SEQUENCE SPECIFIC DEGRADATION OF SINGLE-STRANDED POLYNUCLEOTIDES WITH CARD1 NUCLEASE CROSS-REFERENCE TO RELATED APPLICATIONS [0001] This application claims priority to U.S. provisional application no.63/120,565, 5 filed on December 2, 2020, and to U.S. provisional application no.63/054,157 filed on July 20, 2020, the disclosures of each of which are incorporated herein by reference. STATEMENT REGARDING FEDERALLY SPONSORED RESEARCH OR DEVELOPMENT [0002] This invention was made with government support under Grant No. 10 DP1GM128184 awarded by the National Institutes of Health. The Government has certain rights in the invention. FIELD OF THE INVENTION [0003] This disclosure generally relates to the field of CRISPER/CAS systems, and more particularly to Cas1 systems, and diagnostic methods using a Cas1 nuclease, optionally 15 in conjunction with a Cas10 protein, and specifically to a CARD1 protein. BACKGROUND OF THE DISCLOSURE [0004] Clustered, regularly interspaced short palindromic repeat (CRISPR) loci consist of repetitive DNA sequences intercalated with “spacer” sequences that match the genomes of viruses and plasmids that infect bacteria and archaea (1, 2). These loci are 20 transcribed and processed to generate short RNA guides that contain the spacer sequence, known as the CRISPR RNA (crRNA) (3). Different effector complexes, encoded by the CRISPR associated (cas) genes, use the crRNA guides to find and destroy the nucleic acids of the invader (4). Depending on their cas gene content, CRISPR-Cas systems can be classified into six different types (5). Of these, type III systems display the most elaborate 25 targeting mechanism. The crRNA in the type III Cas10 effector complex recognizes complementary invader’s transcripts (6, 7), resulting in the activation of two catalytic domains within Cas10. The HD domain initiates single-stranded DNA (ssDNA) cleavage near the target transcription site (7, 8); i.e. within the genome of the invader. At the same time the Palm domain converts ATP into 3’-5’ cyclic oligoadenylate (cA) of various sizes, 30 commonly cA4 and cA6 (9, 10). These molecules function as secondary messengers that bind the CRISPR-Cas Associated Rossmann Fold (CARF) domain of Csm6 (11) or Csx1 (12), accessory RNases often found in type III-A or III-B loci, respectively. Binding of cA to the CARF domain activates an RNase domain, through which Csm6 degrades host and invader transcripts non-specifically, inducing a growth arrest essential for the type III-A CRISPR-Cas immune response against targets that are transcribed either weakly (13, 14) or late in the viral infection cycle (15). 5 [0005] Recent bioinformatics studies revealed the existence of a great diversity of genes associated with type III CRISPR-cas loci (16, 17). Many of them contain CARF domains fused to different effector domains with predicted catalytic or regulatory functions (18). Biochemical and structural analysis determined that one such protein, Thermus thermophilus Can1, is activated by cA ₄ binding to introduce nicks only in supercoiled DNA 10 (19). However, whether and how these type III-associated, CARF-containing proteins, can be activated to provide immunity to prokaryotes remains to be demonstrated. Thus, there is an ongoing and unmet need to determine the characteristics of such proteins, and how they can be used to enhance and develop methods of using them. The present disclosure is pertinent to this need. 15 SUMMARY [0006] The present disclosure provides an isolated or recombinantly expressed protein comprising the sequence of SEQ ID NO:1, or an amino acid sequence that is at least 90% identical to the sequence of SEQ ID NO:1, such proteins referred to herein as “CARD1.” In embodiments, the isolated or recombinantly expressed protein comprising the 20 sequence of CARD1 comprises additional amino acids that are not part of the CARD1 sequence, including but not necessarily limited to a purification tag. In non-limiting embodiments, the purification tag comprises a FLAG tag, a poly-histidine tag, such as 3-6 Histidine residues, a SUMO tag, GST, and the like. In embodiments, the protein may be biotinylated or conjugated to streptavidin. The disclosure also provides that the CARD1 25 protein is present within a cell that is not Treponema succinifaciens. In embodiments, the disclosure provides a cDNA encoding the CARD1 protein, including but not necessarily limited to a codon-optimize cDNA for expression in a particular organism; an expression vector encoding the CARD1 protein; and one or more cells comprising the expression vector encoding the CARD1 protein. 30 [0007] In embodiments, the disclosure provides a method comprising expressing the CARD1 protein in cells and separating the CARD1 protein from the cells. Also provided is a method comprising introducing into one or more cells the CARD1 protein, or an expression vector encoding the CARD1 protein. In embodiments, if the protein is expressed by the expression vector, expression of the protein from the expression vector may be controlled by an inducible promoter. In embodiments, the CARD1 protein degrades ssDNA, ssRNA, or a combination thereof. The disclosure also includes a method comprising including a CARD1 protein in an assay comprising Cas10 and RNA from a biological sample, and a guide RNA 5 targeted to an RNA polynucleotide that may be in the biological sample, and determining whether or not the CARD1 cleaves a reporter ssDNA or reporter ssRNA that is added to the sample. If an RNA polynucleotide to which the guide RNA is present is in the sample, the method further comprises detecting a detectable signal produced at least in part by CARD1 cleavage of the reporter ssDNA or ssRNA. In embodiments, the RNA polynucleotide to 10 which the guide RNA is specific is present in the assay comprises a viral mRNA, a viral genomic RNA, a viral subgenomic RNA, or a combination thereof. In embodiments, the described assay is comprised by a container, or a lateral flow device. In embodiments, the presence of viral RNA is detected, and the method further comprises administering to the individual from whom the biological sample was obtained an anti-viral agent, and/or one or 15 more antibodies that bind with specificity to the virus. [0008] In another embodiment, the disclosure provides a kit. The kit comprises an isolated or recombinantly produced CARD1 protein, and may further comprise at least one of: a detectably labeled ssDNA, a detectably labeled ssRNA, a Cas13 and/or Cas10 protein, a buffer suitable for function of the CARD1 protein, or instructions for using the CARD120 protein in an assay. The buffer may also comprise Manganese (Mn) and/or Cyclic Tetra- Adenylate (cA4). [0009] In another embodiment, the disclosure provides an in vitro method comprising degrading ssDNA and/or ssRNA with a CARD1 protein, wherein the method may further comprise use of a Cas10 protein. An in vitro composition, which may be a cell free 25 composition, comprising a CARD1 protein and a ssDNA or a ssRNA template is also provided. The composition may also comprise cA ₄ and/or Mn. In embodiments, Cas10 protein, a Cas13 protein, or a combination thereof, may also be present in the described composition. BRIEF DESCRIPTION OF THE FIGURES 30 [0010] For a fuller understanding of the nature and objects of the disclosure, reference should be made to the following detailed description taken in conjunction with the accompanying figures. [0011] Figure 1. CARD1 is a cA4-activated single-stranded DNase. (a) CARD1 digestion of ΦX174 ssDNA in the presence of cA4, cA6 and/or MnCl2, visualized by agarose gel electrophoresis. (b) CARD1 digestion of M13 ssDNA like specified, visualized by agarose gel electrophoresis. (c) Cleavage preference of CARD1, represented as a WebLogo, 5 determined after next generation sequencing of ΦX174 degradation products. Five nucleotide positions upstream (-5 to -1) and downstream (1 to 5) of the detected cleavage sites are shown. (d) like (b), but with ΦX174 supercoiled dsDNA, (e) like (b) but with ΦX174 linearized dsDNA. [0012] Figure 2. Patterns of CARD1 cleavage. (a) Overview of CARD1 cleavage 10 sites across the ΦX174 genome, based on the 5’ end mapping of DNA degradation products obtained from the 2 hours timepoint in Fig.1a, per 1 million reads. There appears to be preferential cleavage sites that may reflect lack of CARD1 access to secondary structures formed within the ssDNA molecule.26.7% of cuts occur at the 25 most frequent positions. (b) Same as (a) but after the analysis of M13 ssDNA degradation products.31.1% of cuts 15 occur at the 25 most frequent positions. (c) Fragment size distribution of the ΦX174 degradation products from the 2 hours timepoint in Figure 1a. The average fragment length (163.6 nucleotides) is marked by the dotted line. (d) Same as (c) but analyzing M13 degradation products. The average fragment length (150.1 nucleotides) is marked by the dotted line. (e) Cleavage preference of CARD1, represented as a WebLogo, determined after 20 NGS of M13 degradation products. Five nucleotide positions upstream (-5 to -1) and downstream (1 to 5) of the detected cleavage sites are shown. [0013] Figure 3. CARD1 is able to degrade ssRNA in vitro. (a) CARD1 is incubated with a 60 nucleotide ssRNA oligo fluorescently labelled with Cy3 for 15 minutes. The RNase activity is activated by cA4, but not cA6, requires Mn2+, and the activity is abrogated upon 25 mutation of the CARD1 catalytic site (dCARD1). (b) Incubating CARD1 with either a ssRNA ladder, or a dsRNA ladder, for 15 minutes, shows that CARD1 is specific for ssRNA. (c) CARD1 or RNase I was incubated with short RNA oligos with either 15 adenines, cytosines, or uracils, with a 5’ fluorophore and a 3’ quencher. The increase in fluorescent signal results from successful linker cleavage, demonstrating that CARD1 can cut next to all 30 three bases. Guanines could not be tested since multiple guanines form structures resistant to digestion. [0014] Figure 4. CARD1 activation leads to a growth arrest of the cell and the destruction of target plasmids. (a) Schematic of the S. epidermidis type III-A locus showing the replacement of csm6 by CARD1 and the different mutations investigated in this study. (b) RT-qPCR of genes whose transcription is activated by the SOS response, using RNA from cells expressing Cas10HD in which CARD1 or dCARD1 was activated by the type III-A immune response against a target plasmid. Mean of three biological replicates ± s.e.m are reported. p values were obtained with two-sided t-test. (c) Growth of staphylococci carrying 5 different pCRISPR variants, measured as OD600 after the addition of aTc to induce the production of cA4 by the Cas10 complex. Mean of three biological triplicates ± s.e.m. are reported. (d) Enumeration of colony-forming units (cfu) from staphylococcal cultures carrying different pCRISPR variants where cA4 production was activated by the addition of aTc. At the indicated times after induction aliquots were removed and plated on solid media 10 with or without aTc to count the remaining viable cells. Mean of three biological replicates ± s.e.m are reported. (e-f) pTarget plasmid curing assay, where plasmid DNA was extracted from cells containing pTarget and different pCRISPR plasmids after induction with aTc. Plasmids were linearized and visualized by gel electrophoresis. Gel images are representative of three independent experiments. 15 [0015] Figure 5. CARD1-induced cell toxicity. (a) Growth of staphylococci carrying different pCRISPR(+CARD1) taken from six escaper colonies obtained in Figure 3c, measured as OD600 after the addition of aTc to induce the production of cA4 by the Cas10 complex. Mean of three biological triplicates ± s.e.m. are reported. (b) Agarose gel electrophoresis of plasmid DNA was extracted from escaper cells grown in (a), showing 20 deletions in pTarget or pCRISPR. The deletions were confirmed by Sanger sequencing. (c) Growth of staphylococci carrying different pCRISPR variants expressing Cas10HD, measured as OD600 after the addition of aTc to induce the production of cA4 by the Cas10HD complex. Mean of three biological triplicates ± s.e.m. are reported. (d) Enumeration of colony-forming units (cfu) within staphylococcal cultures carrying different 25 pCRISPR variants expressing Cas10HD where cA4 production was activated by the addition of aTc. At the indicated times after induction aliquots were removed and plated on solid media with or without aTc to count the remaining viable cells. Mean of three biological replicates ± s.e.m are reported. (e) Growth of staphylococci carrying different pCRISPR(+CARD1, Cas10HD) taken from five escaper colonies obtained in (c), measured 30 as OD600 after the addition of aTc to induce the production of cA4 by the Cas10HD complex. Mean of three biological triplicates ± s.e.m. are reported. (f) Agarose gel electrophoresis of plasmid DNA was extracted from escaper cells grown in (e), showing deletions in pTarget. The deletions were confirmed by Sanger sequencing. [0016] Figure 6. CARD1 protects staphylococci from phage infection. (a) Growth of staphylococci carrying different pCRISPR variants programmed to target the ORF9 transcript of Φ12γ3, measured as OD600 at different times after infection at a multiplicity of infection (MOI) between 2 and 8. Mean of three biological triplicates ± s.e.m. are reported. (b) Same 5 as in (a) but targeting the ORF27 transcript at an MOI ~8. Mean of three biological triplicates f± s.e.m. are reported. (c) Same as in (b) but following cultures carrying different mutations in the cA4 binding pocket of CARD1, at an MOI ~15. (d) Enumeration of plaque-forming units (pfu) within staphylococcal cultures carrying different pCRISPR variants after infection with Φ12γ3. At the indicated times after infection aliquots were removed and plated on top 10 agar media seeded with a susceptible strain. Mean of three biological replicates ± s.e.m are reported. [0017] Figure 7. CARD1-mediated anti-phage immunity. (a) Schematic of the genomes of the staphylococcal phages used in this study, Φ12γ3 and ΦNM1γ6, showing the location of the transcripts targeted by the type III-A CRISPR-Cas system. Grey arrows 15 indicate promoters. (b) Growth of staphylococci carrying different pCRISPR variants with mutations in the catalytic pocket of CARD1, programmed to target the ORF27 transcript of Φ12γ3, measured as OD600 at different times after infection, at an MOI ~15. Mean of three biological triplicates ± s.e.m. are reported. (c) Growth of staphylococci carrying different pCRISPR variants programmed to target the gp14 transcript of ΦNM1γ6, measured as 20 OD600 at different times after infection, at an MOI ~15. Mean of three biological triplicates ± s.e.m. are reported. (d) Same as in (c) but targeting the gp43 transcript, at an MOI ~2. Mean of three biological triplicates ± s.e.m. are reported. DETAILED DESCRIPTION OF THE DISCLOSURE [0018] Although claimed subject matter will be described in terms of certain 25 embodiments/examples, other embodiments/examples, including embodiments/examples that do not provide all of the benefits and features set forth herein, are also within the scope of this disclosure. Various structural, logical, and process step changes may be made without departing from the scope of the disclosure. [0019] Every numerical range given throughout this specification includes its upper 30 and lower values, as well as every narrower numerical range that falls within it, as if such narrower numerical ranges were all expressly written herein. All ranges provided herein include all values that fall within the ranges to the tenth decimal place, unless indicated otherwise. [0020] Throughout this application, the singular form encompasses the plural and vice versa. All sections of this application, including any supplementary sections or figures, are fully a part of this application. [0021] All of the nucleotide and amino acid sequences associated with the GenBank 5 or other database accession numbers are incorporated herein by reference as they exist on the filing date of this application or patent. The disclosure includes amino acid sequences that are from 80%-99% similar to those amino acid sequences described herein, and includes amino acid sequences that include insertions and deletions. The disclosure also includes all polynucleotide sequences of the CARD1 nuclease (previously referred to as CARD1 10 nuclease) and all sequences complementary to those sequences. [0022] Examples of nucleotide and amino acid sequences encoding the CARD1 nuclease are as follows. [0023] CARD1 (gene Tresu_2185) nucleotides sequence (codon optimized): ATGAAAGAGACTATTTTGGTTAACTTGGTTAGTGAGCAAACAATTCCTAATGTAC 15 AATTTATCAAGTGGTACTTTAATAAAAAGCAAACACCAATGAAGATATTGTTAGT GAGTACTAAGGAGATGGAACAGAAAGAAAAATCATTGTTCATCAAGAACGCTTT ACACTTTTCAGATTCATTCGTGGAGTGGGAGACAATTCACACTGACGGAAACGA CATATCAAAGACAGAAAATATTTTGACAGACTATTTCAGAGATAATGAATACAA AAATATAATAGTTAATATTACGGGCGGTACAAAGATCATGTCTTTAGCAGCATTT 20 GATTTCTTTAATAACAAACCTAACACAGAGATATTCTACCAACCTATAGGTAAAG AATTGCAGGAGTTATACCCAAATAAGCAAAAGTACGACATGTTCGAAGTGTTAT CTTTAAAGGAATATTTGGATGCGCATGGTATTAGTTATAAATACGATAACGAGTG TGTCAAAGACTGGAACTATAATAAGACGGTATATGATTTGTGCGTTGCGGACAAT CGTGAATTAATAAAGGGCATGATCGCTTTGCAGAACAACTCATATTTCAACAATG 25 TATATAAGCGAAAAGATTTTTTAGACTTTACTCAGATTGAGGAGGAGAAGTTCAT TGCTATCAATCATCCAGCGGCTACAAAGGAGAATATGATTAAGATCTTACAAAT ATTTGGATTTGATGTTAGTCGAATTGAGCACAAGCACATCCGTTATATAACTGGC GGTTGGTTCGAGGAGTATGTATATCAGAAAATTTGCAATGAATACCATAACGTCG ATGAAAAGAACGTAGCGTTAAACGTTACAATTCAGAAGGGAAATGACAAAAAC 30 GAGTTGGATGTTATCTACTTGGACAAAGACAATAAGTTACACGTGATAGAATGTA AGAGTTTCGTCGATGGAAACGAAGGCAACAGAGTATTGAACGACGCGTTATATA AGTTACAAGCGATCATCAAGAGTAAGTTCGGATTATATGTAAAGCAACACTTGTA TACGAAAAGTATTATAGAAAAAGAAACTCCATTGAACAGAGCTAAAGAGTTTGG AATTGACATTAAAGACGGTACACAATTATGA (SEQ ID NO:2) 35 (italics indicates stop codon) [0024] CARD1 (gene Tresu_2185) amino acid sequence: MKETILVNLVSEQTIPNVQFIKWYFNKKQTPMKILLVSTKEMEQKEKSLFIKNALHFS DSFVEWETIHTDGNDISKTENILTDYFRDNEYKNIIVNITGGTKIMSLAAFDFFNNKPN 40 TEIFYQPIGKELQELYPNKQKYDMFEVLSLKEYLDAHGISYKYDNECVKDWNYNKT VYDLCVADNRELIKGMIALQNNSYFNNVYKRKDFLDFTQIEEEKFIAINHPAATKEN MIKILQIFGFDVSRIEHKHIRYITGGWFEEYVYQKICNEYHNVDEKNVALNVTIQKGN DKNELDVIYLDKDNKLHVIECKSFVDGNEGNRVLNDALYKLQAIIKSKFGLYVKQHL YTKSIIEKETPLNRAKEFGIDIKDGTQL (SEQ ID NO:1) [0025] Functional fragments of CARD1/SEQ ID NO:1 are included in the disclosure. 5 [0026] In an aspect, this disclosure provides compositions comprising the CARD1 nuclease. In embodiments, an in vitro method is provided, wherein an isolated or recombinantly produced CARD1 is used to degrade single stranded DNA, for any purpose. The same applies to Cas10. In embodiments, the CARD1 protein is used in a complex with a Cas10 protein. 10 [0027] In a non-limiting embodiment, the CARD1 nuclease (which may include any suitable Cas10 protein) is used in an adaptation of a nucleic acid diagnostic assay known in the art as SHERLOCK (for Specific High Sensitivity Enzymatic Reporter UnLOCKing) assay, described in PCT publication WO2017219027, published December 21, 2017, and SHERLOCK: nucleic acid detection with CRISPR nucleases, Kellner MJ, Koob JG, 15 Gootenberg JS, Abudayyeh OO, and Zhang F. Nature Protocols .2019, Oct;14(10):2986- 3012. doi: 10.1038/s41596-019-0210-2. (NATURE PROTOCOLS, VOL 14, OCTOBER 2019, 2986–3), the disclosures of each of which are incorporated herein by reference. [0028] The SHERLOCK assay is used to detect and/or quantify a target RNA or using a CRISPR Cas related approach. In the known SHERLOCK assay, a detectably labeled 20 non-target RNA is used to provide a means of diagnostic readout using Cas13 in guide RNA programmed recognition of, for example, a polynucleotide target. Embodiments of the disclosure include recognition of DNA and RNA polynucleotides. Using RNA and Cas13 as an example, if the RNA target (e.g., an RNA that signifies the presence of a virus or other cell that expresses the target RNA), Cas13 complexes with the target RNA in the sample, and the 25 non-specific Cas13 RNA nuclease activity of Cas13 results in enzymatic degradation of a detectably labeled RNA (e.g., a reporter RNA) that, for example, comprises a detectable label and a quencher. For instance, the detectably labeled RNA may comprise a fluorophore and a quencher moiety conjugated to the reporter RNA in sufficient proximity to one another such that the detectable signal is quenched when the RNA is intact. Accordingly, when and if the 30 RNA reporter is cleaved by the non-specific nuclease activity of the Cas13, which is considered to only become active once the Cas13 has engaged a target in a guide-RNA directed manner, the detectable label is liberated from the intact reporter RNA, and a signal from it can be detected using any suitable approach. The present disclosure provides for use of CARD1 in the conventional SHERLOCK assay, and also for substitution of the reporter RNA in an adaptation of the SHERLOCK assay using a similarly labeled reporter polynucleotide, but wherein the reporter polynucleotide is a single stranded (ss) DNA reporter. Thus, the CARD1 nuclease will degrade the ss reporter and produce a detectable signal in the same manner as in the SHERLOCK assay, whether or not the ss polynucleotide 5 is RNA or DNA. The function of CARD1 is facilitated by its interaction with Cas10. In embodiments, the CARD1 or functional fragment of it is provided together with Cas10 or a functional fragment of Cas10. In embodiments, CARD1, and/or a combination of a CARD1 and Cas10 is used. In embodiments, a combination of CARD1 and Cas10 can be substituted for Cas13 in the known SHERLOCK assay. 10 [0029] A representative Cas10 amino acid sequence is as follows: MNKKNILMYGSLLHDIGKIIYRSGDHTFSRGTHSKLGHQFLSQFSEFKDNEVLDNVA YHHYKELAKANLDNDNTAYITYIADNIASGIDRRDIIEEGDEEYEKQLFNFDKYTPLY SVFNIVNSEKLKQTNGKFKFSNESNIEYPKTENIQYSSGNYTTLMKDMSHDLEHKLSI KEGTFPSLLQWTESLWQYVPSSTNKNQLIDISLYDHSRITCAIASCIFDYLNENNIHNY 15 KDELFSKYENTKSFYQKEAFLLLSMDMSGIQDFIYNISGSKALKSLRSRSFYLELMLE VIVDQLLERLELARANLLYTGGGHAYLLVSNTDKVKKKITQFNNELKKWFMSEFTT DLSLSMAFEKCSGDDLMNTSGNYRTIWRNVSSKLSDIKAHKYSAEDILKLNHFHSYG DRECKECLRSDIDINDDGLCSICEGIINISNDLRDKSFFVLSETGKLKMPFNKFISVIDY EEAEMLVQNNNQVRIYSKNKPYIGIGISTNLWMCDYDYASQNQDMREKGIGSYVDR 20 EEGVKRLGVVRADIDNLGATFISGIPEKYNSISRTATLSRQLSLFFKYELNHLLENYQI TAIYSGGDDLFLIGAWDDIIEASIYINDKFKEFTLDKLTLSAGVGMFSGKYPVSKMAF ETGRLEEAAKTGEKNQISLWLQEKVYNWDEFKKNILEEKLLVLQQGFSQTDEHGKA FIYKMLALLRNNEAINIARLAYLLARSKMNEDFTSKIFNWAQNDKDKNQLITALEYY IYQIREAD (SEQ ID NO:3) 25 [0030] A representative Cas10 nucleotide coding sequence is as follows: ATGAATAAAAAAAATATATTAATGTATGGCTCTTTATTACATGATATAGGGAAAA TTATATATCGAAGTGGTGATCATACATTTTCAAGAGGTACGCATTCAAAATTAGG TCATCAATTTTTGTCCCAATTTTCAGAATTTAAAGACAACGAAGTGCTTGATAAC GTTGCTTATCATCATTACAAAGAACTCGCAAAAGCTAATTTAGATAATGATAATA 30 CAGCTTATATTACCTATATTGCGGATAATATTGCGAGTGGTATTGATAGAAGAGA TATTATAGAAGAAGGCGATGAAGAATACGAAAAACAACTATTTAATTTTGATAA ATATACACCGCTATATAGTGTGTTTAATATTGTGAATTCTGAAAAATTGAAACAA ACAAACGGGAAGTTTAAATTTTCTAATGAAAGTAATATTGAATATCCTAAAACTG AAAACATTCAATATTCAAGTGGAAATTATACAACATTAATGAAAGATATGAGTC ATGATTTAGAGCACAAATTAAGTATTAAAGAAGGTACATTTCCTTCATTATTACA ATGGACGGAAAGTCTATGGCAATATGTACCTAGTTCGACAAATAAAAACCAATT AATTGATATTTCTCTTTATGATCATAGTCGTATTACATGTGCCATCGCCAGTTGTA TATTTGATTATTTAAATGAAAATAACATACATAATTACAAAGATGAATTGTTCTC 5 AAAGTATGAAAATACCAAATCATTTTATCAAAAAGAAGCTTTTTTACTACTTAGT ATGGATATGAGTGGTATTCAAGATTTTATTTACAATATAAGCGGTTCTAAAGCAT TAAAGAGTCTAAGATCTCGTAGTTTTTATTTAGAACTCATGCTTGAAGTAATCGTT GATCAATTATTAGAAAGATTAGAATTAGCACGAGCAAATCTTTTGTATACAGGTG GTGGCCATGCTTATTTATTAGTGTCTAATACTGATAAAGTGAAGAAAAAAATAAC 10 TCAATTTAATAATGAATTAAAAAAATGGTTTATGTCAGAATTTACTACAGATCTT TCATTATCAATGGCTTTTGAAAAATGTAGTGGCGATGATTTAATGAATACAAGTG GTAATTATAGAACTATTTGGCGTAATGTTAGCAGCAAACTTTCTGATATTAAAGC GCATAAATATTCCGCGGAAGATATATTAAAATTAAATCATTTTCATTCGTATGGA GATCGGGAATGTAAAGAATGTTTAAGAAGTGACATAGATATTAATGATGATGGA 15 CTATGTAGTATATGTGAAGGAATTATTAATATATCAAATGATTTAAGAGATAAAT CATTCTTTGTACTGTCAGAAACTGGAAAATTAAAAATGCCATTCAATAAATTTAT ATCGGTTATTGATTATGAAGAGGCAGAAATGTTAGTACAAAATAATAATCAAGTT CGTATTTACAGTAAAAATAAACCATATATAGGCATAGGAATATCAACAAATTTAT GGATGTGTGATTACGACTATGCTAGTCAAAATCAAGATATGAGAGAAAAAGGTA 20 TTGGAAGTTATGTAGATAGAGAAGAAGGGGTTAAGCGTTTAGGCGTGGTACGTG CCGATATAGATAATCTCGGTGCTACATTTATATCTGGAATTCCAGAAAAATATAA TTCAATTTCAAGAACAGCTACATTGTCTCGTCAATTATCATTATTTTTTAAATACG AATTAAATCATTTATTAGAAAATTATCAAATTACTGCTATATATTCAGGCGGTGA CGATTTATTTTTAATCGGTGCATGGGATGACATTATAGAAGCAAGCATTTATATA 25 AATGACAAATTTAAAGAGTTTACTCTTGATAAACTAACATTGTCTGCCGGGGTTG GAATGTTTAGTGGTAAGTACCCAGTTTCTAAAATGGCTTTTGAGACAGGACGACT TGAAGAAGCGGCTAAGACTGGTGAAAAAAATCAGATATCTCTTTGGTTACAAGA AAAAGTATATAACTGGGATGAGTTTAAAAAGAATATCTTAGAAGAAAAACTTCT CGTTTTACAACAGGGGTTTTCTCAAACAGATGAACACGGGAAAGCCTTCATTTAT 30 AAAATGCTCGCTTTACTGAGAAATAATGAAGCTATTAATATTGCTCGTTTAGCTT ACTTATTAGCAAGAAGCAAGATGAATGAGGATTTTACGTCTAAAATTTTTAATTG GGCTCAAAACGACAAAGATAAAAATCAATTAATTACAGCGTTAGAGTATTATAT TTATCAAATAAGGGAGGCTGATTGA (SEQ ID NO:4) (italics indicates stop codon) [0031] As described further herein, the CARD1 nuclease requires adenylate, which in one embodiment may be an oligoadenylate such as cA ₄ to exhibit its ssDNA nuclease activity. In the adapted SHERLOCK assay, the degradation of polyadenylated RNA can provide a source of a suitable adenylate, such as linear cA4. Thus, if a sample that is tested in 5 the adapted SHERLOCK assay of this disclosure contains a target RNA to which Cas13 (or alternatively a Cas10/CARD1 complex) binds in a gRNA directed manner, the non-specific RNA nuclease activity of Cas13, triggered by binding of the Cas13 to the target RNA, will provide a source of adenylate to allow degradation of the labeled ssDNA, yielding a detectable signal. Accordingly, the present disclosure provides compositions, methods, and 10 kits for use in an adapted diagnostic assay. In embodiments, the kits, and the disclosure more generally, provides an isolated CARD1 enzyme, and may further comprise any suitable reagents for use in a diagnostic assay. In embodiments, the CARD1 enzyme may be provided with a detectably labeled ssDNA for use as a CARD1 substrate in the diagnostic assay. [0032] In another aspect, the disclosure provides for use of a ssRNA substrate in a 15 described assay, but wherein the assay is supplemented with manganese (Mn). Thus, the disclosure in various embodiments takes advantage of CARD1 by cA ₄ activation, which allows the cleavage of ssDNA, ssRNA and both ssDNA and ssRNA, in a Mn cation- dependent manner. [0033] In embodiments, a kit of this disclosure provides a recombinant or isolated 20 CARD1 protein or functional fragment thereof, and may further comprise a recombinant or isolated Cas10 protein. In embodiments, the disclosure provide a fusion protein comprising amino acids from Cas10 and from CARD1. The kit may further comprise a detectably labeled ssDNA. The kit may comprise a suitable buffer, such as a buffer that contains Mn cations. [0034] The disclosure further comprises the addition of an anti-CRISPR agent to, for 25 example, enhance or prolong the time during which Cas13 is bound to an target RNA in a guide directed manner. In an embodiment, a suitable anti-CRISPR agent comprises a protein known as AcrVIA1, which has the following amino acid sequence: MIYYIKDLKVKGKIFENLMNKEAVEGLITFLKKAEFEIYSRENYSKYNKWFEMWKSP 30 TSSLVFWKNYSFRCHLLFVIEKDGECLGIPASVFESVLQIYLADPFAPDTKELFVEVCN LYECLADVTVVEHFEAEESAWHKLTHNETEVSKRVYSKDDDELLKYIPEFLDTIATN KKSQKYNQIQGKIQEINKEIATLYESSEDYIFTEYVSNLYRESAKLEQHSKQILKEELN. (SEQ ID NO:5) [0035] AcrVIA1 is known in the art from, for example, Meeske et al., Science, 2020 May 28;eabb6151. doi: 10.1126/science.abb615, the disclosure of which is incorporated herein by reference. [0036] The disclosure includes adding CARD1 and Cas10 to a biological sample 5 obtained from an individual that is either tested directly, or is processed before testing, such as to separate RNA from the sample. In embodiments, the CARD1 and the ss polynucleotide is added to a sample with a suitable Cas enzyme (e.g., Cas13 or Cas10) and a detectably labeled ss polynucleotide reporter, or is added a short time (e.g., within 1 second to 60 minutes) after the Cas enzyme in the sample has associated with the target ss polynucleotide 10 reporter, if the target ss polynucleotide (e.g., RNA, in the detection of a ss virus) is present, in the patient sample. Compositions comprising a Cas enzyme, a guide RNA, a detectably labeled reporter ssDNA, and a CARD1 nuclease, and Cas10 proteins, as described herein, are encompassed by the disclosure. In embodiments, any detectable label can be used with the reporter ss polynucleotide, non-limiting examples of which include fluorophores, metals or 15 chemiluminescent moieties, fluorescent particles, quantum dots, etc., provided the signal from the detectable label can be quenched, or its intensity shifted to a different wavelength in, for example, a fluorescence resonance energy transfer (FRET) process by a suitable quencher moiety conjugated to the reporter RNA. [0037] In an aspect, this disclosure provides methods for using the described 20 compositions for identifying the presence of RNA or DNA from any source, including but not limited to a bacteria or a virus, in a sample. In embodiments, the presence, absence, and or amount of RNA is determined. In embodiments, viral RNA is determined. In embodiments, the presence, absence, and/or amount of any polyadenylated RNA is determined. Thus, in embodiments, the present disclosure provides diagnostic methods, and 25 kits for use in the diagnostic methods. [0038] In a non-limiting embodiment, the disclosure provides for use of the CARD1 and Cas10 proteins for detecting RNA viruses, including but not limited to the coronavirus referred to in the art the time of this disclosure as SARS-CoV-2, which causes COVID-19. In an embodiment, the assay is performed using a lateral flow device. In embodiments, the 30 testing is performed by testing for the presence or absence of RNA encoded by the viral S gene and/or the Orf1ab gene. In embodiments, the Cas13 used in this approach or related approaches is LwaCas13a. In embodiments, liberated label can be detected in the lateral flow device at a predetermined position. Suitable controls may be included, such as a pre- determined amount of synthetically produced viral target RNA. [0039] In alternative embodiments, the disclosure provides for determining the presence, absence and/or amount of DNA in a sample. In a non-limiting embodiment, the method is performed by transcription from a DNA template, wherein detection of the transcribed RNA acts as a surrogate for direct detection of DNA, although DNA can also be 5 assayed as described herein. [0040] In embodiments, a biological sample analyzed according to this disclosure comprises any suitable biological sample, including but not limited to blood, urine, mucosa, mucosal secretions, saliva, and lacrimal secretions. In embodiments, a biological sample is tested directly. In embodiments, the biological sample is subject to a processing step before 10 testing, a non-limiting example of which comprises RNA extraction. In embodiments, a diagnostic assay of this disclosure may exhibit increased sensitivity to the presence or absence of a particular RNA. In embodiments, the CARD1 can be used for ribosome profiling by using CARD1 to digest segments of mRNA that are not protected from digestion by ribosomes. 15 [0041] While sequences or reference numbers have been provided for CARD1 and Cas10 proteins, it will be appreciated that proteins from other similar CRISPR/Cas systems also may be used. CARD1 and Cas10 proteins from other prokaryotic sources and nucleotides sequences encoding such proteins, that have at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity with the sequences/references 20 provided herein may be used. This disclosure encompasses variants of the CARD1 and Cas10 proteins, wherein a variant of the protein is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the listed amino acid sequence. In this regard, as is known in the art, Cas10 is a complex, which is referred to as Cas10-Csm. Cas10-Csm contains a guide RNA that anneals a complementary target RNA and starts producing polyA 25 and/or cyclic oligoA (cOA). This diffuses into the cytoplasm, where is bound by CARD1 to activate it. [0042] In an aspect, the disclosure provides nucleic acid sequences encoding the full CARD1 nuclease (which may include Csm) and Cas10 protein and/or functional fragments or variants thereof as described herein. The nucleic acid sequence can encode an RNA molecule 30 corresponding to the amino acid sequence of the CARD1 protein described above. In embodiments, the sequence which encodes a CARD1 or Cas10 protein or a variants thereof, as described herein may be at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the listed nucleic acid sequences. This also disclosure provides expression vectors comprising the sequences encoding CARD1 proteins as described herein. Methods for cloning expression vectors (CARD1 and Cas10 protein constructs), and methods for expressing and purifying recombinant bacterial proteins of the invention are well known in the art. For example, expression vectors of the present disclosure may be expressed in suitable cells such as, mammalian cells (e.g., murine and/or human cells), using retroviral, 5 adenoviral, or lentiviral vectors. For generating CARD1 proteins, an expression construct encoding a bacterial protein(s) as described or referenced in this disclosure may be introduced into the cell by transfection or other appropriate method known in the art. Appropriate host cells include, but are not limited to, bacterial, yeast, insect, and mammalian cells. The host cells may then be lysed to extract the expressed bacterial protein(s) for 10 subsequent purification and use, such as in a therapeutic composition. [0043] The expression vector is not particularly limiting other than by a requirement for the CARD1 and/or Cas10 protein expression to be driven from a suitable promoter. Many suitable expression vectors and systems are commercially available. Non-limiting examples of vectors include plasmids. The expression vectors may be configured to produce CARD1 15 proteins such that they include suitable components that facilitate purification, such as HIS or FLAG tag, or improve solubility or secretion or other functions. In an embodiment, a CARD1 protein is provided with a nuclear localization signal. [0044] A nucleic acid encoding a CARD1 protein construct may also be operably linked to a nucleotide sequence encoding a selectable marker. A selectable marker may be 20 used to efficiently select and identify cells that have integrated the exogenous nucleic acids. Selectable markers give the cell receiving the exogenous nucleic acid a selection advantage, such as resistance towards a certain toxin or antibiotic. Suitable examples of antibiotic resistance markers include those coding for proteins that impart resistance to kanamycin, streptomycin, neomycin, gentamycin (G418), ampicillin, tetracycline, chloramphenicol, 25 puromycin, hygromycin, zeocin, and blasticidin. [0045] The present disclosure also provides pharmaceutical compositions comprising the CARD1 proteins as described herein. The compositions may comprise pharmaceutically acceptable diluents, preservatives, solubilizers, emulsifiers, and/or carriers. For example, pharmaceutical compositions may comprise various buffers (e.g., Tris-HCl, acetate, 30 phosphate), additives such as detergents and solubilizing agents (e.g., Tween 80, Polysorbate 80), anti-oxidants (e.g., ascorbic acid, sodium metabisulfite), preservatives (e.g., Thimersol, benzyl alcohol) and bulking substances (e.g., lactose, mannitol). Such pharmaceutical composition components are known in the art See, e.g., Remington: The Science and Practice of Pharmacy (2005) 21st Edition, Philadelphia, PA. Lippincott Williams & Wilkins. The materials may be incorporated into particulate preparations of polymeric compounds such as polylactic acid, polyglycolic acid, etc. or into liposomes. Hylauronic acid may also be used. Preparations for parenteral administration may include sterile aqueous or non-aqueous solutions, suspensions, or emulsions. Examples of non-aqueous solvents or vehicles are 5 propylene glycol, polyethylene glycol, vegetable oils, such as olive oil and corn oil, gelatin, and injectable organic esters such as ethyl oleate. Such dosage forms may also contain other adjuvants, preserving, wetting, emulsifying, and dispersing agents. [0046] In embodiments, a composition comprising a CARD1 protein described herein can be used as a treatment for a disease or condition, such as a disease or condition that is 10 associated with deleterious sDNA. The term “treatment” as used herein refers to alleviation of one or more symptoms or features associated with the presence of the particular condition or suspected condition being treated. Treatment does not necessarily mean complete cure or remission, nor does it preclude recurrence or relapses. Treatment can be effected over a short term, over a medium term, or can be a long-term treatment, such as, within the context of a 15 maintenance therapy. Treatment can be continuous or intermittent. In embodiments, a CARD1 protein is used to inhibit phage infection and/or replication. Such an approach may be used, for example, in the food or beverage industries to combat deleterious phage infections where bacteria are used in the preparation of food or beverages, and/or wherein the bacteria are a component of a food or beverage, including but not necessarily limited to dairy 20 products such as yogurts, and fermented foods and beverages. [0047] The term “therapeutically effective amount” as used herein refers to an amount of an agent sufficient to achieve, in a single or multiple doses, the intended purpose of treatment. The exact amount desired or required will vary depending on the particular compound or composition used, its mode of administration, patient specifics and the like. 25 Appropriate effective amount can be determined by one of ordinary skill in the art informed by the instant disclosure using only routine experimentation. [0048] The present compositions may be administered to an individual in need thereof using any suitable route including parenteral, subcutaneous, intraperitoneal, intrapulmonary, and intranasal, and, if desired for local treatment, such as, intratumoral 30 administration. Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, intradermal, or subcutaneous administration. [0049] The following examples are meant to illustrate, and are not intended to be limiting. EXAMPLE 1 [0050] To investigate this, we characterized Tresu_2185, found in the type III-A CRISPR-cas locus of the mesophilic gram-negative spirochete Treponema succinifaciens (18). Tresu_2185 contains 373 amino acids (43.9 kDa), is a member of the Pfam family 5 pfam09002 (domain of unknown function 1887, DUF1887), and is composed of an N- terminal CARF domain and a C-terminal restriction endonuclease-like (REase) domain, typically found in type II restriction endonucleases or Holliday junction resolvases (20), where the two acidic residues coordinate a divalent cation important for catalysis. To evaluate the biochemical activity of Tresu_2185, we expressed and purified it from Escherichia coli, 10 and incubated with different nucleic acids and cAs. We found that the addition of cA ₄ , but not cA6, resulted in the degradation of circular ΦX174 and M13 ssDNA (Figs.1a, b), but cA4 did not promote cleavage of supercoiled or linearized ΦX174 dsDNA (Figs.1d, e). Degradation required the addition of Mn cation (Fig.1a) and resulted in a smear of products, suggesting that ssDNA cleavage is not specific. These results demonstrate that Tresu_2185 is a cA4- 15 activated, non-specific ssDNA nuclease. Therefore, we renamed it cA-activated DNase and RNase 1, or CARD1. Next generation sequencing of the ΦX174 and M13 ssDNA degradation products showed cleavage across both genomes (Figs.2a, b), with an average product size of ~150 nucleotides (Figs.2c, d), preferentially upstream of T(A/G) sites (Figs. 1c, 2e). 20 [0051] Further biochemical experiments established that in addition to being a DNase, CARD1 is able to degrade RNA. Incubating CARD1 with a 60 nucleotide RNA oligo demonstrated that the RNA is degraded in the presence of cA4, but not cA6 (Fig.3a). Single- stranded RNA, but not double-stranded RNA, was degraded (Fig.3b). To determine the nucleotide sequence preference of CARD1, CARD1 was incubated with RNA oligos with 25 either 15 adenines, uracils, or cytosines, with a 5’ fluorophore and a 3’ quencher. CARD1 was able to efficiently degrade RNAs consisting of all three bases, showing broad sequence tolerance for CARD1 (Fig.3c). We were unable to test guanine because guanines forming G quadruplexes which are resistant to cleavage. [0052] Next, we investigated the function of CARD1 during the type III-A CRISPR- 30 Cas immune response. We determined whether or not the non-specific ssDNA degradation could introduce chromosomal lesions, for example on R-loops generated during transcription or ssDNA intermediates that result from DNA replication. If this is correct, the activation of the type III-A immunity would (i) induce the SOS response to DNA damage (21) and (ii) result in toxicity for the host cell. To test these predictions, we constructed pCRISPR(+CARD1) by cloning into the staphylococcal plasmid pC194 (22) the Staphylococcus epidermidis RP62 type III-A locus (2) carrying the CARD1 open reading frame instead of that of the cA-activated accessory protein of this system, Csm6 (Fig.4a). As 5 a control we introduced mutations that inactivate CARD1 (E308A, K310A) in pCRISPR(dCARD1), that inactivate Csm6 in pCRISPR(-CARD1) or that lack a targeting spacer in pCRISPR( ^spc). Each of these plasmids were transformed into Staphylococcus aureus RN4220 (23) cells containing pTarget, a second plasmid producing a target transcript, i.e. complementary to the crRNA expressed by the pCRISPR plasmids, that is under the 10 control of an anhydrotetracycline(aTc)-inducible promoter (14). We then added the inducer to trigger the type III-A response and the production of cA by the Palm domain of Cas10 in the different cultures. To examine the SOS response in the presence of activated CARD1, we used RT-qPCR to measure the levels of recA, lexA, uvrA and umuC transcripts (normalized against the rho transcript), which are derepressed by the SOS pathway (24). We observed a15 significant increase for the expression of all four genes in +CARD1 cultures, compared to d- CARD1 (Fig.4b). To determine if CARD1 activation is toxic for the host cell, we monitored the growth of the different cultures after the addition of aTc, in the absence of antibiotic selection of pTarget (Fig.4c). dCARD1 cultures continued exponential growth, similarly to ^spc cells that cannot trigger the type III-A CRISPR-Cas immune response. In contrast, 20 +CARD1 cultures displayed a severe growth defect after the induction of target transcription, which was completely eliminated by the introduction of mutations in the Palm domain of Cas10 (D586A, D587A; Cas10 ^Palm ) that prevent the production of cA (Fig.4c). We observed an increase in OD600 at around 10 hours after addition of aTc, which was a result of the propagation of “escaper” cells carrying re-arranged, non-functional pCRISPR or pTarget 25 plasmids within +CARD1 cultures (Figs.5a, b). The lack of growth induced by CARD1 could be due to either the arrest or the death of individual cells within the culture. To distinguish between these possibilities, we enumerated viable staphylococci after CARD1 induction, plating culture aliquots taken at different times after addition of aTc on solid media lacking the inducer (Fig.4d). This procedure removes the inducer and allows the formation of 30 colonies from cells that were arrested in the liquid culture, but not from those that died after activation of CARD1. Over a course of three hours of target transcription and CARD1 activation, we observed that while dCARD1 cultures displayed a steady increase in colony formation, +CARD1 cultures showed an initial decrease in colony counts of an order of magnitude that stabilized after one hour, demonstrating the presence of a population of viable cells that cannot grow, but do not die, upon activation of the nuclease. To determine what fraction of these colonies are escapers, we also enumerated colonies resistant to aTc induction (Fig.4d) and found that approximately half of the colonies formed in the absence of aTc 5 come from bona fide dormant cells. Finally, we looked at the effects of CARD1 activation on pTarget by agarose gel electrophoresis of plasmid DNA extracted at different time points after aTc addition (Fig.4e). In dCARD1 cultures the plasmid remained intact for 120 minutes after the activation of cA production, similarly to the ^spc control. In contrast, +CARD1 cells cleared pTarget, but not pCRISPR, 20 minutes after addition of the inducer. However, in cells 10 lacking the ssDNase activity of Cas10 (H14A, D15A; Cas10 ^HD ), pTarget remained intact (Fig.4f) and the growth CARD1-mediated growth arrest was maintained (Figs.5c-f), a result that highlights the importance of both Cas10 DNA destruction and CARD1 replication halt for the clearance of the target DNA. Altogether, these results show that CARD1 activation by the type III-A CRISPR-Cas immune response leads to induction of the SOS response and 15 severe toxicity that results in the generation of a population of host cells with arrested growth in which the target DNA is degraded mainly by Cas10. [0053] We also tested the importance of CARD1 during immunity against phage infection. Due to the dependence on target transcription to activate the HD domain of Cas10, type III-A immunity results in the rapid elimination of the phage DNA from the host when 20 the target is expressed early during infection and the viral genome has not yet replicated to increase its copy number (15). In contrast, when the viral target is located in a late-expressed transcript, the Cas10 complex can only initiate its attack on the invading DNA after the phage has replicated and accumulated in the host. In this situation the complete degradation of the viral genomes within the infected cells is much slower (15). We programmed the different 25 pCRISPR plasmids with spacers targeting either early- or late-expressed viral genes, infected the cultures with staphylococcal virulent phages and followed their growth to determine the effectiveness of the type III-A immune response in the presence or absence of CARD1. As expected from previous results (15), when the early ORF9 transcript of phage Φ12γ3 (25) was targeted, the presence of CARD1 nuclease activity was not required for immunity (Figs. 30 6a, 7a). In contrast, when immunity was activated by the late ORF27 transcript, +CARD1 but not dCARD1 cultures were able to survive infection (Figs.6b and 6b). Survival also required the ability to bind cA4, as mutations in the nucleotide binding pocket also prevented immunity (Fig.6c). Similar results were obtained when the pCRISPR plasmids were programmed with spacers that target an early or late transcript of the staphylococcal phage ΦNM1γ6 (26) (Figs.7a, c-d). We also measured phage propagation in cells programmed to target the ORF27 transcript of Φ12γ3 (Fig.7a), by counting plaque forming units (pfu) at different times after infection (Fig.6d). We found that while the phage propagated to high 5 titers in both -CARD1 and ^spc cultures, +CARD1 cells effectively eliminated Φ12γ3 from the culture. Finally, we investigated whether CARD1 nuclease activity was sufficient to provide immunity by infecting cells that express Cas10 ^HD in the presence or absence of CARD1. Remarkably, both when the ORF9 (Fig.6a) and ORF27 (Fig.6b) transcripts were targeted by the Cas10 complex, CARD1 alone was able to provide immunity to growing cells 10 as well as reduce the phage titer in the cultures (Fig.7e). Altogether, these results demonstrate that CARD1 nuclease activity is sufficient to provide anti-phage defense in staphylococci and also required for an efficient type III-A CRISPR-Cas immune response when the target is expressed late after infection. [0054] Type III CRISPR-Cas systems employ cA second messengers to activate 15 auxiliary proteins needed for immunity (9, 10). The most common accessory proteins are the non-specific ssRNases Csm6 and Csx1 (16, 17). The present disclosure reveals how the ssDNase and ssRNase CARD1 is activated by cA ₄ to assist the type III-A CRISPR-Cas response against phages. We found that not only the function of CARD1 but also its activation differs from the previously described RNases. We can also compare CARD1 with 20 Can1, a type III-associated, CARF-containing nickase activated by cA ₄ (19), and NucC, an effector of the CBASS defense which non-specific dsDNA endonuclease activity is triggered by binding of cA3 (28). While Can1 contains a pair of CARF domains and a single nuclease domain and binds cA ₄ as a monomer, NucC adopts a trimeric scaffold which binds one molecule of cA ₃ to promote the formation of a dimer of trimers with endonuclease activity. 25 [0055] In vivo, activation of CARD1 resulted in cell toxicity that produced a growth arrest followed by the death of a substantial fraction of the host population. In addition, both Cas10 and CARD1 ssDNase activities were required for efficient clearance of a target plasmid. During phage infection, CARD1 was necessary for defense when the target transcript recognized by the crRNA in the Cas10 complex is expressed late in the viral lytic 30 cycle, but it was also sufficient to allow survival of a host population lacking the ssDNase activity of Cas10, both when activated by cA ₄ production early and late during infection. Based on these data we propose that CARD1 protective function is achieved by two separate but overlapping mechanisms. On one hand CARD1 toxicity can provide an abortive infection mechanism of defense in which compromised cells stop growing and prevent the exponential replication of the phage. This activity is similar to the function of Csm6 during type III-A immunity against plasmid-borne, weakly transcribed targets (13, 14) and viral threats recognized late in the infection cycle (15), and it is believed to not only constrain viral 5 propagation and allow the growth of the non-infected cells, but also to facilitate the clearance of the foreign DNA within infected, non-growing cells by Cas10. Interestingly, CARD1 orthologs are present in type III-D systems (18), where Cas10 naturally lacks a functional HD domain and is predicted to be unable to destroy the invader’s DNA. Therefore the presently provided results suggest that these systems might protect the host population via a crRNA- 10 guided abortive infection mechanism, similar to the defense provided by type VI systems (29). On the other hand, in contrast to Csm6, CARD1 could directly destroy the phage genome. Many phages and plasmids copy their DNA through rolling-circle replication, which involves the formation of ssDNA intermediates (30), likely making them sensitive to CARD1 digestion. Moreover, since Cas10 also cuts ssDNA, possibly at the transcription fork of the 15 target (8), it could generate more ssDNA intermediates that are sensitive to CARD1 cutting, a hypothesis that explains our result showing synergy between both nucleases to specifically destroy pTarget (Figs.4e, f). [0056] The lower prevalence of CARD1 across prokaryotic sequences compared to Csm6/Csx1 (16-18) contrasts with its efficient ability to provide immunity against phage 20 infection. It is possible that the potent toxicity we observed for CARD1 could be detrimental for the host organism if randomly triggered, for example by accidental off-target activation of the Cas10 complex. Due to their sparse appearance in genomic databases, the presence of CARD1 orthologs is limited to organisms that are difficult to culture in laboratory conditions and cannot be genetically manipulated (18). Thus we decided to study CARD1 function as an 25 accessory protein of the type III-A CRISPR-Cas system of S. epidermidis, in staphylococci. Because CRISPR-Cas loci are able to transfer horizontally between different species to provide defense without the need of host factors (with only a few exceptions), we believe that our findings for CARD1 would apply to its function in the native host Treponema succinifaciens. Supporting this idea, we previously found that the Palm domain of S. 30 epidermidis Cas10 produces cA6 to heterologously activate Enterococcus italicus Csm6 in staphylococcal hosts (10). Therefore the present results showing that CARD1 is activated by cA ₄ but not cA ₆ indicate that the S. epidermidis Cas10 complex is able to produce cA rings of different sizes to activate a wide range of CARF-containing proteins, offering the possibility for the functional genetic exchange of type III accessory proteins. Our study highlights the variety of defense systems and mechanisms that prokaryotic organisms have evolved to counteract the diversity and rapid evolution of their genetic parasites. [0057] The following materials and methods were used to describe the foregoing results. 5 [0058] Methods [0059] Protein expression and purification [0060] The corresponding sequence of full-length CARD1 (1-372) was cloned to plasmid pJTR330 with a C-terminal hexahistidine (His6)-tag. The protein was overexpressed in E. coli strain BL21-CodonPlus(DE3)-RIL (Stratagene). Bacteria were grown at 37 °C to 10 OD600 of 0.8 and induced by 0.5 mM isopropyl β-D-1-thiogalactopyranoside (IPTG) at 18 °C overnight. Bacteria cells were lysed by sonication in buffer A (20 mM Tris-HCl, 500 mM NaCl, pH 8.0) supplemented with 20 mM imidazole and 1 mM phenylmethylsulfonyl fluoride (PMSF). Cell lysates were centrifuged, and the supernatant was loaded onto a 5 mL HisTrap FF column (GE Healthcare) with extensive washing by buffer A supplemented with 15 50 mM imidazole. The target protein was eluted with buffer A supplemented with 300 mM imidazole. The eluate was further purified on 5 mL HiTrap Heparin column (GE Healthcare) by a linear gradient from 100 mM to 1 M NaCl, and then on Superdex 20016/60 column pre- equilibrated in buffer B (20 mM Tris-HCl, pH 7.5, 150 mM NaCl, 1mM DTT). The high purity eluting fractions were detected by SDS-PAGE and collected. The protein was flash- 20 frozen in liquid nitrogen and stored at −80 °C. [0061] In vitro DNA/RNA cleavage assays [0062] The reactions were done in a reaction buffer (20 mM Tris-HCl, pH 7.5, 150 mM NaCl, 1mM DTT, and 5 mM MnCl ₂ , unless otherwise stated, with 250 nM CARD1 and 2.5 uM of cA4, with 2 μg M13 ssDNA (NEB) (Fig.1b), 500 ng of non-linearized and 25 linearized ΦX174 dsDNA (NEB) (Figs.1d, e, respectively) and 2 μg ΦX174 ssDNA (NEB) (Fig.1a). cA4 and cA6 was obtained from Biolog Life Science Institute GmbH & Co. KG (Bremen, Germany). The reaction products were visualized by agarose gel electrophoresis. For the RNA oligo cleavage assay, 250 nM of a Cy3-labelled RNA oligo was added to the reaction. The reaction products were run on Mini-PROTEAN TBE-Urea precast gel (Bio- 30 Rad), and visualized on a TYPHOON IMAGE SCANNER. For degradation of ssRNA or dsRNA ladders, 1 ug of either ssRNA ladder (NEB) or dsRNA ladder (NEB) was digested. The reaction products were visualized by agarose gel electrophoresis. At the indicated timepoints, all reaction were stopped by the addition of 25 mM of EDTA. [0063] For determining the nucleotide cleavage preference of CARD1, the reaction was performed as above, with 1 uM of each RNA oligo (IDT). The RNA oligos had a 5’ end fluorophore (FAM) and a 3’ end quencher (Iowa black), generating a fluorescent signal upon cleavage of the linker RNA. Fluorescent measurements were taken in a TECAN plate reader, 5 using values from when the reaction was complete.0.5 ul of RNaseI (Thermo Fisher Scientific), which cuts next to all RNA nucleotides, was used as a positive control. [0064] Bacterial growth [0065] S. aureus strain RN4220 (23) was grown in brain heart infusion (BHI) medium at 37 °C, supplemented with chloramphenicol at 10 µg/ml for maintaining 10 pCRISPRs, and erythromycin at 10 µg/ml for maintaining pTarget.5 µM CaCl ₂ was supplemented in phage experiments. [0066] Molecular cloning [0067] The plasmids used in this study are listed in the tables. The oligonucleotides used for this cloning are listed in the tables. The cloning strategies for generating these 15 plasmids are listed in the tables. For obtaining the coding sequence of CARD1, the amino acid sequence of Tresu_2185 (NCBI Reference Sequence WP_013702306.1) from Treponema succinifaciens DSM 2489 was codon optimized for expression in S. aureus and synthesized by Genewiz (NJ, USA). In embodiments, the disclosure thus comprises a codon optimized cDNA, and expression vectors comprising the cDNA sequence. 20 [0068] Growth curves [0069] For in vivo CARD1 toxicity induction, triplicate RN4220 overnight cultures harbouring pTarget and a pCRISPR are diluted 1:100, outgrown for about an hour, and normalized for OD. Cells are then seeded in a 96 well plate. To induce targeting, 6.25-12.5 ng/ml of anhydrotetracycline (aTc) is added to the appropriate wells. Absorbance at 600 nm 25 is then measured every 10 minutes by a microplate reader (TECAN Infinite 200 PRO). To analyze targeting escapers, cells from the end of the experiment (either cells from wells without aTc, i.e. naïve cells, or cells from wells that recovered later in the time course due to CARD1 toxicity) are re-streaked on BHI agar plates, and individual colonies were launched in liquid culture, diluted the next day, and used for a new time course experiment. From these 30 overnight cultures, plasmid DNA was isolated (QIAgen Spin Miniprep Kit), digested by BamHI-HF (single-cutter for both pTarget and pCRISPR) (New England Biolabs), and visualized by gel electrophoresis. The deletion of important features in pTarget (making it unable to be targeted by pCRISPR) or pCRISPR was confirmed by Sanger sequencing. [0070] For in vivo anti-phage immunity, cells harbouring various pCRISPRs were launched in triplicate overnight, diluted 1:100, outgrown for about an hour, and normalized for OD. Cells were seeded into a 96 well plate. Phage Φ12γ3 (25) ΦNM1γ6 (26) or was added at the appropriate multiplicity of infection, and OD measurements were taken every 10 5 minutes. [0071] CARD1 toxicity assay [0072] To measure the effect of CARD1 activity on S. aureus viability over time, colonies of S. aureus harbouring pTarget and the specified pCRISPR were launched in liquid culture overnight in triplicate. The next day, cells were diluted 1:100 and grown out for about 10 an hour, and normalized for OD. One aliquot was taken from each culture, and then aTc was added to induce CRISPR targeting and CARD1 activity (to a concentration of 3 ng/ml in Fig. 4c or 125 ng/ml in Fig.5c). At each timepoint, cell aliquots were removed, centrifuged, resuspended in media lacking aTc, and serial dilutions were plated on solid BHI agar plates with or without aTc. All viable cells should grow on the solid agar plates, but only targeting 15 escapers (cells that recover due to mutations in pTarget or pCRISPR) should form CFUs on plates with aTc. [0073] Liquid anti-phage infection [0074] To obtain CFU and PFU counts over time from cultures infected with phage, RN4220 cultures harbouring various pCRISPRs were launched overnight, diluted 1:100, and 20 outgrown for about one hour. Cells were then infected with phage Φ12γ3 at an MOI of 10, and an aliquot was taken shortly after to obtain PFUs at time 0. The cultures were then incubated further, with aliquots taken at 1 and 4 hours. [0075] Plasmid curing [0076] To assess CARD1’s ability to promote plasmid curing under low transcription 25 conditions, a plasmid curing assay was performed, by adapting a known approach. Briefly, overnight cultures of S. aureus cells harbouring pTarget and a pCRISPR containing either Csm6, dCsm6, or CARD1 were diluted to exactly OD 0.15 in tryptic soy broth with 10 ug/ml chloramphenicol. After removing a cell aliquot for the 0 timepoint, aTc was added to a concentration of 9.3 ng/ml (Fig.4e) or 125 ng/ml (Fig.4f) and the cells were incubated at 37 30 °C, with further aliquots taken at the indicated times. The cells were then lysed, and the plasmid DNA isolated using a QIAprep Miniprep kit (Qiagen) according to the manufacturer’s protocol (Qiagen).400 ng of plasmid was then linearized using BamHI-HF (New England Biolabs), which cuts both pTarget and pCRISPR once, followed by visualization by gel electrophoresis. [0077] RT-qPCR of SOS-induced genes [0078] Cells carrying pTarget and a pCRISPR containing either CARD1 or dCARD1 were grown overnight in triplicate, diluted 1/100 into fresh BHI with 10 ug/ml of chloramphenicol and outgrown for an hour. The cells were then diluted to an OD of 0.1. To 5 induce targeting, aTc was added to a final concentration of 250 ng/ml. The cells were incubated with shaking for 20 minutes before being spun down at 6000 x g for 5 minutes, and then lysed in PBS with 1mg/ml of lysostaphin and 2 mg/ml of lysozyme for 10 minutes at 37 °C. RNA was purified using Direct-zol RNA miniprep kit (Zymo Research) according to the manufacturer’s protocol, followed by DNA depletion using TURBO DNA-free kit 10 (Invitrogen) according to the manufacturer’s protocol. To produce cDNA, approximately 2 ug of DNA-depleted RNA was treated using the SuperScript IV Reverse Transcriptase kit (Invitrogen) according to the manufacturer’s protocol and random hexamer primers. The RT- qPCR reaction was performed using Fast SYBR Green Master Mix (Life Technologies) with an input of about 100 ng cDNA, in biological triplicate, using 0.375 mM of each primer, on a 15 QuantStudio 3 qPCR machine (Thermo Fisher). The housekeeping gene rho was used as an internal normalization control (37). [0079] Next-generation sequencing of ssDNA degradation products [0080] To assess the ssDNA cleavage patterns of CARD1, 2 ug of ΦX174 virion DNA (New England Biolabs) or M13 ssDNA (M13mp18) (New England Biolabs) was first 20 digested by 250 nM CARD1 with 2.5 uM of cA4 in a buffer consisting of 20 mM Tris pH 7.5, 150 mM NaCl, 1 mM DTT, and 5 mM MnCl2. At the specified time points, the reaction was quenched by adding 25 mM of EDTA. Half the reaction was visualized by agarose gel electrophoresis. The remaining digestion products from the 2 hour timepoint were purified by phenol chloroform extraction. 25 [0081] Without further fragmentation, the purified digested DNA was subjected to the Accel-NGS 1S Plus DNA Library Kit (Swift Biosciences), proceeding according to the manufacturer’s protocol, using a 1.5 x ratio of magnetic beads (AMPure XP beads by Beckman Coulter) to also include small DNA fragments. One of the library preparation steps involves the addition of on average 8 nucleotides to the 3’ end of the DNA. The 5’ end of the 30 input DNA molecules remains unchanged. Paired-end sequencing was performed on an Illumina MiSeq. The 5’ end of each read R1 represents the start of a DNA molecule, and thus a CARD1 cut site. Using a custom python script, the location of 7,020,067 ΦX174 reads (mapping to Genbank reference NC_001422) and 7,670,616 M13 reads (mapping to Genbank reference X02513) was determined. To account for reads mapping at the circular junctions, 65 nucleotides of the first 5’ end of the maps were copied and added at the 3’ end of the maps. The DNA sequence 20 nucleotides upstream and downstream of the cut sites was extracted using a custom Python script, and the CARD1 cleavage motifs for ΦX174 and the M13 were determined separately using Weblogo3 (38), with basal nucleotide compositions 5 determined by the compositions in each map (ΦX174 with A:24.0, C:21.4, G:23.3, T:31.3, and M13 with A:24.4, C:21.1, G:21.1, T:33.4). For the fragment size analysis, 8 nucleotides were removed from all the reads from the 3’ end pair mate by the “Trim Ends” option in the Geneious Bioinformatics Software platform (39). Using the STAR aligner (version 2.7.3) (40), 7,505,136 reads were successfully mapped to ΦX174, and 8,179,356 reads were 10 successfully mapped to M13, using default arguments with the addition of --alignIntronMax 1 --alignMatesGapMax 6000 --peOverlapNbasesMin 5 --alignEndsProtrude 10 ConcordantPair. _JTR976 ^{ATGGAACAGAAAGAAAAATCATTGTTC Cloning 26} Cloning 27 JTR977 CTCACTAACAATATCTTCATTGG J _TR978 ^{GAACAGAAAGAAAAATCATTGTTCATCAAG Cloning 28} Cloning 29 JTR979 GTACTCACTAACAATATCTTCATTGG J _TR980 ^{AGGTAAAGAATTGCAGGAGTTATACC Cloning 30} GTATAACTCCTGCAATTCTTTACCTGCAGGTTG Cloning 31 JTR981 GTAGAATATCTCTGTGTTAGG J _TR982 ^{GTAAAGCAACACTTGTATACGAAAAG Cloning 32} CTTTTCGTATACAAGTGTTGCTTTACTGCTAAT Cloning 33 JTR983 CCGAACTTACTCTTGATGATCG J _TR984 ^{ATGTAAGAGTTTCGTCGATGGAAACG Cloning 34} CCATCGACGAAACTCTTACATGCTATCACGTGT Cloning 35 JTR985 AACTTATTGTCTTTGTCC J _TR986 ^{AATGTAAGAGTTTCGTCGATGG Cloning 36} CCATCGACGAAACTCTTACATTGTATCACGTGT Cloning 37 JTR987 AACTTATTGTCTTTGTCC J _TR993 ^{CAACCTATAGGTAAAGAATTGCAGG Cloning 38} CAATTCTTTACCTATAGGTTGTGCGAATATCTC Cloning 39 JTR994 TGTGTTAGGTTTGTTATTAAAGAAATC J _TR995 ^{GTTATCTACTTGGACAAAGACAATAAGTTAC Cloning 40} GTCTTTGTCCAAGTAGATAACTGCCAACTCGTT Cloning 41 JTR996 TTTGTCATTTCCC GTTCAGTTACATTAGATAATGCGCTAGGTG qPCR primer 42 JTR1000 for recA, F CGATAAATGCTGCCACCCCG qPCR primer 43 JTR1001 for recA, R CTGTGACTTTACCAATAACTGGCACATG qPCR primer 44 JTR1002 for lexA, F CTGTTCATGGTCACCTTTCACGTCTTG qPCR primer 45 JTR1003 for lexA, R CGATACTATATATGCTGAAGGACAACGACG qPCR primer 46 JTR1004 for uvrA, F W1170 GCATGGGATG [0082] References - this reference listing is not an indication that any reference(s) are material to patentability. 1. R. Barrangou et al., CRISPR provides acquired resistance against viruses in 5 prokaryotes. Science 315, 1709-1712 (2007). 2. L. A. Marraffini, E. J. Sontheimer, CRISPR interference limits horizontal gene transfer in staphylococci by targeting DNA. Science 322, 1843-1845 (2008). 3. S. J. Brouns et al., Small CRISPR RNAs guide antiviral defense in prokaryotes. Science 321, 960-964 (2008). 10 4. R. N. Jackson, P. B. van Erp, S. H. Sternberg, B. Wiedenheft, Conformational regulation of CRISPR-associated nucleases. Curr. Opin. Microbiol.37, 110-119 (2017). 5. K. S. Makarova et al., Evolutionary classification of CRISPR-Cas systems: a burst of class 2 and derived variants. Nat. Rev. Microbiol.18, 67-83 (2020). 6. C. R. Hale et al., RNA-guided RNA cleavage by a CRISPR RNA-Cas protein 15 complex. Cell 139, 945-956 (2009). 7. M. Kazlauskiene, G. Tamulaitis, G. Kostiuk, C. Venclovas, V. Siksnys, Spatiotemporal Control of Type III-A CRISPR-Cas Immunity: Coupling DNA Degradation with the Target RNA Recognition. Mol. Cell 62, 295-306 (2016). 8. P. Samai et al., Co-transcriptional DNA and RNA Cleavage during Type III CRISPR- 20 Cas Immunity. Cell 161, 1164-1174 (2015). 9. M. Kazlauskiene, G. Kostiuk, C. Venclovas, G. Tamulaitis, V. Siksnys, A cyclic oligonucleotide signaling pathway in type III CRISPR-Cas systems. Science 357, 605-609 (2017). 10. O. Niewoehner et al., Type III CRISPR-Cas systems produce cyclic oligoadenylate 25 second messengers. Nature 548, 543-548 (2017). 11. N. Jia, R. Jones, G. Yang, O. Ouerfelli, D. J. Patel, CRISPR-Cas III-A Csm6 CARF Domain Is a Ring Nuclease Triggering Stepwise cA4 Cleavage with ApA>p Formation Terminating RNase Activity. Mol. Cell, (2019). 12. R. Molina et al., Structure of Csx1-cOA4 complex reveals the basis of RNA decay in 30 Type III-B CRISPR-Cas. Nat Commun 10, 4302 (2019). 13. K. Foster, J. Kalter, W. Woodside, R. M. Terns, M. P. Terns, The ribonuclease activity of Csm6 is required for anti-plasmid immunity by Type III-A CRISPR-Cas systems. RNA Biol, (2018). 14. J. T. Rostol, L. A. Marraffini, Non-specific degradation of transcripts promotes 35 plasmid clearance during type III-A CRISPR-Cas immunity. Nat Microbiol 4, 656-662 (2019). 15. W. Jiang, P. Samai, L. A. Marraffini, Degradation of phage transcripts by CRISPR- associated RNases enables type III CRISPR-Cas immunity. Cell 164, 710-721 (2016). 16. S. A. Shmakov, K. S. Makarova, Y. I. Wolf, K. V. Severinov, E. V. Koonin, 40 Systematic prediction of genes functionally linked to CRISPR-Cas systems by gene neighborhood analysis. Proc Natl Acad Sci U S A 115, E5307-E5316 (2018). 17. S. A. Shah et al., Comprehensive search for accessory proteins encoded with archaeal and bacterial type III CRISPR-cas gene cassettes reveals 39 new cas gene families. RNA Biol, 1-13 (2018). 18. K. S. Makarova, V. Anantharaman, N. V. Grishin, E. V. Koonin, L. Aravind, CARF 5 and WYL domains: ligand-binding regulators of prokaryotic defense systems. Front Genet 5, 102 (2014). 19. S. A. McMahon et al., Structure and mechanism of a Type III CRISPR defence DNA nuclease activated by cyclic oligoadenylate. Nat Commun 11, 500 (2020). 20. J. Kosinski, M. Feder, J. M. Bujnicki, The PD-(D/E)XK superfamily revisited: 10 identification of new members among proteins involved in DNA metabolism and functional predictions for domains of (hitherto) unknown function. BMC Bioinformatics 6, 172 (2005). 21. K. H. Maslowska, K. Makiela-Dzbenska, I. J. Fijalkowska, The SOS system: A complex and tightly regulated response to DNA damage. Environ Mol Mutagen 60, 368-384 (2019). 15 22. S. Horinouchi, B. Weisblum, Nucleotide sequence and functional map of pC194, a plasmid that specifies inducible chloramphenicol resistance. J. Bacteriol.150, 815-825 (1982). 23. B. N. Kreiswirth et al., The toxic shock syndrome exotoxin structural gene is not detectably transmitted by a prophage. Nature 305, 709-712 (1983). 20 24. R. T. Cirz et al., Complete and SOS-mediated response of Staphylococcus aureus to the antibiotic ciprofloxacin. J. Bacteriol.189, 531-539 (2007). 25. J. W. Modell, W. Jiang, L. A. Marraffini, CRISPR-Cas systems exploit viral DNA injection to establish and maintain adaptive immunity. Nature 544, 101-104 (2017). 26. G. W. Goldberg, W. Jiang, D. Bikard, L. A. Marraffini, Conditional tolerance of 25 temperate phages via transcription-dependent CRISPR-Cas targeting. Nature 514, 633-637 (2014). 27. J. S. Athukoralage, C. Rouillon, S. Graham, S. Gruschow, M. F. White, Ring nucleases deactivate type III CRISPR ribonucleases by degrading cyclic oligoadenylate. Nature, (2018). 30 28. R. K. Lau et al., Structure and Mechanism of a Cyclic Trinucleotide-Activated Bacterial Endonuclease Mediating Bacteriophage Immunity. Mol. Cell 77, 723-733 e726 (2020). 29. A. J. Meeske, S. Nakandakari-Higa, L. A. Marraffini, Cas13-induced cellular dormancy prevents the rise of CRISPR-resistant bacteriophage. Nature 570, 241-245 (2019). 35 30. P. Wawrzyniak, G. Plucienniczak, D. Bartosik, The Different Faces of Rolling-Circle Replication and Its Multifunctional Initiator Proteins. Front Microbiol 8, 2353 (2017). 31. W. Kabsch, Xds. Acta Crystallogr D Biol Crystallogr 66, 125-132 (2010). 32. A. J. McCoy et al., Phaser crystallographic software. J Appl Crystallogr 40, 658-674 (2007). 40 33. P. D. Adams et al., PHENIX: a comprehensive Python-based system for macromolecular structure solution. Acta Crystallogr D Biol Crystallogr 66, 213-221 (2010). 34. P. Emsley, B. Lohkamp, W. G. Scott, K. Cowtan, Features and development of Coot. Acta Crystallogr D Biol Crystallogr 66, 486-501 (2010). 35. P. V. Afonine et al., Towards automated crystallographic structure refinement with 45 phenix.refine. Acta Crystallogr D Biol Crystallogr 68, 352-367 (2012). 36. T. D. Goddard et al., UCSF ChimeraX: Meeting modern challenges in visualization and analysis. Protein Sci.27, 14-25 (2018). 37. T. Theis, R. A. Skurray, M. H. Brown, Identification of suitable internal controls to study expression of a Staphylococcus aureus multidrug resistance system by quantitative real- 50 time PCR. J. Microbiol. Methods 70, 355-362 (2007). 38. G. E. Crooks, G. Hon, J. M. Chandonia, S. E. Brenner, WebLogo: a sequence logo generator. Genome Res.14, 1188-1190 (2004). 39. M. Kearse et al., Geneious Basic: an integrated and extendable desktop software platform for the organization and analysis of sequence data. Bioinformatics 28, 1647-1649 5 (2012). 40. A. Dobin et al., STAR: ultrafast universal RNA-seq aligner. Bioinformatics 29, 15-21 (2013). [0083] Although the present disclosure has been described using specific 10 embodiments and examples, routine modifications will be apparent to those skilled in the art and such modifications are intended to be within the scope of the disclosure and the claims.