds of Formula 12A: or pharmaceutically acceptable salt thereof. This invention provides compounds of Formula 13A: or pharmaceutically acceptable salt thereof. This invention provides compounds of Formula 14A:

or pharmaceutically acceptable salt thereof. This invention provides compounds of Formula 15A: or pharmaceutically acceptable salt thereof. This invention provides compounds of Formula 16A: or pharmaceutically acceptable salt thereof. This invention provides compounds of Formula 17A: 17A or pharmaceutically acceptable salt thereof. This invention provides compounds of Formula 18A: or pharmaceutically acceptable salt thereof. This invention provides compounds of Formula 19A: or pharmaceutically acceptable salt thereof. This invention provides compounds of Formula 20A: or pharmaceutically acceptable salt thereof. This invention provides compounds of Formula 21A:

or pharmaceutically acceptable salt thereof. This invention provides compounds of Formula 22A: 22A or pharmaceutically acceptable salt thereof. This invention provides compounds of Formula 23A: or pharmaceutically acceptable salt thereof. This invention provides compounds of Formula 24A: 24A This invention provides compounds of Formula 25A: or pharmaceutically acceptable salt thereof. The various radicals and/or variables for 1A, 2A, 3A, 4A, 5A, 6A, 7A, 8A, 9A, 10A, 11A, 12A, 13A, 14A, 15A, 16A, 17A, 18A, 19A, 20A, 21A, 22A, 23A, 24A and 25A are defined herein as for Formula (I). In another embodiment the present invention provides for the compounds and pharmaceutically acceptable salts of the formulas 1A, 2A, 3A, 4A, 5A, 6A, 7A, 8A, 9A, 10A, 11A, 12A, 13A, 14A, 15A, 16A, 17A, 18A, 19A, 20A, 21A, 22A, 23A, 24A and 25A. In another embodiment the present invention provides for the compounds and pharmaceutically acceptable salts of the formulas 1A, 2A, 3A, 4A, 5A, 6A, 7A, 8A, 9A, 10A, 11A, 12A, 13A, 14A, 15A, 16A, 17A, 18A, 18A, 20A, 21A, 22A, 23A, 24A and 25A wherein: substituted with 0-5 J groups; substituted with 1-5 JJ groups. In another embodiment the present invention provides for the compounds and pharmaceutically acceptable salts of the formulas 1A, 2A, 3A, 4A, 5A, 6A, 7A, 8A, 9A, 10A, 11A, 12A, 13A, 14A, 15A, 16A, 17A, 18A, 19A, 20A, 21A, 22A, 23A, 24A and 25A wherein: Z1 is substituted with 1 J group; Z2 is substituted with 1-5 JJ groups. In another embodiment the present invention provides for the compounds and pharmaceutically acceptable salts of the formulas 1A, 2A, 3A, 4A, 5A, 6A, 7A, 8A, 9A, 10A, 11A, 12A, 13A, 14A, 15A, 16A, 17A, 198A, 19A, 20A, 21A, 22A, 23A, 24A and 25A wherein: Z1 is substituted with 1 J group; Z2 is substituted with 1 JJ group. In another embodiment the present invention provides for the compounds and pharmaceutically acceptable salts of the formulas 1A, 2A, 3A, 4A, 5A, 6A, 7A, 8A, 9A, 10A, 11A, 12A, 13A, 14A, 15A, 16A, 17A, 18A, 19A, 20A, 21A, 22A, 23A, 24A and 25A wherein: Z1 is Z2 is substituted with 1-5 JJ groups. In another embodiment the present invention provides for the compounds and pharmaceutically acceptable salts of the formulas 1A, 2A, 3A, 4A, 5A, 6A, 7A, 8A, 9A, 10A, 11A, 12A, 13A, 14A, 15A, 16A, 17A, 18A, 19A, 20A, 21A, 22A, 23A, 24A and 25A wherein: Z1 is ; Z2 is substituted with 1 JJ group. In another embodiment the present invention provides for the compounds and pharmaceutically acceptable salts of the formulas 1A, 2A, 3A, 4A, 5A, 6A, 7A, 8A, 9A, 10A, 11A, 12A, 13A, 14A, 15A, 16A, 17A, 18A, 19A, 20A, 21A, 22A, 23A, 24A and 25A wherein: Z1 is substituted with 1 J group; Z2 is substituted with 1 JJ group; R5, R6, R7, R8, R9, R10, R11 and R12 are hydrogen; R14 is independently selected from hydrogen, (C1-C6)alkyl and -NH ₂ ; W1 and W2 are nitrogen; W3 is independently selected from oxygen and sulphur; W4 is independently selected from nitrogen and carbon; W5 is independently selected from the group consisting of a single bond, W6 is independently selected from oxygen, sulphur and NH ₂ ; R13 is independently selected from hydrogen and (C1-C6)alkyl; A is G is independently selected from and M is independently selected from the group consisting of and E is independently selected from the group consisting of a single bond, and ; R14 is independently selected from hydrogen, (C1-C6)alkyl, and NH ₂ ; R19 is independently selected from hydrogen and (C1-C6)alkyl. The methods of treating porphyria described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound of Formula 1A, 2A, 3A, 4A, 5A, 6A, 7A, 8A, 9A, 10A, 11A, 12A, 13A, 14A, 15A, 16A, 17A, 18A, 19A, 20A, 21A, 22A, 23A, 24A and 25A or a pharmaceutically acceptable salt thereof. A pharmaceutical composition described herein, comprising a compound of Formula 1A, 2A, 3A, 4A, 5A, 6A, 7A, 8A, 9A, 10A, 11A, 12A, 13A, 14A, 15A, 16A, 17A, 18A, 19A, 20A, 21A, 22A, 23A, 24A and 25A or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier or excipient. The methods of treating acute hepatic porphyria (AHP) described herein include a method for the treatment of AHP in a subject, comprising administering an effective amount of a compound of Formula 1A, 2A, 3A, 4A, 5A, 6A, 7A, 8A, 9A, 10A, 11A, 12A, 13A, 14A, 15A, 16A, 17A, 18A, 19A, 20A, 21A, 22A, 23A, 24A and 25A or a pharmaceutically acceptable salt thereof. The methods of treating acute intermittent porphyria (AIP) described herein include a method for the treatment of AIP in a subject, comprising administering an effective amount of a compound of Formula 1A, 2A, 3A, 4A, 5A, 6A, 7A, 8A, 9A, 10A, 11A, 12A, 13A, 14A, 15A, 16A, 17A, 18A, 19A, 20A, 21A, 22A, 23A, 24A and 25A or a pharmaceutically acceptable salt thereof. This invention also provides for the treatment of disease whereby the reduction in concentration and/or activity of ALSA1 would be effective. The methods described herein for the treatment of such disease would include the administration of a compound of the following Formulas: 1A, 2A, 3A, 4A, 5A, 6A, 7A, 8A, 9A, 10A, 11A, 12A, 13A, 14A, 15A, 16A, 17A, 18A, 19A, 20A, 21A, 22A, 23A, 24A and 25A or a pharmaceutically acceptable salt thereof. The methods described herein for the treatment of described herein diseases would include the administration of a compound of the following Formulas: 1A, 2A, 3A, 4A, 5A, 6A, 7A, 8A, 9A, 10A, 11A, 12A, 13A, 14A, 15A, 16A, 17A, 18A, 19A, 20A, 21A, 22A, 23A, 24A and 25A or a pharmaceutically acceptable salt thereof. In one embodiment of this invention the following compounds are anticipated to treat porphyrias, and/or reduce ALAS1 levels, and/or treat cancer, and/or treat estrogen- driven cancers, and/or treat colorectal cancer, and/or treat immunological diseases and and/or treat neurodegenerative diseases. These compounds are formed via a selection of an FA2 fragment (shown below with FA1 and FA3 attachments) and the independent selection of fragments: FA1 and FA3 to form a single molecule. Alternatively, a selection of an FA1 fragment would allow for the independent selection of FA2 and FA3. Alternatively, a selection of an FA2 fragment would allow for the independent selection of FA1 and FA3. For FA1 (FA11), Ar1 is phenyl which is optionally substituted with 1-5 J groups. FA1: FA3: FA2 (shown with appropriate attachment of FA1 and FA2): In another embodiment are compounds FA1-FA2-FA3. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3. Another embodiment is a method to reduce ALAS1 expression and/or function to treat a disease disorder, or pathological process that is related to ALAS1 expression, comprising administering an effective amount of a compound FA1-FA2-FA3 to a subject in need. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA14. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA15. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA3 is FA31. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA3 is FA32. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA3 is FA33. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA3 is FA34. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA3 is FA35. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA3 is FA36. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA3 is FA37. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA36 and FA2 is FA21. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA37 and FA2 is FA21. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA15, FA3 is FA36 and FA2 is FA21. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA15, FA3 is FA37 and FA2 is FA21. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA31 and FA2 is FA22. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA32 and FA2 is FA22. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA33 and FA2 is FA22. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA34 and FA2 is FA22. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA35 and FA2 is FA22. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA37 and FA2 is FA22. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA37 and FA2 is FA22. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA15, FA3 is FA31 and FA2 is FA22. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA15, FA3 is FA32 and FA2 is FA22. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA15, FA3 is FA37 and FA2 is FA22. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA36 and FA2 is FA26. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA31 and FA2 is FA26. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA31 and FA2 is FA26. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA32 and FA2 is FA26. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA33 and FA2 is FA26. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA31 and FA2 is FA24. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA31 and FA2 is FA24. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA32 and FA2 is FA24. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA33 and FA2 is FA24. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA31 and FA2 is FA27. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA31 and FA2 is FA27. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA32 and FA2 is FA27. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA33 and FA2 is FA27. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA31 and FA2 is FA29. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA32 and FA2 is FA29. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA33 and FA2 is FA29. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA31 and FA2 is FA29. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA32 and FA2 is FA29. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA33 and FA2 is FA29. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA31 and FA2 is FA210. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA32 and FA2 is FA210. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA33 and FA2 is FA210. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA31 and FA2 is FA210. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA32 and FA2 is FA210. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA33 and FA2 is FA210. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA31 and FA2 is FA211. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA32 and FA2 is FA211. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA33 and FA2 is FA211. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA31 and FA2 is FA211. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA32 and FA2 is FA211. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA33 and FA2 is FA211. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA31 and FA2 is FA212. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA32 and FA2 is FA212. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA33 and FA2 is FA212. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA31 and FA2 is FA212. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA32 and FA2 is FA212. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA33 and FA2 is FA212. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA31 and FA2 is FA213. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA32 and FA2 is FA213. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA33 and FA2 is FA213. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA31 and FA2 is FA213. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA32 and FA2 is FA213. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA33 and FA2 is FA213. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA31 and FA2 is FA214. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA32 and FA2 is FA214. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA33 and FA2 is FA214. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA31 and FA2 is FA214. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA32 and FA2 is FA214. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA12, FA3 is FA33 and FA2 is FA214. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA31 and FA2 is FA215. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA32 and FA2 is FA215. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA11, FA3 is FA37 and FA2 is FA215. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA15, FA3 is FA31 and FA2 is FA215. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA15, FA3 is FA32 and FA2 is FA215. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound FA1-FA2-FA3 whereby FA1 is FA15, FA3 is FA37 and FA2 is FA215. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound where Q is Q1. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound where Q is Q2. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound where Q is Q3. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound where Q is Q5. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound where Q is Q13. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound where Q is Q14. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound where Q is Q15. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound where Q is Q16. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound where Q is Q17. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound where Q is Q18. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound where Q is Q19. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound where Q is Q20. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound where Q is Q21. In another embodiment preferred compounds of the invention are examples 83, 88, 60, 2, 51, 65, 85, 14, 89 and 86 or a pharmaceutically acceptable salt thereof. Another embodiment is a method of treating porphyrias described herein include a method for the treatment of porphyria in a subject, comprising administering an effective amount of a compound: or a pharmaceutically acceptable salt thereof. Another embodiment is a method for the treatment of a porphyria in a subject, comprising administering an effective amount of a compound of Formula I or a pharmaceutically acceptable salt thereof wherein: Q is independently selected from Q1 Q2, Q3, Q4, Q5, Q6, Q7, Q8, Q9, Q10, Q11, Q12, Q13, Q14, Q15, Q16, Q17, Q18, Q19, Q20, Q21, Q22 and Q23. COMPOUNDS OF THE INVENTION Dosage Forms and Regimens Administration of compounds of the invention may be affected by any method that enables delivery of the compounds to the site of action. These methods include oral routes, intraduodenal routes, parenteral injection (including intravenous, subcutaneous, intramuscular, or infusion), topical and rectal administration. Dosage regimens may be adjusted to provide the optimum desired response. For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dose. Dosage unit form, as used herein, refers to physically discrete units suited as unitary dosages for the mammalian subjects to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms of the invention may be dictated by and directly dependent on (a) the unique characteristics of the chemotherapeutic agent and the particular therapeutic or prophylactic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals. Thus, the skilled artisan would appreciate, based upon the disclosure provided herein, that the dose and dosing regimen is adjusted in accordance with methods well-known in the therapeutic arts. That is, the maximum tolerable dose may be readily established, and the effective amount providing a detectable therapeutic benefit to a patient may also be determined, as can the temporal requirements for administering each agent to provide a detectable therapeutic benefit to the patient. Accordingly, while certain dose and administration regimens are exemplified herein, these examples in no way limit the dose and administration regimen that may be provided to a patient in practicing the present invention. It is to be noted that dosage values may vary with the type and severity of the condition to be alleviated, and may include single or multiple doses. It is to be further understood that for any particular subject, specific dosage regimens should be adjusted over time according to the individual need and the professional judgement of the person administering or supervising the administration of the compositions, and that dosage ranges set forth herein are exemplary only and are not intended to limit the scope or practice of the claimed composition. For example, doses may be adjusted based on pharmacokinetic or pharmacodynamics parameters, which may include clinical effects such as toxic effects and/or laboratory values. Thus, the present invention encompasses intra-patient dose-escalation as determined by the skilled artisan. Determining appropriate dosages and regimens for administration of the chemotherapeutic agent are well-known in the relevant art and would be understood to be encompassed by the skilled artisan once provided the teachings disclosed herein. The amount of the compound of the invention administered will be dependent on the subject being treated, the severity of the disorder or condition, the rate of administration, the disposition of the compound and the discretion of the prescribing physician. However, an effective dosage is in the range of about 0.01 to about 50 mg per kg body weight per day, preferably about 0.1 to about 20 mg/kg/day, in single or divided doses. For a 70 kg human, this would amount to about 0.0007 to about 3.5 g/day, preferably about 0.007 to about 1.4 g/day. In some instances, dosage levels below the lower limit of the aforesaid range may be more than adequate, while in other cases still larger doses may be employed without causing any harmful side effect, provided that such larger doses are first divided into several small doses for administration through-out the day. Formulations and Routes of Administration As used herein, a “pharmaceutically acceptable carrier” refers to a carrier or diluent that does not cause significant irritation to an organism and does not abrogate the biological activity and properties of the active compound. The pharmaceutically acceptable carrier may comprise any conventional pharmaceutical carrier or excipient. The choice of carrier and/or excipient, will to a large extent, depend on factors such as the particular mode of administration, the effect of the excipient on solubility and stability, and the nature of the dosage form. Suitable pharmaceutical carriers include inert diluents or fillers, water and various organic solvents (such as hydrates and solvates). The pharmaceutical compositions may, if desired, contain additional ingredients such as flavorings, binders, excipients and the like.Thus, for oral administration, tablets containing various excipients, such as citric acid may be employed together with various disintegrants such as starch, alginic acid and certain complex silicates and with binding agents such as sucrose, gelatin and acacia. Examples without limitation, of excipients include calcium carbonate, calcium phosphate, various sugars and types of starch, cellulose derivatives, gelatin, vegetable oils and polyethylene glycols. Additionally, lubricating agents such as magnesium stearate, sodium lauryl sulfate and talc are often useful for tableting purposes. Solid compositions of a similar type may also be employed in soft and hard filled gelatin capsules. Non-limiting examples of material, therefore, include lactose or milk sugar and high molecular weight polyethylene glycols. When aqueous suspensions or elixirs are desired for oral administration the active compound therein may be combined with various sweetening or flavoring agents, coloring matters or dyes and, if desired, emulsifying agents or suspending agents, together with diluents such as water, ethanol, propylene glycol, glycerin, or combinations thereof. The pharmaceutical composition may, for example, be in a form suitable for oral administration as a tablet, capsule, pill, powder, sustained release formulation, solution, suspension or emulsion, for topical administration as an ointment or crease, or for rectal administration as a suppository. Exemplary parenteral administration forms include solutions or suspensions of an active compound in a sterile aqueous solution, for example, aqueous propylene glycol or dextrose solutions. Such dosage forms may be suitably buffered, if desired. The pharmaceutical composition may be in unit dosage forms suitable for single administration of precise amounts. Pharmaceutical compositions suitable for the delivery of active agents and methods for their preparation will be readily apparent to those skilled in the art. Such compositions and methods for their preparation may be found, for example, in “Remington’s Pharmaceutical Sciences”, 19 ^th Edition (Mack Publishing Company, 1995), the disclosure of which is incorporated herein by reference in its entirety. Compounds of the invention may be administered orally. Oral administration may involve swallowing, so that the compound enters the gastrointestinal tract, buccal or sublingual administration may be employed by which the compounds enters the blood stream directly from the mouth. Formulations suitable for oral administration include solid formulations such as tablets, capsules containing particulates, liquids, or powders. Lozenges (including liquid filled), chews, multi- and nano-particulates, gels solid solution, liposome, films, ovules, sprays and liquid formulations. Liquid formulations include suspensions, solutions, syrups and elixirs. Such formulations may be used as fillers in soft or hard capsules and typically include a carrier, for example, water, ethanol, polyethylene glycol, propylene glycol, methylcellulose, or a suitable oil, and one or more emulsifying agents and/or suspending agents. Liquid formulations may also be prepared by the reconstitution of a solid, for example, from a sachet. Compounds of the invention may also be used in fast-dissolving, fast-disintegrating dosage forms such as those described in Expert Opinion in Therapeutic Patents, 11 (6), 981-986 by Liang and Chen (2001), the disclosure of which is incorporated herein by reference in its entirety. For tablet dosage forms, the active agent may make up from 1 wt % to 80 wt % of the dosage form, more typically from 5 wt % to 60 wt % of the dosage form. In addition to the active agent, tablets generally contain a disintegrant. Examples of disintegrants include sodium starch glycolate, sodium carboxymethyl cellulose, calcium carboxymethyl cellulose, croscarmellose sodium, crospovidone, polyvinylpyrrolidone, methyl cellulose, microcrystalline cellulose, lower alkyl- substituted hydroxypropyl cellulose, starch, pregelatinized starch and sodium alginate. Generally, the disintegrant may comprise from 1 wt % to 25 wt %, preferably from 5 wt % to 20 wt % of the dosage form. Binders are generally used to impart cohesive qualities to a tablet formulation. Suitable binders include microcrystalline cellulose, gelatin, sugars, polyethylene glycol, natural and synthetic gums, polyvinylpyrrolidone, pregelatinized starch, hydroxypropyl, cellulose and hydroxypropyl methylcellulose. Tablets may also contain diluents, such as lactose, mannitol, xylitol, dextrose, sucrose, sorbitol, microcrystalline cellulose, starch, and dibasic calcium phosphate dehydrate. Tablets may also optionally include surface active agents such as sodium lauryl sulfate and ploysorbate 80, and glidants such as silicon dioxide and talc. When present, surface active agents are typically in amounts of from 0.2 wt % to 5 wt % of the tablet, and glidants typically from 0.2 wt % to 1 wt % of the tablet. Tablets also generally contain lubricants such as magnesium stearate, calcium stearate, zinc stearate, sodium stearyl fumarate, and mixtures of magnesium stearate with sodium lauryl sulphate. Lubricants generally are present in amounts from 0.25 wt % to 10 wt %, preferably from 0.5 wt % to 3 wt % of the tablet. Exemplary tablets may contain up to about 80 wt % active agents for about 10 wt % to about 90 wt % binder, from about 0 wt % to about 85 wt % diluent, from about 2 wt % to about 10 wt % disintegrant, and from about 0.25 wt % to about 10 wt % lubricant. The formulation of tablets is discussed in detail in “pharmaceutical Dosage Forms: Tablets, Vol.1”, by H. Lieberman and L. Lachman, Marcel Dekker, N.Y., N.Y., 1980 (ISBN 0-8247-6918-X), the disclosure of which is incorporated herein by reference in its entirety. Suitable modified release formulations are described in U.S. Pat. No.6,106,864. Details of other suitable release technologies such as high energy dispersions and osmotic and coated particles may be found in Verma et al, Pharmaceutical Technology On-line 25(2), 1-14 (2001). This disclosure of this reference is incorporated herein by reference in its entirety. It is understood that compounds of Formula (I) can be formulated as a di-salt. Parenteral Administration Compounds of the invention may also be administered directly into the blood stream, into muscle, or into an internal organ. Suitable means for parenteral administration including intravenous, intraarterial, intraperitoneal, intrathecal, intraventricular, intraurethral, intracranial, intramuscular and subcutaneous. Suitable devices for parenteral administration include needle injectors, needle-free injectors and infusion techniques. Parenteral formulations are typically aqueous solutions which may contain excipients such as salts, carbohydrates and buffering agents (preferably to a pH of 3 to 9), but, for some applications, they may be more suitably formulated as a sterile non- aqueous solution or as a dried form to be used in conjunction with a suitable vehicle such as sterile, pyrogen-free water. The preparation of parenteral formulations under sterile conditions, for example, by lyophilization, may readily be accomplished using standard pharmaceutical techniques well known to those skilled in the art. The solubility of compounds of the invention used in the preparation of parenteral solutions may potentially be increased by the use of appropriate formulation techniques, such as the incorporation of solubility-enhancing agents. Formulations for parenteral administration may be formulated to be immediate and/or modified release. Modified release formulations include delayed-, sustained-, pulsed-, controlled-, targeted and programmed release. Thus, compounds of the invention may potentially be formulated as a solid, semi-solid, or thixotropic liquid for administration as an implanted depot providing modified release of the active compound. Examples of such formulations include drug-coated stents and PGLA microspheres. The compounds of the invention may also potentially be administered topically to the skin or mucosa, that is, dermally or transdermally. Typical formulations for this purpose include gels, hydrogels, lotions, solutions, creams, ointments, dusting powders, dressings, foams, films, skin patches, wafers, implants, sponges, fibers bandages and microemulsions. Dosage The amount of the compound of the present invention administered will be dependent on the subject being treated, the severity of the disorder or condition, the rate of administration, the disposition of the compound and the discretion of the prescribing physician. However, an effective dosage is in the range of about 0.01 to about 50 mg per kg body weight per day, preferably about 0.1 to about 20 mg/kg/day, in single or divided doses. For a 70 kg human, this would amount to about 0.0007 to about 3.5 g/day, preferably about 0.007 to about 1.4 g/day. In some instances, dosage levels below the lower limit of the aforesaid range may be more than adequate, while in other cases still larger doses may be used without causing any harmful side effect, with such larger doses typically divided into several smaller doses for administration throughout the day. In embodiments, the effective dose for compounds of the present invention is 0.05-50 mg/kg, or 0.1-20 mg/kg, or 0.05-5.0 mg/kg. In embodiments, the effective dose for compounds of the present invention is determined based on the dose required to obtain a reduction of a level of ALAS1 mRNA (that is, a liver level of ALAS1 mRNA and/or a circulating level of ALAS1 mRNA). In embodiments, the effective dose for compounds of the present invention is determined based on the dose required to obtain a reduction of a level of ALA and/or PBG in urine, bodily fluids, or tissue. In embodiments, the effective dose for compounds of the present invention is determined based on the dose required to obtain a particular treatment effect such as the prevention or reduction of symptoms associated with a porphyria. Combination Therapy As used herein, the term “combination therapy” or drug combination” or “in combination” or alike, refers to the administration of a compound of the invention together with at least one additional pharmaceutical or medicinal agent, either sequentially or simultaneously. As noted herein, the compounds of the present invention may be used in combination with one or more agents to treat a porphyria and or disease related to ALAS1 regulation, which are described herein and are known to those skilled in the arts (e.g., heme products (such as hemin, Panhematin ^TM and heme arginate), glucose, ALAS1 expression modulating agents such as an iRNA compositions of US 11,028,392 including givosiran (Givlaari ^TM ), hydroxychloroquine (Plaquenil), chloroquine (Aralen) and afamelanotide (Scenesse ^TM ). Additionally, a subject with a porphyria may also be administered various opiates to control pain, phenothiazines to control vomiting and nausea, anti-seizure medicines, and beta-blockers to control tachycardia and/or hypertension in combination with a compound of the present invention. When a combination therapy is used, the one or more additional agents may be administered sequentially or simultaneously with a compound of the present invention. In one embodiment, the additional agent is administered to the subject or patient prior to administration of the compound of the invention. In another embodiment, the additional agent is administered to the subject after administration of the compound of the invention. In another embodiment, the additional agent is administered to the subject simultaneously with the administration of the compound of the invention. The compounds of the invention may potentially be used in combination with one or more additional anti-cancer agents, which are described below. When a combination therapy is used, the one or more additional anti-cancer agent may be administered sequentially or simultaneously with the compound of the invention. In one embodiment, the additional anti-cancer agent is administered to a mammal (subject, patient) prior to administration of the compound of the invention. In another embodiment, the additional anti-cancer agent is administered to the mammal after administration of the compound of the invention. In another embodiment, the additional anti-cancer agent is administered to the mammal simultaneously with the administration of the compound of the invention. The invention also relates to a pharmaceutical composition for the treatment of abnormal cell growth in a mammal, including a human, which comprises an amount of a compound of the invention, as defined herein, in combination with one or more (preferably one to three) anti-cancer agents selected from a group consisting of anti- angiogenesis agents and signal transduction inhibitors and a pharmaceutically acceptable carrier, wherein the amounts of the active agent and the combination anti- cancer agents when taken as a whole is therapeutically effective for treating said abnormal cell growth. In one embodiment of the present invention the anti-cancer agent used in conjunction with a compound of the invention and pharmaceutical compositions described herein is an anti-angiogenesis agent (e.g., an agent that stops tumors from developing new blood vessels). Examples of anti-angiogenesis agents include for example VEGF inhibitors, VEGFR inhibitors, TIE-2 inhibitors, PDGFR inhibitors, angiopoetin inhibitors, PKCbeta inhibitors, COX-2 inhibitors, integrins, MMP-2 (matrix-metalloproteinase 2) inhibitors, and MMP-9 (matrix-metalloproteinase 9) inhibitors. Preferred anti-angiogenesis agents include sunitinib (Sutent®), bevacizumab (Avastin®), axitinib (AG 13736), ramucirumab (Cyramza®), SU 14813 (Pfizer), and AG 13958 (Pfizer). Additional anti-angiogenesis agents include vatalanib (CGP 79787), Sorafenib (Nexavar®), pegaptanib octasodium (Macugen®),ziv-aflibercept (Zaltrap®), vandetanib (Zactima®), PF-0337210 (Pfizer), SU 14843 (Pfizer), AZD 2171 (AstraZeneca), ranibizumab (Lucentis®), Neovastat®) (AE 941), tetrathiomolyb-data (Coprexa®), AMG 706 (Amgen), VEGF Trap (AVE 0005), CEP 7055 (Sanofi-Aventis), regorafenib (Stivarga®), XL 880 (Exelixis), telatinib (BAY 57-9352), and CP-868,596 (Pfizer). Other anti-angiogenesis agents include enzastaurin (LY 317615), midostaurin (CGP 41251), perifosine (KRX 0401), teprenone (Selbex®) and UCN 01 (Kyowa Hakko). Other examples of anti-angiogenesis agents which may be used in conjunction with a compound of the invention and pharmaceutical compositions described herein include celecoxib (Celebrex®), parecoxib (Dynastat®), deracoxib (SC 59046), lumiracoxib (Preige ^TM ), valdecoxic (Bextra ^TM ), rofecoxib (Vioxx ^TM ), iguratimod (Careram®), IP 751 (Invedus), SC-58125 (Pharmacia) and etoricoxib (Arcoxia®). Other anti-angiogenesis agents include exisulind (Aptosyn®), salsalate (Amigesic®), diflunisal (Dolobid®), ibuprofen (Motrin®), ketoprofen (Orudis®), nabumetone (Relafen®), piroxicam (Feldene®), naproxen (Aleve®), Naprosyn®), diclofenac (Voltarn®), indomethacin (Indocin®), Lenvatinib mesylate (Lenvima®), sulindac (Clinoril®), tolmetin (Tolectin®), etodolac (Lodine®), ketorolac (Toradol®), and oxaprozin (Day-pro®). Other anti-angiogenesis agents include ABT 510 (abbott), apratastat (TMI 005), AZD 8955 (AstraZeneca), incyclinide (Metastat®), and PCK 3145 (Procyon). Other anti-angiogenesis agents include acitretin (Neotigason®), plitidepsin (Aplidine®), cilengtide (EMD 121974), combretastatin A4 (CA4P), fenretinide (4 HPR), halofuginone (Tempostatin®), Panzem®, rebimastat (BMS 275291), catumaxomab, (Removab®), lenalidomide (Revlimid®), squalamine (EVIZON®), thalidomide (Thalomid®), Ukrain® (NSC 631570), Vitaxin® (MEDI 522), and zoledronic acid (Zomata®). In another embodiment the anti-cancer agent is a so-called signal transduction inhibitor (e.g., inhibiting the means by which regulatory molecules that govern the fundamental processes of cell growth, differentiation, and survival communicated within the cell). Signal transduction inhibitors include small molecules, antibodies, and antisense molecules. Signal transduction inhibitors include for example kinase inhibitors (e.g., tyrosine kinase inhibitors or serine/threonine kinase inhibitors) and cell cycle inhibitors. More specifically signal transduction inhibitors include, for example, farnesyl protein transferase inhibitors, EgF inhibitors, ErbB-1 (EGFR) inhibitors, ErbB-2 inhibitors, pan- erb inhibitors, IGF1R inhibitors, MEK (1,2) inhibitors, c-Kit inhibitors, FLT-3 inhibitors, K-Ras inhibitors, PI3 kinase inhibitors, JAK inhibitors, STAT inhibitors, Raf kinase inhibitors, Akt inhibitors, mTOR inhibitors, P70S6 kinase inhibitors, CDK inhibitors, CDK4/6 inhibitors, BTK inhibitors, inhibitors of the WNT pathway and so called multi- targeted kinase inhibitors. Preferred signal transduction inhibitors include gefitinib (Iressa®), cetuximab (Erbitux®), erlotinib (Tarceva®), adagrasib (Krazati®), afatinib dimaleate (Gilotrif®), trastuzmab (Herceptin®), ruxolitinib (Jakafi®), alectinib (Alecensa®), sunitinib (Sutent®), imatinib (Gleevec®), Trametinib® (GSK1120212), sotorasib (Lumakras®), alpelisib (Piqray®), abemaciclib (Verzenio®), osimertinib mesylate (Tagrisso®), palbociclib (Ibrance®), ribociclib (Kisqali®), pralsetinib (Gavreto®), daratumumab (Darzalex®), dabrafenib (Tafinlar®), quizartinib (Vanflyta®), neratinib maleate (Nerlynx®), trametinib (Mekinist®), acalabrutinib (CALQUENCE®, LOXO-305, and Cobimetinib® (XL518). Additional examples of signal transduction inhibitors which may be used in conjunction with a compound of the invention and pharmaceutical compositions described herein include BMS 214662, selpercatinib (Retevmo®), lonafarnib (Sarasar®), brigatinib (Alunbrig®), pelitrexol (AG 2037), matuzumab (EMD 7200), nimotuzumab (TheraCIM h-R3®), binimetinib (Mektovi®), encorafenib (Braftovi®), entrectinib (Rozlytrek®), ceritinib (Zykadia®), panitumumab (Vectibix®), vandetanib (Zactima®), dabrafenib (Tafinlar®), pazopanib (SB 786034), BIBW 2992 (Boehringer Ingelheim), and Cervene® (TP 38). Other examples of signal transduction inhibitors include Canertinib (CI 1033), pertuzumab (Omnitarg®), pelitinib (EKB 569), miltefosine (Miltefosin®), BMS 599626, Lapuleucel-T (Neuvenge®), NeuVax®), Osidem® (IDM 1), mubritinib (TAK-165), Panitumumab (Vectibix®), lapatinib (Tykerb®), capmatinib hydrochloride (Tabrecta®), tucatinib (Tukysa®), dacomitinib (Vizimpro®), lorlatinib (Lorbrena®), crizotinib (Xalkori®), pelitinib (EKB 569), erbafitinib (Balversa), and pertuzumab (Omnitarg®). Other examples of signal transduction inhibitors include ARRY 142886, everolimus (Certican®), zotarolimus (Endeavor®), temsirolimus (Torisel®), and VX 680 (Vertex). This invention contemplates the use of a compound of the invention together with antineoplastic agents. Antineoplastic agents include, but are not limited to, hormonal, anti-estrogen therapeutic agents, histone deacetylase (HDAC) inhibitors, gene silencing agents or gene activating agents, ribonucleases, proteosomics, Topoisomerase I inhibitors, Camptothecin derivatives, Topoisomerase II inhibitors, alkylating agents, antimetabolites, poly(ADP-ribose), polymerase-1 (PARP-1) inhibitors, microtubulin inhibitors, antibiotics, spindle inhibitors, platinum-coordinated compounds, gene therapeutic agents, antisense oligonucleotides, vascular targeting agents (VTAs) and statins. Examples of antineoplastic agents used in combination therapy with a compound of the invention, include, but are not limited to, glucocorticoids, such as dexamethasone, prednisone, prednisolone, methylprednisolone, hydrocortisone, and progestins such as medroxyprogesterone, ado-trastuzumab emtansine (Kadcyla®), megestrol acetate (Megace), mifepristone (RU-486) selective estrogen receptor modulators (SERMs, such as tamoxifen, raloxifene, lasofoxifene, afimoxifene, arzoxifene, bazedoxifene, fispemifene, ormeloxifene, ospemifene, tesmilifene, toremifene, trilostance and CHF 4227 (Cheisi), selective estrogen-receptor downregulators (SERDs, such as fulvestrant), exemestane (Aromasin®), anastrozole (Arimidex®), belzutifan (Welireg®), atamestane, fadrozole, letrozole (Femara®), gonadotropin-releasing hormone (GnRH, also commonly referred to as luteinizing hormone-releasing hormone [LHRH]) agonists such as buserelin (Suprefact), goserelin (Zoladex), leuprorelin (Lupron), and triptorelin (Trelstar®), abarelix (Plenaxis®), bicalutamide (Casodex®), cyproterone, flutamide (Eulexin®), megestrol, pertuzumab (Perjeta®), nilutamide (Nilandron), and osaterone, Obinutuzumab (Gazyva®), dutasteride, epristeride, finasteride, abarelix, goserelin, leuprorelin, triptorelin, bicalutamide, tamoxifen, exemestane, anastrozole, fadrozole, fromestane and combinations thereof. Other examples of antineoplastic agents used in combination with a compound of the invention include, but are not limited to, pomalidomide Pomalyst®),suberolanilide hydroxamic acid (SAHA®, Merck), depsipeptide (FR901228), G2M-777, MS-275, pivaloyloxymethyl butyrate and PXD-101/Onconase® (ranpimase), tepotinib hydrochloride (Tepmetko®), margetuximab-cmkb (Margenza®), PS-341, Valcade® (bortezomib), amivantamab (Rybrevant®),Sacituzumab govitecan-hziy (Trodelvy®), 9- aminocamptothecin, belotecan, BN-80915, camptothecin, diflomotecan, edotecarin, exatecan, gimatecan, 10-hydroxycamptothecin, irinotecan HCl (Camptosar®), lurtotecan, Orathecin® (rubitecan, Supergen®), fam-trastuzumab deruxtecan-nxki (Enhertu®), SN-38, topotecan, camptothecin, 10-hydroxycamptothecin, 9- aminocamptothecin, irinotecan, aclarubicin, adriamycin, amonafide, amrubicin, annamycin, daunorubicin, doxorubicin, elsamitrucin, epirubicin, etoposide, idarubicin, galarubicin, hydroxycarbamide, nemorubicin, novantrone (mitoxantrone), pirarubicin, pixantrone, procarbazine, rebeccamycin, sobuzoxane, tafluposide, valrubicin, Zinecard® (dexrazoxane), nitrogen mustard N-oxide, cyclophosphamide, AMD-473, altretamine, Ap-5280, apaziquone, brostallicin, bendamustine, busulfan, carboquone, carmustine, chlorambucil, dacarbazine, estramustine, fotemustine, glufosfamide, ifosfamide, KW-2170, lomustine, mafosfamide, mechlorethamine, melphalan, mitobronitol, mitolactol, mitomycin C, mitoxatrone, nimustine, ranimustine, temozolomide, thiotepa, and platinum-coordinated alkylating agents such as cisplatin. Paraplatin (carboplatin), eptaplatin, lobaplatin, nedaplatin, Eloxatin® (oxaliplatin), streptozocin, satrplatin, and combinations thereof. The invention also contemplates the use of a compound of the invention together with dihydrofolate reductase inhibitors (for example methotrexate and NeuTrexin® (trimetresate glucoronate)), purine antagonist (for example 6-mercaptopurine riboside, mercaptopurine, 6-thioguanine, cladribine, clofarabine (Clolar(R)), fludarabine, nelarabine, and raltitrexed), pyrimidine antagonists (for example, 5-fluorouracil (5-FU), Alimta® (premetrexed disodium), capecitabine (Xeloda ^® ), cytosine, Arabinoside, Gemzar® (gemcitabine), Tegafur® (UFT Orzel® or UForal® and including TS-1 combination of tegafur, gimestat and otostat), doxifluridine, carmofur, cytarabine (including ocfosfate, phosphate stearate, sustained release and liposomal forms), enocitabine, 5-azacitidine (Vidaza®), decitabine, and ethynyl-cytidine) and other antimetabolites such as eflomithine, hydroxyurea, leucovorin, nolatrexed, triapine, trimetrexate, ABT-472, Ino-1001, KU-0687 and GPI 18180 and combinations thereof. Additional examples of antineoplastic agents used in combination therapy with a compound of the invention, optionally with one or more other agents include, but are not limited to, Advexin ^® , Genasense (oblimersen, Genta®), Combretastatin A4P (CA4P), Oxi4503, AVE-8062, ZD-6126, TZT 1027, atorvastatin (Lipitor ^® ), pravastatin (Pravachol®(), lovastatin (Mevacor®), simvastatin (Zocor®), fluvastatin (Lescol®), cerivastatin (Baycol®), rosuvastatin (Crestor®), niacin (Advicor®), caduet and combinations thereof. The invention also contemplates the use of a compound of the invention together with agents that modulate the immune system (also known as immunotherapy). Several types of immunotherapy are used to treat cancer, these include, immune checkpoint inhibitors, T-cell transfer therapy, monoclonal antibodies (often specific for a marker/protein on the cancer cell’s surface), vaccines, and various immune system modulators. These include, but are not limited to, pembrolizumab (Keytruda®), nivolumab (Opdivo®), cemiplimab (Liptayo®), atezolizumab (Tecentrig®), avelumab (Bavencio®), durvalumab (Imfinzi®), camiplimab hydrochloride (Tabrecta(T dostarlimab-gxly (Jemperli®), elranatamab (Elrexfio®), ipilimumab (Yervoy®), tremalimumab (Imjudo®), rituximab (RITUXAN®, Thor-707, and dexamethazone. Drugs that target immune checkpoint targets, such as lymphocyte activation gene-3 (LAG-3), T cell immunoglobulin and mucin-domain containing-3 (TIM-3), T cell immunoglobulin and ITIM domain (TIGIT), V-domain Ig suppressor of T cell activation (VISTA) are incorporated into this invention. The invention also contemplates the use of a compound of the invention together with agents that modulate the BCL-2 family of proteins include, but are not limited to, venetoclax, (Venelexta ^® , ABT-199) and AMG176. The invention also contemplates the use of a compound of the invention together with agents that inhibit the androgen receptor include, but are not limited to, apalutamide (Erleada®), flutamide (Eulexin®), nilutamide (Nilandron®), dicalutamide (Casodex®) and enzalutamide (Xtandi®). The invention also contemplates the use of a compound of the invention together with agents that modulate the PARP family of proteins include, but are not limited to, niraparib (Zejula®), olaparib (Lynparza®), rucaparib (Rubraca®) and talazoparib (Talzenna®). The invention also contemplates the use of a compound with senolytic agents, including but not limited to the following: Dasatinib, Quercetin, Fisetin and Navitoclax. Another embodiment of the present invention of particular interest relates to a method for the treatment of breast cancer in a human in need of such treatment, comprising administering to said human an amount of a compound of the invention, in combination with one or more (preferably one to three) anti-cancer agents selected from the group consisting of trastuzumab, tamoxifen, docetaxel, paclitaxel, capecitabine, gemcitabine, vinorelbine, exmestane, elacestrant dihydrochloride (Orserdu®), letrozole, anastrozole (Arimidex®), and anastrozole. Another embodiment of the present invention relates to the method of treatment of neurodegenerative diseases in a human in need of such treatment, comprising administering to said human an amount of a compound of the present invention in combination with one or more agents selected from the group consisting of anti-tau mAb, anti-beta-amyloid mAb, BIIB067 (tofersen), BAN2401, BIIB054 (anti-alpha- synuclein), BIIB074, BIIB092, BIIB092 (gosuranemab), BIIB104, Natalizumab, BIIB076 (anti-tau mAb), BIIB078 (IONIS-C9RX), BIIB080 (IONIS-MAPTRX), BIIB095 (NAV 1.7), BIIB (XPO1 inhibitor), BIB110, cholinesterase inhibitors (Aricept®, Exelon®, Razadyne®), memantine (Namenda®), Levodopa, Lodosyn, dopamine agonists (pramipexole, ropinirole, rotigotine and apomorphine), MAO B Inhibitors (selegiline, rasagiline, safinamide), catechol O-methyltransferase (COMT) inhibitors (entacapone and tolcapone), anticholinergics (benztropine and trihexphenidyl), amantadine, riluzole, edavarone, xenazine, antipsychotics and benzodiazepines. Therapeutic Methods and Uses The invention further provides therapeutic methods and uses comprising administering a compound of the present invention, or pharmaceutically acceptable salt thereof, alone or in combination with one or more other therapeutic agents or palliative agents. The compositions and methods described herein have utility in treating many disease conditions, including porphyrias and disorders related to ALAS1 expression. Additional diseases where a reduction in ALAS1 expression would have a therapeutic effect are cancer, immunological diseases and neurological diseases. a) Methods and uses of the compounds of the present invention to treat diseases related to the expression of an ALAS1 gene The invention relates to the use of an agent, as described in Formula I, to reduce ALAS1 expression and/or function to treat a disease, disorder, or pathological process that is related to ALAS1 expression. As used herein, “a disease related to ALAS1 expression”, “a disorder related to ALAS1 expression”, or “pathological process related to ALAS1 expression” or alike, includes any condition, disorder or disease in which ALAS1 expression is altered or the activity of ALAS1 is altered. Consequently, the levels of one or more porphyrins are altered, the level or activity of one or more enzymes in the heme biosynthetic pathway is altered, or other mechanisms in the heme biosynthetic pathway that lead to pathological changes. Targeting the ALAS1 protein expression by the agents of Formula I, or in combination with agents and methods described herein (and those agents and methods known to those skilled in the arts for treatment of porphyrias) may be used for treatment of conditions in which levels of a porphyrin or a porphyrin precursor (e.g. ALA and or PBG) are elevated or conditions in which there are defects in the enzymes of the heme biosynthetic pathway. Examples of disorders related to ALAS1 expression include: X-linked sideroblastic anemia (XLSA), ALA dehydratase deficiency porphyria (Doss porphyria), acute intermittent porphyria (AIP), congenital erythropoietic porphyria, porphyria cutanea tarda, hereditary coproporphyria (coproporphria), variegate porphyria, erythropoietic protoporphyria (EEP) and transient erythroporphyria of infancy. This list of examples is not meant to be limiting. In some embodiments, the invention provides a method for the treatment of disorders related to ALAS1 expression include: X-linked sideroblastic anemia (XLSA), ALA dehydratase deficiency porphyria (Doss porphyria), acute intermittent porphyria (AIP), congenital erythropoietic porphyria, porphyria cutanea tarda, hereditary coproporphyria (coproporphria), variegate porphyria, erythropoietic protoporphyria (EEP) and transient erythroporphyria of infancy comprising administering to the subject a therapeutically effective amount of a compound of the invention, or a pharmaceutically acceptable salt thereof. In some embodiments, the subject has or is at risk for developing a porphyria and has a level of ALAS1, in a subject’s sample, that is elevated as compared to a reference standard. In some embodiments, the subject has or is at risk for developing a porphyria and has a level of one or more porphyrins, in a subject’s sample, that is elevated as compared to a reference standard. In some embodiments, the subject has or is at risk for developing a porphyria and has a level or activity of one or more enzymes in the heme biosynthetic pathway, in a subject’s sample, that is elevated as compared to a reference standard. In some embodiments, the subject has or is at risk for developing a porphyria and has a level of ALA, in a subject’s sample, that is elevated as compared to a reference standard. In some embodiments, the subject has or is at risk for developing a porphyria and has a level of PBG, in a subject’s sample, that is elevated as compared to a reference standard. In some embodiments, the subject has or is at risk for developing a porphyria and has a level of coproporphyrin and/or erythrocyte Zn-protoporphyrin and/or uroporphyrin and/or coproporphyrin III and/or uroporphyrin and/or 7-carboxylate porphyrin, in a subject’s sample that is elevated as compared to a reference standard. In some embodiments, the level of porphyrin or porphyrin precursor in a subject is determined from examining a sample of blood or serum or stool or urine or tissue. The effects of administration of a compound of Formula I to a subject in need of treatment, may be assessed by comparison of levels of porphyrin and/or a porphyrin precursors and/or ALAS1 levels described herein, during the time periods of pre- treatment, during treatment and post-treatment by a compounds of Formula I. In some embodiments the administration of a compound of Formula I is effective at preventing attacks and/or reducing the frequency of attacks. In some embodiments the administration of a compound of Formula I is effective at lessening the severity of the attack and/or shorting the duration of the attack (e.g., by ameliorating one or more signs or symptoms associated with the attack). A subject “at risk” of developing a porphyria, as used herein, includes a subject with a family history of porphyria and/or a history of one or more reoccurring or chronic porphyric symptoms, and/or a subject who carries a genetic alteration (e.g., a mutation) in a gene encoding an enzyme of the heme biosynthetic pathway, and a subject who carries a genetic alteration, e.g., a mutation known to be associated with porphyria. Levels of a porphyrin or porphyrin precursors can be assessed using methods known to the art. Methods for assessing urine and plasma levels of ALA and PBG and urine and plasma levels of porphyrins are disclosed in Floderus, Y. et al, Clinical Chemistry, 52(4): 701-707, 2006 and Sardh et al., Clinical Pharmacodynamics, 46(4): 335-349, 2007, the entire contents of which is hereby incorporated in their entirety. Levels of ALAS1 can be assessed using methods known to the art. Methods for assessing ALAS1 expression are described herein and are reported in the literature. For example, Graziadei et al., Frontiers in Physiology 2022; 13: 886194 and references cited therein, the entire contents of which is hereby incorporated in their entirety. A determination of a subject’s level of a porphyrin or porphyrin precursor (e.g. ALA and/or PBG) is made by establishing that the level of ALA and/or PBG in a patient sample (tissue or fluid) is elevated in comparison to an reference sample. Commonly ALA and/or PBG levels are evaluated in plasma urine or stool and a physician with expertise in the treatment of porphyrias can made a determination if the porphyrin and/or porphyrin precursors are elevated. Furthermore, the physician can make a determination over subsequent testing if the levels of porphyrin or porphyrin precursors are approaching a more normal state and/or if the patient is benefiting from treatment. As used herein, a “reference value” or “reference level” refers to a value from the subject at a time when the subject is not in a diseased state or a value from a normal health subject, or a value from a population known to be healthy. The normal value may be expressed as a range in values and this range of values are known to those skilled in the arts and that are skilled at treating subjects with porphyrias. An example of reference values is given in Floderus, Y. et al., Clinical Chemistry, 52(4): 701-707, 2006 and references cited therein or Sardh et al., Clinical Pharmacokinetics, 46(4): 335-349, 2007 and references cited therein. In some embodiments the subject is a human and has an elevated level of a porphyrin or porphyrin precursor (e.g. ALA and/or PBG) where the level is 2 times (2X), 3X, 4X and 5X that of the reference sample. In some embodiments the subject is a human and has an elevated level of a porphyrin or porphyrin precursor (e.g. ALA and/or PBG) where the level is greater than 4X. In some embodiments the subject has an elevated level of a porphyrin or porphyrin precursor (e.g. ALA and/or PBG) where the level is given by the references Floderus et al. and/or Sardh et al. In some embodiments, the subject is a human and has a urine level of PBG that is greater than or equal to 4.8 mmol/mol creatinine. In some embodiments, the subject is a human and has a urine level of PBG that is greater than or equal to about 3, 4, 5, 6, 7 or 8 mmol/mol creatinine. In some embodiments the reference value for urine PBG is 1.2 mmol/mol creatinine. In some embodiments, the subject is a human and has a urine level of PBG that is greater than or equal to, 1.0 mmol/mol creatinine, 1.2 mmol/mol creatinine, 2.4 mmol/mol creatinine, 3.6 mmol/mol creatinine, 4.8 mmol/mol creatinine or 6.0 mmol/mol creatinine. In some embodiments the reference value for plasma PBG is 0.12 ^mol/L. In some embodiments the subject is a human and has a plasma level of PBG that is greater than or equal to, 0.48 ^mol/L. In some embodiments, the subject is a human and has a plasma level of PBG that is greater than or equal to, 0.10 ^mol/L, 0.12 ^mol/L, 0.24 ^mol/L, 0.36 ^mol/L, 0.48 ^mol/L or 0.60 ^mol/L. In some embodiments, the reference value for urine ALA that is 3.1 mmol/mol creatinine. In some embodiments, the subject is a human and has a urine ALA level that is greater than or equal to, 2.5 mmol/mol creatinine, 3.1 mmol/mol creatinine, 6.2 mmol/mol creatinine, 9.3 mmol/mol creatinine, 12.4 mmol/mol creatinine or 15.5 mmol/mol creatinine. In some embodiments the reference value for plasma ALA is 0.12 ^mol/L. In some embodiments the subject is a human and has a plasma level of ALA that is greater than or equal to, 0.48 ^mol/L. In some embodiments, the subject is a human and has a plasma level of ALA that is greater than or equal to, 0.10 ^mol/L, 0.12 ^mol/L, 0.24 ^mol/L, 0.36 ^mol/L, 0.48 ^mol/L or 0.60 ^mol/L. In some embodiments the reference value for plasma porphyrin is 10 nmol/L. In some embodiments the subject is a human and has a plasma porphyrin level that is greater than or greater than or equal to, 10 nmol/L or 40 nmol/L. In some embodiments, the subject is a human and has a plasma porphyrin level that is greater than or greater than and equal to, 8 nmol/L, 10 nmol/L, 15 nmol/L, 20 nmol/L, 25 nmol/L, 30 nmol/L, 35 nmol/L, 40 nmol/L, 45 nmol/L, or 50 nmol/L. In some embodiments the reference value for urine porphyrin is 25 ^mol/mol creatinine. In some embodiments the subject is a human and has a urine porphyrin level that is greater than or greater than or equal to, 25 ^mol/mol creatinine. In some embodiments, the subject is a human and has a urine porphyrin level that is greater than or greater than and equal to, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, or 80 ^mol/mol creatinine. In some embodiments the subject has a urine level of ALA that is 1.6, or more, times that of the mean level in a normal subject. In some embodiments the subject has a plasma level of ALA that is 2, or more, times that of the mean level in a normal subject. In some embodiments the subject has a urine level of PBG that is 4, or more, times that of the mean level in a normal subject. In some embodiments the subject has a plasma level of PBG that is 4, or more, times that of the mean level in a normal subject. In some embodiments, the method is effective to decrease the level of a porphyrin and/or porphyrin precursor, e.g., ALA and/or BPG. In embodiments, the method is effective to produce a predetermined reduction in the elevated level of the porphyrin or porphyrin precursor, e.g., ALA and or PBG. In some embodiments, the predetermined reduction is a decrease of at least 10%, 20%, 30%, 40% or 50%. In some embodiments, the predetermined reduction is a reduction that is effective to prevent or ameliorate symptoms, e.g., pain or recurring attacks. In some embodiments, the predetermined reduction is a reduction that brings the level of the porphyrin or porphyrin precursor to a level that is less then, or to a level that is less than or equal to, a reference value (e.g., a reference value as described herein.) In some embodiments, the subjected to be treated according to the methods described suffers from pain, e.g., chronic pain. In some embodiments, the subject has or is at risk for developing a porphyria, e.g., an acute hepatic porphyria, e.g., AIP. In embodiments, the method is effective to treat the pain, e.g., by reducing the severity of the pain or curing the pain. In embodiments, the method is effective to decrease or prevent nerve damage. In some embodiments, the subject to be treated according to the methods described herein a) has an elevated level of ALA and/or PBG and B) suffers from pain, e.g., chronic pain. In embodiments, the method is effective to decrease an elevated level of ALA and/or PBG and/or treat the pain, e.g., by reducing the severity of the pain or curing the pain. In one embodiment, a subject to be treated according to the methods described herein, (e.g., a human subject or patient) is at risk of developing, or has been diagnosed with a disorder related to ALAS1 expression, e.g., a porphyria. In some embodiments, the subject is a subject who has suffered one or more acute attacks of one or more porphyric symptoms. In some embodiments, the subject is a subject who has suffered chronically from one or more symptoms of porphyria (e.g., pain and/or neuropathic pain and neuropathy and/or progressive neuropathy). In some embodiments the subject carries a genetic mutation (e.g., mutation) as described herein. In some embodiments, the subject has previously been treated with a heme product (e.g., hemin, heme arginate, Panhematin ^TM , or heme albumin), as described herein. In some embodiments, a subject (e.g., a subject with a porphyria, such as, e.g., AIP) to be treated according to the methods described herein has recently experienced or is currently experiencing a prodrome. In some embodiments, the subject is administered a combination treatment, e.g., a compound of the present invention and one or more additional treatments known to be effective against porphyria or its associated symptoms (e.g., pain and/or nausea). In another embodiment a compound of the present invention is administered in combination with glucose or dextrose. In another embodiment a compound of the present invention is administered in combination with a heme product. In another embodiment a compound of the present invention is administered in combination with (givosiran (Givlaari ^TM ). A ”prodrome” as used herein, includes any symptom that the individual subject has previously experienced immediately prior to developing an acute attack (e.g., porphyria). An acute “attack” of porphyria involves the onset of one or more symptoms of porphyria, typically in a patient who carries a mutation associated with a porphyria. In certain embodiments, administration of a compound of the present invention results in a decrease in the level of one or more porphyrins or porphyrin precursors as described herein (e.g., ALA and/or PBG). The decrease may be measured relative to any appropriate control or reference value as described herein and to those skilled in the arts. For example, the decrease in the level of one or more porphyrins or porphyrin precursors may be established in an individual subject, e.g., as a decrease of at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 50% or more compared with the level prior to treatment (e.g., immediately prior to treatment). A decrease in the level of a porphyrin precursor, a porphyrin, or a porphyrin metabolite may be measured using any method known in the art. For example, the level of PBG and/or ALA in urine or plasma may be assessed, using Watson-Schwartz test, ion exchange chromatography, or high-performance liquid chromatography-mass spectrometry (HPLC-MS), see e.g., Thunell (1993). In some embodiments, administration of a compound of Formula I is effective to reduce the level of ALA and/or PBG in the subject. The level of ALA or PBG in the subject can be assessed, e.g., based on the absolute level of ALA or PBG, or based on the relative level of ALA or PBG (e.g., relative to the level of another protein or compound, e.g., the level of creatine) in a sample from the subject. In some embodiments, the sample is a urine sample. In some embodiments the sample is a plasma sample. In some embodiments a compound of Formula I is administered after an acute attack of porphyria. In some embodiments a compound of Formula I is administered during an acute attack of porphyria. In some embodiments, administration of a compound of Formula I is effective to lessen the severity of the attack (e.g., by ameliorating one or more signs or symptoms associated with the attack). In some embodiments, administration of a compound of Formula I is effective to shorten the duration of the attack. In some embodiments, administration of a compound of Formula I is effective to prevent an acute attack of porphyria. In some embodiments the subject is at risk of developing a porphyria. In some embodiments, administration of a compound of Formula I is administered during prodrome. In some embodiments, the prodrome is characterized by pain (e.g., headache or abdominal pain) nausea, psychologic symptoms (e.g., anxiety) restlessness and/or insomnia. In some embodiments, administration of a compound of Formula I is effective to prevent or decrease the frequency or severity of pain and/or neuropathy, e.g., neuropathic pain. Effects on administration of a compound of Formula I can be established, for example, by comparison of a specific metric with an appropriate control. Specific metrics indicative of a therapeutic response for the administration of a compound of Formula I, for example are: decreased frequency of acute attacks, decrease in the level of one or more porphyrins or porphyrin precursors in a patient sample (e.g., urine and/or plasma), decrease in pain (e.g., abdominal pain and/or headaches, and/or pain in chest legs or back, decrease in nausea and/or vomiting, decrease in episodes of insomnia and improvement in anxiety, confusion, hallucinations, disorientation and/or paranoia. Methods described herein may also serve to reduce chronically elevated levels of porphyrin precursors (e.g., ALA and/or PBG) in subjects suffering from a porphyria (e.g., an acute hepatic porphyria, e.g., AIP) or at risk for developing a porphyria. Symptoms associated with porphyria may include abdominal pain or cramping, headaches, effects caused by nervous system abnormalities, and light sensitivity, causing rashes, blistering, and scarring of the skin (photodermatitis). In certain embodiments, the porphyrin is AIP. Symptoms of AIP include gastrointestinal symptoms (e.g., severe and poorly localized abdominal pain, nausea/vomiting, constipation, diarrhea, ileus), urinary symptoms (dysuria, urinary retention/incontinence, or dark urine), neurological symptoms (e.g., sensory neuropathy, motor neuropathy (e.g., affecting the cranial nerves and/or leading to weakness in the arms or legs), seizures, neuropathic pain, progressive neuropathy, headaches, neuropsychiatric symptoms (e.g., mental confusion, anxiety, agitation, hallucination, hysteria, delirium, apathy, depression, phobias, psychosis, insomnia, somnolence, coma), autonomic nervous system involvement (resulting (e.g., in cardiovascular symptoms such as tachycardia, hypertension, and/or arrhythmias, as well as other symptoms, such as, e.g., increased circulating catecholamine levels, sweating, restlessness, and/or tremor), dehydration, and electrolyte abnormalities. A method for treating a patient in need with a compound of Formula I and assessing the effectiveness of the treatment by a comparison of a post-treatment metric with a control value. For example, the metric under evaluation can be the levels of ALA and/or PBG and/or other porphyrin or porphyrin precursors in urine and/or serum post-treatment whereby a post-treatment sample is taken at 5 mins, 10 mins, 15 mins, 20 mins, 30 mins, 1h, 2h, 3h, 4h, 5h or greater than 5h after the administration of a compound of Formula I. The level of the post-treatment porphyrin or porphyrin precursor is than compared to normal patient standards as are described herein and/or evaluated by one skilled in the art. Administration of a second dose of a compound of Formula I may be given and another post-treatment sample taken as above. Subsequent evaluation of this second sample, by one skilled in the art, would determine if additional administrations of compounds of Formula I would be required. Post-treatment is any time period after the administration of the compound. A “precipitating factor” as used herein, refers to an endogenous or exogenous factor that may induce an acute attack of one or more symptoms associated with porphyria. Precipitating factors include fasting, (or other forms of reduced or inadequate caloric intake, due to crash diets, long-distance athletics, etc.), metabolic stresses (e.g., infections, surgery, international air travel, and psychological stress), endogenous hormones (e.g., progesterone), cigarette smoking, lipid-soluble foreign chemicals (including, e.g., chemicals present in tobacco smoke, certain prescription drugs, organic solvents, biocides, components in alcoholic beverages), endocrine factors (e.g., reproductive hormones (women may experience exacerbations during the premenstrual period), synthetic estrogens, progesterones, ovulation stimulants, and hormone replacement therapy). See, for example, Thunell (1993). Common precipitating factors include cytochrome P450 inducing drugs and phenobarbital. The invention further provides therapeutic methods and uses comprising administering a compound of the invention, or pharmaceutically acceptable salt thereof, alone or in combination with one or more other therapeutic agents or palliative agents. The compositions and methods described herein have utility in treating many disease conditions, including cancer. The invention further provides for the selection of patients for treatment by a compound of Formula I. Excess heme and products of the heme pathway facilitate tumor growth, thereby evaluating the levels of heme, and/or heme products, and/or ALAS1 levels independently, can select patients for treatment with a compound of Formula I. Notably, estrogen is known to elevate ALAS1 levels in estrogen-driven cancers (breast cancer, ovarian cancer and endometrial cancers) (Lu, Jia-Jing et al, Biomolecules 2023, 13, 1097: is incorporated herein by reference in its entirety). Cancers treated using methods, compositions and/or agents described herein are characterized by abnormal cell proliferation including, but not limited to, pre-neoplastic hyper-proliferation, cancer in-situ, neoplasms and metastasis. Method and compositions described herein can be used for prophylaxis, and amelioration of signs and/or symptoms of cancer. In one aspect, methods described herein predict whether a patient will be sensitive to the anti-cancer activity of a compound of Formula I when administered. In one aspect, provided herein are methods of treating a patient having a cancer, the method comprising administering a therapeutically effect amount of a compound of Formula I to a patient, wherein the patient’s cancer has a D190A mutation in a ClpP protein (US 2022/0143024). In one aspect, the cancer to be treated is from a group of estrogen-driven cancers: breast cancer, ovarian cancer and endometrial cancer. In one aspect, the cancer to be treated is a colorectal cancer (Zhao, Ya et al, Saudi J Gastroenterol 2020, 26(3), 144, doi: 10.4103/sjg.SJG_477_19 and Allocco, A. L. et al Cancers (Basel) 2022, 24(5),1230). In one aspect, the compositions and methods described herein are used to treat diseases such as ocular melanoma, desmoplastic round cell tumor, chondrosarcoma, leptomengial disease, diffuse large B-cell lymphoma, Acute Lymphoblastic Leukemia, Acute Myeloid Leukemia, Adrenocortical Carcinoma, Aids-Related Cancers, Aids- Related Lymphoma, anal or rectal cancer, appendix cancer, Astrocytomas, and atypical Teratoid/Rhabdoid tumor. In one aspect, the compositions and methods described herein are used to treat diseases such as basal cell carcinoma, basel cell nevus syndrome, Gorlin-Nevus Syndrome, Bile Duct Cancer, bladder cancer, bone cancer, osteosarcoma, and malignant fibrous histiocytoma, brain tumor, breast cancer, bronchial tumors, Burkitt lymphoma, and spinal cord tumors. In one aspect, the compositions and methods described herein are used to treat diseases such as carcinoid tumor, carcinoma of unknown primary, central nervous system atypical Teratoid/Rhabdoid tumor, leptomeningeal disease, central nervous system embryonal tumors, central nervous system lymphoma, cervical cancer, chordoma, Chronic Lymphocytic Leukemia, Chronic Myelogenous Leukemia, Chronic Myeloproliferative disorders, Colon cancer, colorectal cancer, craniopharyngioma, cutaneous T-cell lymphoma, embryonal tumors of the central nervous system, endometrial cancer, ependymoblastoma, ependymoma, esophageal cancer, Ewing Sarcoma, extracranial germ cell tumor, extragonadal germ cell tumor, extrahepatic bile duct cancer, eye cancer, gallbladder cancer, gastric cancer, gastrointestinal cancer, gastrointestinal stromal tumor, germ cell tumor, gestational trophoblastic tumor, glioma, hairy cell leukemia, head and neck cancer, hepatocellular cancer, histiocytosis, Hodgkin lymphoma, hypopharyngeal cancer, Kaposi sarcoma, kidney cancer, Langerhans Cell Histiocytosis, laryngeal cancer, lip and oral cavity cancer, liver cancer, lung cancer, Non-Hodgkin Lymphoma, Waldenstrom’s macroglobulinemia, malignant fibrous histiocytoma of bone and osteosarcoma, medulloblastoma, medulloepithelioma, melanoma, Merkel cell carcinoma, mesothelioma, metastatic squamous neck cancer with occult primary, multiple neoplasia syndrome, mouth cancer, multiple/plasma cell neoplasm, mycosis fungoides, myelodysplastic syndromes, neoplasms, multiple myeloma and myeloproliferative disorders. In one aspect, the compositions and methods described herein are used to treat cancer. The invention further provides therapeutic methods and uses comprising administering a compound of the invention, or pharmaceutically acceptable salt thereof, alone or in combination with one or more therapeutic agents or palliative agents. In one aspect, the invention provides a method for the treatment of disease states where an abnormally high concentration of a protein that is a substrate for ClpP exists in a subject comprising administering to the subject a therapeutically effective amount of a compound of the invention, or a pharmaceutically acceptable salt thereof. In one aspect, the invention provides a method for the treatment of disease states, including cancer where the reduction in the concentration of a protein that is a substrate for ClpP in a subject leads to an amelioration of disease comprising administering to the subject a therapeutically effective amount of a compound of the invention, or a pharmaceutically acceptable salt thereof. In one aspect, the invention provides a method for the treatment of disease states, including cancer where an abnormally high concentration of the protein, ClpP exists in a subject comprising administering to the subject a therapeutically effective amount of a compound of the invention, or a pharmaceutically acceptable salt thereof. In one aspect, the invention provides a method for the treatment of disease states where an abnormally low concentration of the protein, ClpP exists in a subject comprising administering to the subject a therapeutically effective amount of a compound of the invention, or a pharmaceutically acceptable salt thereof. In one aspect, the invention provides a method for the treatment of abnormal cell growth in a subject comprising administering to the subject a therapeutically effective amount of a compound of the invention, or a pharmaceutically acceptable salt thereof. In another aspect, the invention provides a method for the treatment of abnormal cell growth in a subject comprising administering to the subject an amount of a compound of the invention, or a pharmaceutically acceptable salt thereof, in combination with an amount of an anti-tumor agent, which amounts are together effective in treating said abnormal growth. In some embodiments, the anti-tumor agent is selected from the group consisting of mitotic inhibitors, alkylating agents, anti-metabolites, intercalating antibiotics, growth factor inhibitors, radiation, cell cycle inhibitors, enzymes, topoisomerase inhibitors, biological response modifiers, antibodies, cytotoxics, anti- hormones and anti-androgens. In another aspect, the invention provides a method of inhibiting cancer cell proliferation in a subject, comprising administering to the subject a compound of the invention, or pharmaceutically acceptable salt thereof, in an amount effective to inhibit cell proliferation. In another aspect, the invention provides a method for treatment for a cancer selected from the group consisting of solid tumors, liquid tumors, lymphomas, leukemias or myelomas. In some embodiments, treatment of cancer comprises prevention of tumor growth in a cancer subject, comprising administering to the subject a compound of the invention, or pharmaceutically acceptable salt thereof, in an amount effective to inhibit cell proliferation. In another aspect, the invention provides a method of inhibiting cancer cell invasiveness in a subject, comprising administering to the subject a compound of the invention, or pharmaceutically acceptable salt thereof, in an amount effective to inhibit cell proliferation. In another aspect, the invention provides a method of inducing apoptosis in cancer cells in a subject, comprising administering to the subject a compound of the invention, or pharmaceutically acceptable salt thereof, in an amount effective to inhibit cell proliferation. In another aspect, the invention provides a method of inducing apoptosis in a subject, comprising administering to the subject a compound of the invention, or pharmaceutic acceptable salt thereof, in an amount effective to inhibit cell proliferation. In frequent embodiments of the methods provided herein, the abnormal cell growth is cancer, wherein said cancer is selected from the group consisting of basal cell cancer, medulloblastoma cancer, liver cancer, rhabdomyosarcoma, lung cancer, bone cancer, pancreatic cancer, skin cancer, cancer of the head and neck, cutaneous or intraocular melanoma, uterine cancer, ovarian cancer, rectal cancer, cancer of the anal region, stomach cancer, colon cancer, breast cancer, uterine cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, Hodgkin’s disease, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, prostate cancer, chronic or acute leukemia, lymphocytic lymphomas, cancer of the bladder, cancer of the kidney or ureter, renal cell carcinoma, carcinoma of the renal pelvis, neoplasms of the central nervous system (CNS), primary CNS lymphoma, spinal axis tumors, brain stem glioma, pituitary adenoma, or a combination of one or more of the foregoing cancers. In some embodiments, the cells are in a tissue or tumor, and the tissue or tumor may be in a subject, including a human. Cancers treated using methods and compositions described herein are characterized by abnormal cell proliferation including, but not limited to, metastasis, pre-neoplastic hyperproliferation, cancer in situ, and neoplasms. Compounds of this invention can be for prophylaxis in addition to amelioration of signs and/or symptoms of cancer. Examples of cancers treated by the compounds of the present invention include, but are not limited to, breast cancer, CNS cancers, colon cancer, prostate cancer, leukemia, lung cancer and lymphoma. In another aspect, the invention provides a method for the treatment of a leukemia selected from the group consisting of: Acute Lymphoblastic Leukemia (ALL), Chronic Lymphocytic Leukemia (CLL), Chronic Myeloproliferative Disorders, Hair Cell Leukemia, Acute Myeloid Leukemia (AML), Chronic Myelogenous Leukemia (CML) and Langerhans Cell Histiocytosis. In another aspect, the invention provides a method for the treatment of a lymphoma selected from the group consisting of: diffuse large B-cell lymphoma, AIDS-Related Lymphoma, Cutaneous T-Cell Lymphoma, Sezary syndrome, mycosis fungoides (MF), Histiocytosis, Burkitt Lymphoma, Central Nervous System Lymphoma, Non-Hodgkin Lymphoma, Primary Central System Nervous System Lymphoma, Hodgkin Lymphoma, Waldenstrom’s macroglobulinemia, mycosis fungoides and lymphoplasmacytic lymphoma. In another aspect, the invention providesa method for the treatment of a cancer in a subject comprising administering to the subject a therapeutically effective amount of a compound of the invention, or a pharmaceutically acceptable salt thereof. In another aspect, the invention provides a method for the treatment of a cancer selected from the group consisting of: vaginal cancer, vulvar cancer, endometrial cancer, carcinoma of unknown primary site and cancer of unknown primary site. Another aspect of the present invention relates novel detection of ALAS1 as a biomarker of cancer, immunological diseases, neurological diseases and porphyrias in patient samples. Comparison of levels of ALAS1 in patient samples to reference levels. These biological samples may be acquired from the patient before, during or after treatment with a compound of the present invention and/or Formula I. The monitoring of ALAS1 in this way, with comparison to reference levels (both normal levels and prior patient sample levels), allow for the selection of a patient who may benefit from treatment of a compound of Formula I or from continued treatment with said compound, the continued treatment with a compound of Formula I with an adjustment in dose and schedule, or the stopping of said compound treatment. In addition, these samples may also be treated with compounds described by Formula I and the response to the compounds may be determined by changes in ALAS1 levels, changes in porphyrins, porphyrin precursors, porphyrin products and their metabolites, or other related marker to ALAS1. In some embodiments, the method is effective to decrease the level ALAS1 in a patient’s cancer. In embodiments, the method is effective to produce a predetermined reduction in the elevated level of ALAS1. In some embodiments, the predetermined reduction is a decrease of at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or >90%. In some embodiments, the predetermined reduction is a reduction that is effective to prevent or ameliorate symptoms. In some embodiments there is a reduction in tumor size. In some embodiments there is a reduction in cancer cell counts. In some embodiments, the predetermined reduction in ALAS1 is a reduction that brings the level of ALAS1 to a reference value (e.g., a reference value as described herein.) In some embodiments, the predetermined reduction in ALAS1 is a reduction that brings the level of ALAS1 to < 5% or 5% or 10% or 20% or 30% or 40% or 50% or 60% or 70% or 80% or 90% of a reference value (e.g., a reference value as described herein.) In some embodiments, the method is for treatment of a cancer in a patient where the following is applied: 1) determine a patient cancer’s ALAS1 level, 2) evaluated said level in comparison to a reference level, or levels, as described herein, 3) make a determination to treat the patient with a compound of Formula I, 4) treat the patient with a compound of Formula I with dose and schedule known to be therapeutic and 5) optionally treat the patient with an immune-therapy or a combination of immune- therapies. In another aspect, the invention provides a method for the treatment of a bacterial infection in a subject comprising administering to the subject a therapeutically effective amount of a compound of the invention, or a pharmaceutically acceptable salt thereof. In another aspect, the invention provides a method for the treatment of a staphylococcus aureus infection in a subject comprising administering to the subject a therapeutically effective amount of a compound of the invention, or a pharmaceutically acceptable salt thereof. In another aspect, the invention provides a method for the treatment of a neurodegenerative disease including by not limited to, Alzheimer’s disease, Parkinson’s disease, Huntington’s disease, amyotrophic lateral sclerosis, spinocerebellar ataxia, spinal muscular atrophy and motor neurone diseases in a subject comprising administering to the subject a therapeutically effective amount of a compound of the invention, or a pharmaceutically acceptable salt thereof. In another aspect, the invention provides a method for the treatment of erythropoietic protoporphyrin (EPP) in a subject comprising administering to the subject a therapeutically effective amount of a compound of the invention, or a pharmaceutically acceptable salt thereof. In another aspect, the invention provides a method for the treatment of erythropoietic protoporphyrin (EPP) in a subject with the dominant mutant (ClpX: p.Gly298Asp) comprising administering to the subject a therapeutically effective amount of a compound of the invention, or a pharmaceutically acceptable salt thereof. In another aspect, other conditions that may be suitable for the methods described herein include, but are not limited to, Attention Deficit Disorder; addiction; Epilepsy; viral infection; inflammation; neurodegenerative diseases such as Alzheimer’s disease, Parkinson’s disease, Huntington’s disease, Amyotrophic lateral sclerosis; cardiovascular diseases such as coronary artery disease, cardiomyopathy, hypertensive heart disease, heart failure, pulmonary heart disease, cardiac dysrhythmias, inflammatory heart disease, endocarditis, inflammatory cardiomegaly, myocarditis, valvular heart disease, cerebrovascular disease, peripheral arterial disease, congenital heart disease, rheumatic heart disease; diabetes and light chain amyloidosis. In another aspect, the invention provides a method for the treatment of cystic fibrosis. In another aspect, the invention provides a method for the treatment of Perrault syndrome. In another aspect, the invention provides a method for the treatment of Perrault syndrome type 3. In another aspect, the invention provides a method for the treatment of autoimmune disease. Autoimmune diseases include, but are not limited to alopecia areata, antiphospholipid, autoimmune hepatitis, celiac disease, diabetes type 1, Graves’ disease, Guillain-Barre syndrome, Hasimoto’s disease, hemolytic anemia, idiopathic thrombocytopenic purpura, inflammatory bowel disease, inflammatory myopathies, multiple sclerosis, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, scleroderma, Sjogren’s syndrome, systemic lupus erythematosus, psoriatic arthritis, Crohn’s disease and vitiligo. In another aspect, the invention provides a method for the treatment of allograft rejection. In another aspect, the invention provides a method for the treatment of hereditary spastic paraplegia. In another aspect, the invention provides a method for the treatment of the condition, acquired immunodeficiency syndrome (AIDS). In another aspect, the invention provides a method for the treatment of HIV and the condition, acquired immunodeficiency syndrome (AIDS). In another aspect, the invention provides a method for the treatment of the condition, pneumonia. In another aspect, the invention provides a method for the treatment of the condition, sepsis. In another aspect, the invention provides a method for the treatment of the condition, viral infection. In another aspect, the invention provides a method for the treatment of hepatitis in a subject, comprising administering to the subject a therapeutically effective amount of a compound of the invention, or a pharmaceutically acceptable salt thereof. In another aspect, the invention provides a method for the treatment of cryptogenic cirrhosis in a subject, comprising administering to the subject a therapeutically effective amount of a compound of the invention, or a pharmaceutically acceptable salt thereof. In another aspect, the invention provides a method for the treatment of hepatocyte senescence in a subject, comprising administering to the subject a therapeutically effective amount of a compound of the invention, or a pharmaceutically acceptable salt thereof. In another aspect, the invention provides a method for the treatment of nonalcoholic fatty liver disease (NAFLD) in a subject, comprising administering to the subject a therapeutically effective amount of a compound of the invention, or a pharmaceutically acceptable salt thereof. In another aspect, the invention provides a method for the treatment of nonalcoholic steatohepatitis (NASH) in a subject, comprising administering to the subject a therapeutically effective amount of a compound of the invention, or a pharmaceutically acceptable salt thereof. In many embodiments the subject or patient is a human. METHODS OF PREPARATION, CHEMICAL COMPOUNDS The compounds of this invention may be made by a variety of methods, including standard chemistry. Any previously defined variable will continue to have previously defined meaning unless otherwise noted. Illustrative general synthetic methods are set out below, specific compounds of Formula (I) are prepared in the Examples, and additional information on the synthesis of these compounds are described in the following citations: Sun H. et al ACS Med. Chem. Lett.2019, 10, 191-195 and references cited therein, WO 2018031990 and references cited therein, WO 2018 031987 and references cited therein, CN 1048600948 and references cited therein, and US 8,318,751 and references cited therein. In addition, the synthesis of many compounds of the present invention and methods that may be used or modified by those skilled in the art, are found in WO 2020/176654 and references contained therein and US 20220089596 and references contained therein. In addition, WO 2023/284807 provides synthetic details, specific for compounds of the present invention, given as Formula 18A and Formula 19A. In The CN patent application 2023106791890 and references cited therein provide methods for the synthesis of agents given as Formula Q23 and 25A. These methods may also be applied to the preparation of other compounds of the present invention. There are currently many suppliers of chemical reagents. Examples of chemical suppliers: Sigma Aldrich, Saint Louis, MO; Alfa Aesar, Tewksbury, MA; TCI America. Portland, OR; BroadPharm, San Diego, CA and Cambridge BioSciences, Cambridge, UK, in no way is this list meant to be limiting. BroadPharm also provides custom services providing reagents for the synthesis of compounds of this invention. ONC201 (CAS 1616632-77-9) is commercially available from a number of suppliers including: MEDCHEM Express, 1 Deer Park Drive, Suite Q, Monmouth Junction, NJ, 08852.2-(3-iodopropyl) isoindoline-1,3-dione is available from multiple vendors including Sigma-Aldrich (Aldrich CPR-R465674). In addition, 2-(4-iodobutyl) isoindoline-1,3-dione is also available from multiple vendors including Sigma-Aldrich (Aldrich CPR-R260312). Both ONC201 and ONC206 are available from commercial suppliers including SelleckChem, Houston, TX 77014, MedKoo BioSciences, Inc and Matrix Scientific, Columbia, SC 29224. ONC212 is available from SelleckChem, Houston, TX 77014. Compounds of general Formula (I) may be prepared by methods known in the art of organic synthesis as set forth in part by the following synthetic schemes. In all the schemes described below, it is well understood that protecting groups for sensitive or reactive groups are employed where necessary in accordance with general principles of chemistry. Protecting groups are manipulated according to standard methods of organic synthesis (T. W. Green and P. G. M. Wuts (1991) Protecting Groups in Organic Synthesis, John Wiley & Sons). Those skilled in the art will recognize whether a stereocenter exists in compounds of Formula (I). Accordingly, the present invention includes all possible stereoisomers and includes not only mixtures of stereoisomers (such as racemic compounds) but the individual stereoisomers. When a compound is desired as a single isomer it may be obtained by various methods of separation of the final product or key intermediate or alternatively may be made by a stereo specific synthesis using isomerically pure intermediates or methods to impart isomeric purity. These are known to those skilled in the art. Compounds were analyzed by common methods known to those skilled in the art. NMR and HPLC and LCMS were used to evaluate isolated compounds and to evaluate reaction mixtures. LCMS conditions used water and MeCN as the two solvents using a Symmetry C18, 5 um, 4.6 X 50 mm column. A linear gradient was used from time 0 (90% H20, 10 % MeCN, 0.1% TFA) to time 4.5 min (5% H20, 95% MeCN, 0.1% TFA). The flow rate was 1.7 ml/min. Evaluation was at 254 nm. The following solvents, reagents, protecting groups, moieties, and other designations may be referred to by their abbreviations: Me: methyl; Et: ethyl; Pr: propyl; i-Pr: isopropyl; Bu: butyl; t-Bu: tert-butyl ; Ac: acetyl ACN: acetonitrile AcOH: acetic acid Aq.: aqueous AUC: area under a curve BOC or Boc: tert-butyloxycarbonyl Conc.: concentrated DMF: dimethylformamide DMSO: dimethylsulfoxide EDCI or EDC: 1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide EtOAc: ethyl acetate EtOH: ethyl alcohol Ex.: Example g: grams h: hours HPLC: high-performance liquid chromatography LCMS: liquid chromatography mass spectrometry MeOH: methyl alcohol MeI: methyl iodide MS: mass spectrometry NA: not applicable ND: no data reported NMR: nuclear magnetic resonance spectrometry NT: not tested Ph: phenyl, Ret Time: retention time RT or rt: room temperature Satd, Sat’d, sat’d and satd.: saturated TEA: triethylamine TFA: trifluoroacetic acid THF: tetrahydrofuran Of particulate note is the use of toluene analogs as reagents and synthetic intermediates. There are numerous commercial sources of toluene analogs which may be used directly or converted to useful reagents or intermediates used for the synthesis of compounds of this invention. Numerous methods are known to those skilled in the art for the interconversion of toluene analogs to provide reagents and intermediates useful for the synthesis of the compounds of this invention. Example described herein include the bromination of the methyl residue (Ex.85). In addition, benzyl alcohols may be converted to the corresponding benzyl amines via oxidation to the aldehyde followed by a reductive amination process (Ex.85). These examples are not to be limiting. Additional examples may be found in the references cited herein. Scheme 1 A general synthetic scheme shown as Scheme 1, is a series of reactions that one skilled in the art may use to prepare compounds of the invention. The synthesis of S8 is shown however this is not meant to be limiting. This example is not to be limiting with regard to the number and type of substituents that may be used therein. Alternative reaction conditions, known to those skilled in the art, may be employed for the various transformations in Scheme 1. Additional information providing additional details for the synthesis of the compounds of the present invention are: 1) US 10,597,380 and references cited therein, 2) WO 2008/109180 and references cited therein and 3) US 2019/0127349 and references cited therein, there are in no way meant to be limiting. Scheme 1 A general synthetic scheme as shown in Scheme 2, is a series of reactions that one skilled in the art may use to prepare compounds of the present invention such as those of Formula 16A (S2.4) and Formula 9A (S2.6 & S2.7). Shown herein is the synthesis of S2.4, S2.6 and S.2.7. Central to this chemical synthetic route is the use of isocyanates here shown as S2.3. In this case the isocyanate required has the chemical formula of: C ₈ H ₆ ClNO. Isocyanates are common reagents made from the corresponding benzylamine by the reaction with phosgene or a phosgene equivalent. Alternative reaction conditions may be employed for the various transformations in Scheme 2. This example is not to be limiting with regard to the number and type of substituents that may be used therein. Scheme 2

A general synthetic scheme as shown in Scheme 3, is a series of reactions that one skilled in the art may use to prepare compounds of the invention. Shown herein is the synthesis of S3.3. This synthetic scheme draws on the chemistry described in Scheme 1 and chemistry described in Example 85. Compound S3.1 is commercially available from a number of suppliers (AstaTech Inc., AA Blocks, Mcule). Those skilled in the art may make additional changes to this scheme. Scheme 3 A general synthetic scheme as shown in Scheme 4, is a series of reactions that one skilled in the art may use to prepare compounds of the invention. Shown herein is the synthesis of S4.4. This synthetic scheme draws on the chemistry described in Hang J. et al J Med Chem 2022 Jun 9;65(11):7629-7655 and references cited therein and Zhong, J. et al, 2022 Aug 27;204:115232 and references cited therein. Those skilled in the art may make additional changes to this scheme. Scheme 4

A general synthetic scheme as shown in Scheme 5, is a series of reactions that one skilled in the art may use to prepare compounds of the invention. Shown herein is the synthesis of S5.5 and key intermediates for the preparation of compounds of Formula 15A. This synthetic scheme draws on the chemistry described in Krishnananthan S. et al J Org Chem 2016, 81(4), 1520-1526 and references cited therein and Prime M. et al J Med Chem 2011, 54(1), 312-319 and references cited therein. Alternative nucleophiles may be employed in the synthetic scheme to react with S5.3 (such as oxygen-based or sulphur based). Removal of the Boc residue on S5.4 results in the corresponding amine which may be alkylated with the appropriate benzyl halide yielding analogs of Formula 15A, or alternatively as shown in this scheme the amine may undergo a reductive amination reaction yielding the final agent. A very similar transformation is seen in Example 91. Those skilled in the art may make additional changes to this scheme. Scheme 5

A general synthetic scheme as shown in Scheme 6, is a series of reactions that one skilled in the art may use to prepare compounds of the invention. Shown herein is the synthesis of S6.7. The reductive amination and alkylation conditions are provided herein, through cited references and to those skilled in the art. Those skilled in the art may make additional changes to this scheme. Scheme 6 A general synthetic scheme as shown in Scheme 7, is a series of reactions that one skilled in the art may use to prepare compounds of the invention. Shown herein is the synthesis of S7.5. Those skilled in the art may make additional changes to this scheme. Scheme 7

A general synthetic scheme as shown in Scheme 8, is a series of reactions that one skilled in the art may use to prepare compounds of the invention (Formula 25A). Shown herein is the synthesis of S8.3. Those skilled in the art may make additional changes to this scheme. Scheme 8

EXAMPLES Chemistry Examples The following show examples of the chemical compounds. In no way is this meant to be limiting. Examples 1-27 Examples 1-27 were prepared as described in: WO 2018031987. Examples 28-58 Examples 28-58 were prepared as described in: WO 2018031990 and references cited therein.

Examples 57-84 (as described in US 2020/019944 and references cited therein) p p p

p p p Example 85 3-((3-(4-chlorobenzyl)-4-oxo-3,5,7,8-tetrahydropyrido[3,4-d] pyridazin-6(4H)- yl)methyl)benzonitrile Example 85 is made by the following synthetic scheme: 3-Cyano-4-methypyridine (85.1) was dissolved in 50 ml of THF, and 4N sodium hydroxide (50 mL) was added. The solution was refluxed for 2h. The solvent was removed in vacuo and water was added. HCl was added to make the mixture a pH 6. The resulting precipitate was filtered to give 13g material (85.2) (95%). 4-Methyl-3-pyridine-carboxylic acid (85.2) was dissolved in methanol (100 mL) and concentrated sulfuric acid (6 mL) was added. The solution was heated at 60 ^o C for 16 h. Then the solution was concentrated in vacuo, neutralized with saturated sodium carbonate and extracted with CH ₂ Cl ₂ . Evaporation of the solvent gave methyl 4- methyl-3-pyridinecarboxylate 85.3 (12.0g, 84%). Methyl 4-methyl-3-pyridinecarboxylate 85.3 (12g) was dissolved in 150 mL of CCl ₄ , and NBS (56.6g) and benzoyl peroxide (9.6g) was added. The mixture was heated at 80 ^o C for 48 h. The mixture was concentrated under reduced pressure and the residue was separated by column chromatography to give the desired dibromo compound 85.4 (15.0g). To a solution of compound 85.4 in methanol was added hydrazine (1.6g). The solution was heated under reflux for 5h. The solvent was removed under reduced pressure and the residue was separated by chromatography to give compound 85.5 (2.0g, 27%). To a solution of compound 85.5 (2.0 g) in trifluoroacetic acid was added PtO ₂ (500 mg). The system was stirred under high pressure hydrogen (50 psi) at room temperature for 25h. The mixture was filtered and the filtrate was concentrated, neutralized with sodium carbonate and extracted with EtOAc. The residue was purified by column chromatography to give 600 mg of product 85.6.

To a solution of compound 85.6 (600 mg) in methanol was added 3- cyanobenzaldehyde (520 mg). Sodium triacetoxyborohydride（1.26g）was added. The mixture was reacted at room temperature for 20h. Aqueous work up, organic extraction, concentration and column chromatography gave 300 mg of compound 85.7. To a solution of 85.7 (300 mg) in MeCN was added 4-chlorobenzyl bromide (231mg) and potassium carbonate (234mg). The mixture was heated at 60 ^o C for 20h. Aqueous workup, organic extraction, concentration and column chromatography gave 80 mg of the desired product Example 85 (18%). ¹ HNMR (400MHz, CDCl ₃ ) δ 7.67 (s, 1H), 7.58 (t, J=4.8Hz, 3H), 7.43 (d, J=4.4Hz, 1H), 7.35 (d, J=8.4Hz, 2H), 7.29 (s, 2H), 5.24 (s, 2H), 3.73 (s, 2H), 3.47 (s, 2H), 2.68 (s, 4H); LC-MS: m/z = 391.1 (M+1) Example 86 Example 86 was prepared as described in Hang J, et al. J Med Chem 2022 Jun 9, 65(11): 7629-7655. Example 87 Example 87 is the compound known as D9: D9 was prepared as described in: Sieber S.A. et al, Angew. Chem. Int. Ed.2008, 57, 14,602-14,607. Example 88-89 Examples 88-89 were prepared as described in WO 2018031987 and references therein. In addition, see Bonner, E.R. et al, Neuro-Oncology 2020, 24(4), 542-556 and references cited therein. Example 90 3-((7-(4-chlorobenzyl)-8-oxo-3,4,7,8 -tetrahydro-2,7-naphthyridin-2(1H)- yl)methyl)benzonitrile Synthesis of 5,6,7,8-tetrahydro-2,7-naphthyridin-1(2H)-one 90.2 To a solution of 2,7-naphthyridin-1(2H)-one 90.1 (1.0 g, 2.83 mmol) in methanol (50 ml) was added PtO2 (1.0 g, 4.40 mmol) under hydrogen. Hydrogen balloon was fitted, and the hydrogen gas was exchanged three times. The solution was stirred at r.t for 15 h. TLC of the reaction mixture found that there was no SM. The solution was filtered, the solvent evaporated in vacuo, and separated by column chromatography. Eluent fractions with the desired material were combined and the solvent was evaporated in vacuo to give 0.55 g of 90.2. Synthesis of 3-((8-oxo-3,4,7,8-tetrahydro-2,7-naphthyridin-2 -(1H)-yl)-methyl)- benzonitrile 90.4 A mixture of 5,6,7,8-tetrahydro-2,7-naphthyridin-1(2H)-one 90.2 (0.25 g), 3- cyanobenzyl bromide (0.49 g) and potassium carbonate (0.52 g) in acetonitrile (30 mL) was stirred at room temperature for 15 h. The solution was filtered, concentrated in vacuo and the desired material was isolated by chromatography to give 0.18 g of the desired product, 90.4. Synthesis of 3-((7-(4-chlorobenzyl)-8-oxo-3,4,7,8 -tetrahydro-2,7-naphthyridin-2(1H)- yl)methyl)benzonitrile, Example 90 To a solution of 3-((8-oxo-3,4,7,8-tetrahydro-2,7-naphthyridin-2 -(1H)-yl)-methyl)- benzonitrile 90.4 (0.18 g) in THF (10 mL) at 0 ^o C was added NaH (55 mg) and the mixture was stirred for 0.5 h.4-chlorobenzylchloride, (0.164 g) was added and the solution was stirred at r.t. overnight. The subsequent workup: (NH ₄ Cl (aqueous, 3 X 5 mL (EtOAc extraction), extracts were combined and the solvent was removed in vacuo, chromatographic separation gave 65 mg of Example 90. LCMS 390.0 M+H. NMR 400 MHz: 7.73 (s, 1H), 7.64 (m, 2H), 7.59 (m, 2H), 7.43(m, 1H), 7.24-7.33(m, 4H), 7.12 (d, 1H, 7.2 Hz), 6.04 (d, 1H, J = 6.8 Hz), 5.09 (s, 2H), 3.76 (s, 2H), 3.51 (s, 2H), 2.70 (s, 4H). Example 91 5-((7-(4-chlorobenzyl)-8-oxo-3,4,7,8-tetrahydro-2,7-naphthyr idin-2(1H)- yl)methyl)isophthalonitrile Example 91 Example 91 was similarly prepared to Example 90 with 3,5-dicyanobenzyl bromide, 91.1 in place of 3-cyanobenzyl bromide, 90.3: Example 91: LCMS 415.2 (M+H): Ret Time 1.663 min: (Column: Waters Co. C18, 5 μm, 4.6 mm X 50 mm), flow rate: 2 mL/min., mobile phase (B: acetonitrile; A: 0.1% TFA in water), gradient (0-2.5 min linear gradient: time 0 min: 10% B & 90 % A & time 2.5 min: 95% B & 5% A) Analytical data for intermediate after reaction A: (5-((8-oxo-3,4,7,8-tetrahydro-2,7- naphthyridin-2(1H)-yl)methyl)iso-phthalonitrile): LCMS 290.1. NMR 400 MHz: 11.37ppm (1H), 8.39 (1 H), 8.16 (2H), 7.17 (d, 1H, J= 6.8Hz), 6.00 (1H, d, J=6.4 Hz), 3.77 (s, 2H), 3.18 (s, 2H), 2.63 (s, 4H). Example 92 5-((3-(4-chlorobenzyl)-4-oxo-3,5,7,8-tetrahydropyrido[3,4-d] pyridazin-6(4H)- yl)methyl)isophthalonitrile Example 92 Example 92 was similarly prepared to Example 91. Example 92: LCMS 416. (M+H): Ret Time 1.737 min (HPCL conditions as described in Example 91. Biology Examples, Data and Experimental The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the present invention and are not intended to limit the scope of this invention. Efforts have been made to ensure accuracy with respect to numbers used (e.g., amount, temperature, etc.) but some experimental errors and deviations should be accounted for. a) Experimental Procedure/Materials, Methods and Results The compounds of the present invention reduce ALAS1 levels in a cell and/or tissue. Various methods for evaluating ALAS1 levels are known to those skill in the arts and further details are described herein. Additional details on determining ALAS1 levels are found in Lu, Jia-Jing, Biomolecules 2023, 13, 1097 and references cited therein, patent no. US 11,028,382 and US20220403382 which is incorporated in its entirety. ALAS1 levels may be determined before, during, or after treatment of a compound of Formula I. Reference ALAS1 levels may be determined from references cited herein by those skilled in the arts, and from a study method by Lu, Jia-Jing, (Biomolecules 2023, 13, 1097) where data taken from the Cancer Genome Atlas and Clinical Proteomic Tumor Analysis Consortium (CPTAC) provide normal reference levels of ALAS1. In addition, the Lu, Jia-Jing et al study reports a comparison of ALAS1 reference values with primary tumor ALAS1 levels. Statistical analyses provide confidence in identifying ALAS1 levels in cancer patient tumors that is different from normal levels and thereby patients to be selected for treatment with a compound of Formula I. Both gene expression RNA-seq levels and protein expression levels of ALAS1 in endometrial cancer tissues show statistically significant differences vs normal reference levels. The present invention teaches that any cancerous tumor may be the subject of an analysis in addition to the primary tumor analysis done by Lu, Jia-Jing et al. ALAS1 protein is decreased by Ex.51 or Ex.88 as determined by mass spectrometry proteomics. SUM159 breast cancer cells were incubated with the small molecule ClpP activators Ex.51 or Ex.88 for a period of 24 hrs. Control treatments were the same incubation with DMSO (0.01%). Cells were washed to remove culture media, lysed, the proteins extracted and trypsin digested. The resultant peptides were purified by C18 chromatography and the peptides analyzed by mass spectrometry. Peptide identification and quantification was performed on a ThermoScientific Q-Exactive HF mass spectrometer using Perseus/Maxquant. Peptide ratios compared to DMSO treated cells were obtained. From this list, 5-aminolevulinate synthase (ALAS1 protein (Uniprot P13196), was detected and significant decreases in ALAS1 were observed: Ex. 51= log2 fold change -1.2, p-value 0.03; Ex. 88= log fold change -0.51, p-value 0.1). Confirmation of ALAS1 degradation by immunoblotting (Western blotting) (Figure 1) To confirm the mass spectrometry observations, lysates from SUM159 cells treated as described above were prepared, the proteins separated on a 10% polyacrylamide gel and transferred to PVDF or nitrocellulose membrane. Western blotting for ALAS1 was performed by standard methods (known to those skilled in the arts) using a polyclonal antibody specific for ALAS1 (ABCAM Cat #154860). ALAS1 protein was quantified by goat anti-rabbit secondary antibody and ECL. Protein loading controls (p32) were included for these experiments. Time dependent degradation of ALAS1 by Ex.51 and Ex.88 were compared. ALAS1 is degraded in non-cancer HUMEC cells (Western blotting) (Figure 2) Human mammary epithelial cells (HUMECs) were incubated with Ex.51 in a dose and time-dependent manner as described in Figure 2. Samples were prepared and Western blotted for ALAS1 as described herein and in Figure 1. Vinculin was included as a protein loading control. These experiments demonstrate both time and dose-dependent degradation of ALAS1 in normal cells. ALAS1 is rapidly degraded after Ex.88 and Ex.51 treatment (Western blotting) (Figure 3) Experiments were performed as described herein and in Figure 2. Times of treatment are shown in the figure. Notable decrease in ALAS1 over a 30 minute time period. ALAS1 is rapidly degraded after Ex.85 and Ex.51 treatment (Western blotting) (Figure 4) Experiments were performed as described herein and in Figure 2. Times of treatment are shown in the figure. Notable decrease in ALAS1 in a 30 minute time period and the response is sustained over 24 hrs. ALAS1 is degraded after Ex.88 and Ex.51 treatment (Western blotting) (Figure 5) Figure 6 shows a western blot of a series of compounds from the present invention. The experiments were run as follows: Methods for ALAS1 Blot SUM159 cells (BioIVT, HUMANSUM-0003006) were maintained in DMEM:F12 (Gibco, 11330-032) with 5% fetal bovine serum (Corning, 35015CVEA), 1% antibiotic/antimycotic (Gibco, 15240062), 1 ^g/mL insulin (Gibco, 12585014), and 5 ^g/mL HCS (Sigma, H0396). CRISPRi was used to generate ClpP-knockout SUM159 cells as previously described in Fennell et al. Pharmacol Res Perspect, 2022. SUM159 WT and ClpP KO cell lines were maintained in parallel below passage 40 in 10cm plates (Corning, 430167). For experimental setup, SUM159 cells were plated at 1.0E- 5 cells/well in a 6-well plate (Corning, 2516) and allowed to adhere overnight. Cells were treated with indicated concentrations of drug or 0.1% dimethyl sulfoxide (DMSO) for 24 hours. On ice, the media was aspirated and cells were washed with Dulbecco’s phosphate buffered saline (DPBS) (Gibco, 14190144) before being manually scraped in DPBS. Once scraped, cells were pelleted at 2 xg for 3 minutes in a ThermoScientific Legend Micro21 centrifuge. Cell pellets were lysed in RIPA buffer (50 mM Tris HCl, 150 mM NaCl, 1.0% (v/v) NP-40, 0.5% (w/v) Sodium Deoxycholate, 1.0 mM EDTA, 0.1% (w/v) SDS and 0.01% (w/v) sodium azide at a pH of 7.4) supplemented with complete protease inhibitor cocktail (Roche, 11836170001), 2 mM Na(VO3)4, 10 mM NaF, and 0.0125 μM calyculin A. Lysates were clarified at 21,000 xg for 10 minutes (cell lysate supernatant). Protein content of the cell lysate supernatant was measured by Bradford dye (BioRad, 5000006) according to manufacturer’s protocol (BioRad). Cell lysate supernatant samples were normalized to 1mg/mL with Laemmeli buffer (65.8 mM Tris-HCl, pH 6.8, 2.1% SDS, 26.3% (w/v) glycerol, 0.01% bromophenol blue) and DI water, heated for 5 minutes at 95 ^o C and proteins separated on 10% SDS- polyacrylamide gel electrophoresis (SDS-PAGE) with 20 ^g of protein loaded in each well. One well contained only protein molecular weight standard markers (BioRad, Precision Plus Cat# 1610374). Western blot electrophoretic transfer of proteins from the SDS-PAGE gel to nitrocellulose membranes (BioRad, 1620112) was performed in Tris glycine-methanol transfer buffer (25 mM Tris, 192 mM Glycine, 20% (v/v) methanol, pH ~8.3) using a BioRAD tank transfer apparatus (1 hr, 110 volts). Immunoblotting for ALAS1 and vinculin was performed as described below. Primary antibodies (Vinculin- Santa Cruz, sc-73614; ALAS1- Abcam, ab154860) were used at 1:1000 dilution, respectively, in TBST buffer (20 mM Tris pH7.6 -buffered Saline (150mM NaCL)+Tween (Sigma P1379) (0.1%v/v)) plus 1% fish gelatin (Sigma G7041). After incubation in primary antibodies for 15 hrs, the nitrocellulose membranes (BioRad, 1620112) were washed 3 times for 10 minutes in TBST. Membranes were incubated with secondary antibodies (Promega, anti-mouse and anti-rabbit IgG horseradish peroxidase (HRP) conjugated antibodies; W4011 and W4021, respectively) in 5% milk (dry powder) for 1 hr. Membranes were washed again 3 times for 10 minutes each in TBST before enhanced chemiluminescence (ECL) reagents (BioRad Clarity Western ECL Substrate, 1705061) were added to visualize bands. The membranes were imaged on the BioRad Chemidoc MP Imaging System and the ALAS1 and vinculin corresponding luminescent bands compared to the molecular weight standards.Experiments were performed as described herein and in Figure 2. Times of treatment are shown in the figure. Notable decrease in ALAS1 in a 3 h time period and the response is sustained over 48 hrs. Example 85 was examined on cancer cells (HCT116 and MDA-MB-231) as described in US20220089596A1. This example showed an IC ₅₀ on HCT116 cells of 8.0 nM and an IC ₅₀ of 3.0 nM on MDA-MB-231 cells. Examples 90 and 91 were examined on cancer cells (HCT116 and MDA-MB-231). Example 90 showed an IC ₅₀ on HCT116 cells of 17 nM and an IC ₅₀ of 20 nM on MDA-MB-231 cells and Example 90 showed an IC ₅₀ on HCT116 cells of 45 nM and an IC ₅₀ of 35 nM on MDA-MB-231 cells. Cell proliferation assays for Ex.90 and Ex.91 were as follows: Cells (either MDA MB 231 or HCT116) were collected at logarithmic growth stage and cell viability was measured. These cells were independently suspended in culture media (MDA-MB- 231: RPMI-1640 and 10% FBS; HCT116: McCoy’s 5A and 10% FBS) and inoculated into 96-well plates (Corning 3610) with 100 μL of cell suspension added. These culture plates were placed in an incubator with high humidity, 37 ^o C and 5% CO ₂ overnight. Test articles and control DMSO solutions were prepared. The final concentrations of Ex.90 and Ex.91 solutions were initiated from 100 μM DMSO/water solution with 4-fold dilution yielding 9 concentrations in total. The cells plates were then incubated in an incubator at high humidity, 37 ^o C and 5% CO ₂ for 72 hrs. The 96-well plate was placed at room temperature for 30 min, and 60 mL CellTiter-Glo (CTG) reagent was added. After 30 min, the luminescent signal is measured on a EnVision 2104 enzyme-labeled instrument, the chemiluminescence values are read and the inhibition rate calculated. Calculation of inhibition rate according to the following formula Cell growth inhibitory rate (%) = (1-RLUs/RLUv) X 100%; RLUs: RLU of sample (Cells + Test article); RLUv: RLU of vehicle control (Cells + CTG + DMSO). GraphPad Prism 6 software was used to fit the curve and calculate the IC50 values. List of Abbreviations A549: human non-small cell lung cancer cell line AIP: acute intermittent porphyria ALA: delta-aminolevulinic acid ALAS1: 5’-aminolevulinate synthase 1 PBG: porphobilinogen BSA: bovine serum albumin ClpP: caseinolytic protease P DMSO: dimethylsulphoxide DNA: deoxyribonucleic acid EDTA: ethylenediaminetetraacetic acid ELISA: enzyme-linked immunosorbent assay FACS: fluorescence activated cell scan/sorting HEPES: 4-(2-Hydroxyethyl)piperazine-1-ethanesulphonic acid IHC: immunohistochemistry MAB: monoclonal antibody mRNA: messenger ribonucleic acid PBS: phosphate buffered saline RPMI-1640: cell culture medium used for culturing transformed and non-transformed eukaryotic cells and cell lines siRNA: small inhibitory ribonucleic acid TR compound or TR compounds: any compound or set of compounds described herein with nomenclature beginning with TR. For example: TR57 or TR-57. Amino Acid Sequence Protein: ALAS1 Organism: Homo sapiens sp|P13196|HEM1_HUMAN 5-aminolevulinate synthase, non-specific, mitochondrial OS=Homo sapiens OX=9606 GN=ALAS1 PE=1 SV=2 MESVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRALSTAAVHY QQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGHPLPATSQGTASKCPF LAAQMNQRGSSVFCKASLELQEDVQEMNAVRKEVAETSAGPSVVSVKTDGGDPS GLLKNFQDIMQKQRPERVSHLLQDNLPKSVSTFQYDRFFEKKIDEKKNDHTYRVFK TVNRRAHIFPMADDYSDSLITKKQVSVWCSNDYLGMSRHPRVCGAVMDTLKQHGA GAGGTRNISGTSKFHVDLERELADLHGKDAALLFSSCFVANDSTLFTLAKMMPGCEI YSDSGNHASMIQGIRNSRVPKYIFRHNDVSHLRELLQRSDPSVPKIVAFETVHSMDG AVCPLEELCDVAHEFGAITFVDEVHAVGLYGARGGGIGDRDGVMPKMDIISGTLGK AFGCVGGYIASTSSLIDTVRSYAAGFIFTTSLPPMLLAGALESVRILKSAEGRVLRRQ HQRNVKLMRQMLMDAGLPVVHCPSHIIPVRVADAAKNTEVCDELMSRHNIYVQAIN YPTVPRGEELLRIAPTPHHTPQMMNYFLENLLVTWKQVGLELKPHSSAECNFCRRP LHFEVMSEREKSYFSGLSKLVSAQA (SEQ ID NO: 1)