DELPUTTE PETER (BE)
NAUWYNCK HANS (BE)
DELPUTTE PETER (BE)
WO2004100983A2 | 2004-11-25 | |||
WO2002087424A2 | 2002-11-07 |
CROCKER PAUL R ET AL: "Sialoadhesin Binds Preferentially to Cells of the Granulocytic Lineage" JOURNAL OF CLINICAL INVESTIGATION, vol. 95, no. 2, 1995, pages 635-643, XP002533021 ISSN: 0021-9738
DATABASE DISSABS [Online] 13 October 2003 (2003-10-13), KALOVIDOURIS, STACEY A. [PH.D.] ET AL: "Constructing carbohydrate-based multivalent scaffolds for studying carbohydrate-protein interactions" XP002533022 retrieved from STN Database accession no. 2003:46286 & DISSERTATION ABSTRACTS INTERNATIONAL, VOL. 64, NO. 1B, P. 189. ORDER NO.: AAI3078096. 115 PAGES. ISBN: 0-493-98674-X., 2002,
DUCREUX J ET AL: "The inhibitory potencies of monoclonal antibodies to the macrophage adhesion molecule sialoadhesin are greatly increased following PEGylation" BIOCONJUGATE CHEMISTRY, ACS, WASHINGTON, DC, US, vol. 19, no. 10, 1 October 2008 (2008-10-01), pages 2088-2094, XP008098528 ISSN: 1043-1802 [retrieved on 2008-09-23]
1. A method of delivering a cargo moiety to a cell, comprising: contacting a cell expressing sialoadhesin with a conjugate, the conjugate comprising a sialoadhesin binding moiety and a cargo moiety, wherein the sialoadhesin binding moiety binds to the sialoadhesin expressed by the cell, thereby delivering the cargo moiety to the cell.
2. The method of claim 1 wherein the cell is a macrophage.
3. The method of claim 1 wherein the sialoadhesin binding moiety is an antibody.
4. The method of claim 1 wherein the sialoadhesin binding moiety is a sialoadhesin ligand.
5. The method of claim 1 wherein the cargo moiety is a stimulator of a response in the cell.
6. The method of claim 1 wherein the response is an immune response.
7. The method of claim 5 wherein the cargo moiety is an antigen.
8. The method of claim 1 wherein the cargo moiety is an inhibitor of the cell.
9. The method of claim 1 wherein the cargo moiety is a cytotoxic agent.
10. The method of claim 9 wherein the cytotoxic agent is a ribosome inactivating protein.
11. The method of claim 9 wherein the cytotoxic agent is saporin.
12. The method of claim 1 wherein the cargo moiety is an antimicrobial agent.
13. The method of claim 12 wherein the antimicrobial agent is effective to inhibit a microbe selected from the group consisting of: a bacterium, a virus, a fungus, a protozoan, and a combination thereof.
14. The method of claim 1, 5, 8 or 9 wherein the cargo moiety comprises a nucleic acid.
15. The method of claim 7 wherein the antigen is selected from the group consisting of: a protein, a peptide, a glycoprotein and a glycopeptide.
16. The method of claim 7 wherein the antigen selected from the group consisting of: a viral protein, a viral peptide, a viral glycoprotein and a viral glycopeptide.
17. The method of claim 7 wherein the antigen selected from the group consisting of: an influenza virus haemagglutinin or an antigenic portion thereof.
18. The method of claim 17 wherein the antigenic portion of an influenza virus haemagglutinin is encoded by SEQ ID No. 3 or a homologue thereof.
19. The method of claim 1 wherein the cell is in vitro.
20. The method of claim 1 wherein the cell is in vivo.
21. The method of claim 1 further comprising treating the cell with a cytokine effective to induce or enhance expression of sialoadhesin.
22. The method of claim 21 wherein the cell is selected from the group consisting of: a monocyte, a monocyte cell line, a macrophage and a macrophage cell line.
23. The method of claim 22 wherein the cell is selected from the group consisting of: a human cell and a human-derived cell line.
24. The method of claim 23 wherein the human-derived cell line is human monocyte cell line THP-I.
25. The method of claim 21 wherein the cytokine is interferon-alpha.
26. The method of claim 1 wherein the cell is transfected with an expression construct encoding sialoadhesin.
27. The method of claim 1 or 26 wherein the cargo moiety is a nucleic acid.
28. The method of claim 1 wherein the cell is a mammalian cell.
29. A composition, comprising: a sialoadhesin binding moiety conjugated to a cargo moiety.
30. The composition of claim 29 wherein the sialoadhesin binding moiety is an antibody.
31. The composition of claim 29 wherein the sialoadhesin binding moiety is a sialoadhesin ligand.
32. The method of claim 29 wherein the cargo moiety is a stimulator of a response in a sialoadhesin expressing cell.
33. The composition of claim 32 wherein the cargo moiety is an antigen.
34. The method of claim 29 wherein the cargo moiety is an inhibitor of a response in a sialoadhesin expressing cell.
35. A composition of claim 29 wherein the cargo moiety is a cytotoxic agent.
36. The composition of claim 29 wherein the cargo moiety is an antimicrobial agent.
37. The composition of claim 36 wherein the antimicrobial agent is effective to inhibit a microbe selected from the group consisting of: a bacterium, a virus, a fungus, a protozoan, and a combination thereof.
38. The composition of claim 29 wherein the cargo moiety is a cytokine.
39. A method of stimulating an immune response to a viral antigen in a subject, comprising: administering a composition comprising a sialoadhesin binding moiety conjugated to a viral antigen to a subject.
40. The method of claim 39 wherein the viral antigen is an influenza virus protein.
41. The method of claim 40 wherein the influenza virus protein is influenza virus haemagglutinin.
42. The method of claim 40 wherein the influenza virus protein is an extracellular portion of an influenza virus haemagglutinin encoded by the nucleic acid sequence of SEQ ID No. 3 or a homologue thereof.
43. The method of claim 39 wherein the viral antigen is selected from the group consisting of: a Porcine Reproductive and Respiratory Syndrome virus, a Porcine Reproductive and Respiratory Syndrome virus protein , and an antigenic portion of a Porcine Reproductive and Respiratory Syndrome virus protein.
44. The method of claim 39 wherein the sialoadhesin binding moiety is an antibody.
45. The method of claim 44 wherein the sialoadhesin binding moiety is monoclonal antibody 41D3.
46. The method of claim 41 wherein the sialoadhesin binding moiety is monoclonal antibody 7D2.
47. The method of claim 41 wherein the sialoadhesin binding moiety is monoclonal antibody
MCA2316.
48. The method of claim 39 wherein the sialoadhesin binding moiety is a sialoadhesin ligand.
49. The method of claim 39 further comprising administering an amount of a cytokine effective to induce or enhance expression of sialoadhesin in a cytokine responsive cell in the subject.
50. The method of claim 49 wherein the cytokine is INF-alpha.
51. The method of claim 49 wherein the cell is selected from the group consisting of: a monocyte and a macrophage.
52. A method of stimulating an immune response to an antigen in a subject, comprising: administering a composition comprising a sialoadhesin binding moiety conjugated to an antigen to a subject.
53. The method of claim 52 wherein the antigen is selected from the group consisting of: a protein, a peptide, a glycoprotein and a glycopeptide.
54. The method of claim 52 wherein the antigen selected from the group consisting of: a viral protein, a viral peptide, a viral glycoprotein and a viral glycopeptide.
55. The method of claim 52 wherein the antigen is an influenza virus protein.
56. The method of claim 55 wherein the influenza virus protein is influenza virus haemagglutinin.
57. The method of claim 52 wherein the antigen is influenza virus haemagglutinin isolated from an influenza virus.
58. The method of claim 52 wherein the antigen is recombinant influenza virus haemagglutinin.
59. The method of claim 58 wherein the recombinant influenza virus protein is an extracellular portion of an influenza virus haemagglutinin encoded by the nucleic acid sequence of SEQ ID No. 3 or a homologue thereof.
60. The method of claim 52 wherein the antigen is influenza virus haemagglutinin identified by SEQ ID No. 4 or a homologue thereof.
61. The method of claim 52 wherein the antigen is selected from the group consisting of: a
Porcine Reproductive and Respiratory Syndrome virus protein , and an antigenic portion of a Porcine Reproductive and Respiratory Syndrome virus protein.
62. The method of claim 52 wherein the sialoadhesin binding moiety is an antibody.
63. The method of claim 62 wherein the sialoadhesin binding moiety is selected from the group consisting of: monoclonal antibody 41D3, monoclonal antibody 7D2 and monoclonal antibody MCA2316.
64. The method of claim 62 wherein the sialoadhesin binding moiety is a sialoadhesin ligand.
65. A method of screening a compound for sialoadhesin binding activity and/or sialoadhesin binding stimulated cell internalization activity, comprising: inducing or enhancing sialoadhesin expression in a cell; administering the compound to the cell; and performing an assay for specific binding of the compound to sialoadhesin and/or performing an assay for sialoadhesin binding stimulated cell internalization activity.
66. The method of claim 65 wherein the inducing or enhancing sialoadhesin expression in the cell comprises administering a cytokine to the cell.
67. The method of claim 66, wherein the cytokine is IFN-alpha.
68. The method of claim 66 wherein the cell is selected from the group consisting of: a monocyte, a monocyte cell line, a macrophage and a macrophage cell line.
69. The method of claim 65 wherein the induding or enhancing sialoadhesin expression in the cell comprises transfection of the cell with a sialoadhesin expression construct.
70. A method of transfecting a cell, comprising: administering a sialoadhesin binding moiety conjugated to an expression construct to a cell expressing sialoadhesin.
71. The method of claim 70, wherein the cell expressing sialoadhesin is a cell transfected with a sialoadhesin expression construct.
72. The method of claim 71 wherein the cell is a cell line stably expressing sialoadhesin.
73. The method of claim 70 wherein the cell is treated with a cytokine to induce or enhance sialoadhesin expression.
74. A kit for delivering a cargo to a cell, comprising: a cell expressing sialoadhesin; and a sialoadhesin binding moiety.
75. The kit of claim 74 further comprising a reagent for use in conjugation of a cargo to the sialoadhesin binding moiety.
76. The kit of claim 74 wherein the cell is a cell line.
77. The kit of claim 74 wherein the sialoadhesin binding moiety is conjugated to a the cargo.
78. The kit of claim 74 wherein the cargo is an expression construct.
79. A method of treating a pathological condition in a subject, comprising: administering a therapeutically effective amount of a sialoadhesin binding moiety conjugated to a therapeutic cargo moiety to the subject, wherein the therapeutic cargo moiety is delivered to a sialoadhesin expressing cell in the subject, thereby treating the pathological condition.
80. The method of claim 79 wherein the therapeutic cargo moiety is an inhibitor of the cell.
81. The method of claim 80 wherein the inhibitor is a cytotoxic agent.
82. The method of claim 81 wherein the inhibitor is saporin.
83. The method of claim 79 wherein the pathological condition is characterized by presence of a pathogen in the cell.
84. The method of claim 79 wherein the pathological condition is an autoimmune disease.
85. The method of claim 79 wherein the cargo moiety is an inhibitor of macrophage activation and/or inflammation.
86. The method of claim 86 wherein the inhibitor of macrophage activation and/or inflammation is selected from the group consisting of: IL-10, TGF-beta, 6-(methylsulfinyl)hexyl isothiocyanate, a sesquiterpene chromones, and a combination thereof.
87. The method of claim 79 wherein the pathological condition is cancer.
88. A method of immunization essentially as described herein.
89. A method of delivering a cargo to a cell essentially as described herein.
90. A method of inducing or enhancing sialoadhesin expression essentially as described herein.
91. A method of screening a compound for sialoadhesin binding activity and/or sialoadhesin binding stimulated cell internalization activity essentially as described herein.
92. A composition comprising a sialoadhesin binding moiety conjugated to a cargo moiety essentially as described herein.
93. A method of transfecting a cell with an expression construct essentially as described herein.
94. A method of treating a pathological condition essentially as described herein.
95. A kit for delivering a cargo to a cell essentially as described herein. |
SIALOADHESIN-RELATED COMPOSITIONS AND METHODS
REFERENCE TO RELATED APPLICATION
[0001] This application claims priority to U.S. Provisional Patent Application Serial No. 60/799,566, filed May 11, 2006, the entire content of which is incorporated herein by reference.
FIELD OF THE INVENTION
[0002] The present invention relates generally to compositions and methods for targeted cargo delivery to a cell. In particular, the present invention relates to compositions and methods for targeted cargo delivery to a sialoadhesin-expressing cell.
BACKGROUND OF THE INVENTION
[0003] Specific delivery of a substance to a targeted cell is desirable for various purposes, including pharmacological intervention as well as clinical and research bioassays. [0004] Targeted delivery is particularly desirable where exposure of non-targeted cells to a substance to be delivered is preferably avoided, such as where exposure of non-targeted cells can result in undesirable side effects. For example, a therapeutic intervention may require elimination, inhibition, stimulation and/or activation of a particular cell or cell type. In such a situation, it is advantageous to deliver a substance effective to achieve a desired result preferentially to a targeted cell in order to avoid an undesirable side effect such as inhibition or stimulation of non-targeted cells and cell types. Targeted delivery also allows use of less of the substance to be delivered to achieve a desired effect.
[0005] There is a continuing need for compositions and methods for achieving targeted delivery of a substance to a cell.
SUMMARY OF THE INVENTION
[0006] A method of delivering a cargo moiety to a cell is provided according to embodiments of the present invention which includes contacting a cell expressing sialoadhesin with a conjugate including a sialoadhesin binding moiety and a cargo moiety. The sialoadhesin binding moiety binds to the sialoadhesin expressed by the cell and is internalized along with the cargo moiety, thereby delivering the cargo moiety to the cell. Cells naturally expressing sialoadhesin are known, particularly including macrophages. Particular methods provided by the present invention include induction or enhancement of sialoadhesin expression in a cell which naturally produces little or no sialoadhesin. Induction or enhancement of sialoadhesin expression includes transfection of a sialoadhesin expression construct and/or administration of an agent effective to induce or enhance sialoadhesin expression. Expression of sialoadhesin is determined by any of various methods including binding of sialoadhesin-specific antibodies, detection of sialoadhesin encoding mRNA and the like.
[0007] In particular embodiments, the sialoadhesin binding moiety is an antibody which binds substantially specifically to sialoadhesin. Such antibodies include, but are not limited to, mouse anti- porcine sialoadhesin mAb 41D3, mouse anti-human sialoadhesin mAb 7D2 and mouse anti-porcine sialoadhesin mAb MCA2316. [0008] In further embodiments of a method according to the present invention a sialoadhesin binding moiety is a sialoadhesin ligand.
[0009] A cargo moiety included in a conjugate is a stimulator of a response in the cell in particular embodiments. For example, in one embodiment, a conjugate is a stimulator of an immune response in the cell. In further particular embodiments, a conjugate which stimulates an immune response in the cell stimulates an immune response in a subject. Thus, a cargo moiety may be an antigen.
[0010] Also provided are embodiments of the present invention in which the cargo moiety is an inhibitor of the cell. For example, a cargo moiety included in a conjugate is a cytotoxic agent in particular embodiments. A cytotoxic agent is exemplified by, but not limited to, a ribosome inactivating protein. A specific cytotoxic agent which is a ribosome inactivating protein is saporin. [0011] In further embodiments, a cargo moiety is an antimicrobial agent. An antimicrobial agent included in a conjugate is effective to inhibit a microbe such as, but not limited to, a bacterium, a virus, a fungus or a protozoan.
[0012] A cytokine is a cargo moiety in certain embodiments of an inventive method. Optionally, the cargo moiety is a nucleic acid. A delivered nucleic acid is optionally an expression construct. Further optionally an expression construct is included in a vector, such as, but not limited to, a bacterial plasmid or a viral vector. A nucleic acid cargo is optionally an antisense construct such as, but not limited to, an antisense oligonucleotide, an siRNA, an shRNA or an expression vector for expressing an antisense nucleic acid. [0013] Where a cargo moiety is an antigen, the antigen is optionally a protein, a peptide, a glycoprotein or a glycopeptide. Such antigens may be synthetic, such as, but not limited to, recombinantly produced or chemically synthesized proteins or peptides; or natural, such as, but not limited to, an antigen isolated from a cell, virus or organism. In particular embodiments, a cargo which is an antigen is a viral protein, a viral peptide, a viral glycoprotein or a viral glycopeptide. [0014] In particular embodiments, an antigen conjugated to a sialoadhesin binding moiety is an influenza virus haemagglutinin or an antigenic portion thereof. A specific antigenic portion of an influenza virus haemagglutinin is encoded by SEQ ID No. 3 or a homologue thereof. In particular embodiments, a virus haemagglutinin included in a conjugate of the present invention is an influenza virus haemagglutinin of SEQ ID No. 4 or a homologue thereof. [0015] A cell contacted by a conjugate for delivery of a cargo to the cell is in vitro, or in vivo. [0016] In further embodiments of methods according to the present invention a cell is treated with a
cytokine effective to induce or enhance expression of sialoadhesin in the cell. For example, a cell treated with a cytokine effective to induce or enhance expression of sialoadhesin is a monocyte, a monocyte cell line, a macrophage and a macrophage cell line. In particular embodiments, a human cell and /or a human- derived cell line is treated with a cytokine effective to induce or enhance expression of sialoadhesin. An example of a human-derived cell line is human monocyte cell line THP-I. In further particular embodiments, a porcine cell and /or a porcine-derived cell line is treated with a cytokine effective to induce or enhance expression of sialoadhesin. Suitable cytokines effective to induce or enhance expression of sialoadhesin include interferon alpha (IFN-alpha), and a combination of tumor necrosis factor-alpha (TNF- alpha) and interferon-gamma (IFN-gamma). [0017] Compositions are provided according to the present invention which include a sialoadhesin binding moiety conjugated to a cargo moiety. The sialoadhesin binding moiety is an antibody or a sialoadhesin ligand in particular embodiments of a composition of the present invention. [0018] A method of stimulating an immune response in a subject to a viral antigen is provided according to the present invention which includes administering a composition including a sialoadhesin binding moiety conjugated to a viral antigen to a subject. In particular embodiments, a cargo which is a viral antigen is a viral protein, a viral peptide, a viral glycoprotein or a viral glycopeptide. [0019] In particular embodiments, a viral antigen conjugated to a sialoadhesin binding moiety is an influenza virus haemagglutinin or an antigenic portion thereof. A specific antigenic portion of an influenza virus haemagglutinin is encoded by SEQ ID No. 3. [0020] Also provided are methods and compositions in which a viral antigen conjugated to a sialoadhesin binding moiety is a Porcine Reproductive and Respiratory Syndrome virus, a Porcine Reproductive and Respiratory Syndrome virus protein or an antigenic portion of a Porcine Reproductive and Respiratory Syndrome virus protein. [0021] Optionally a sialoadhesin binding moiety is an antibody or a sialoadhesin ligand. Specific antibodies included in a conjugate according to the present invention include monoclonal antibody 41 D3, monoclonal antibody 7D2 and monoclonal antibody MC A2316.
[0022] A conjugate including a sialoadhesin binding moiety and a cargo is produced by chemical bonding between the sialoadhesin binding moiety and cargo in particular embodiments. In further embodiments, a conjugate including a sialoadhesin binding moiety and a cargo is produced by recombinant techniques, including expression of a fusion protein.
[0023] In particular embodiments, a method of stimulating an immune response according to the present invention includes administering an amount of a cytokine effective to induce or enhance expression of sialoadhesin in a cytokine responsive cell in the subject. A specific cytokine effective to induce or enhance expression of sialoadhesin in an INF-alpha responsive cell is INF-alpha. A, INF-alpha responsive cell is identified by methods known in the art including, but not limited to, detection of an INF-alpha
receptor. Particular INF-alpha responsive cells include monocytes, such as, but not limited to, human monocytes, and monocyte-derived cell lines, such as, but not limited to, human monocyte cell line THP-I. A macrophage is a further example of a INF-alpha responsive cell.
[0024] A method of stimulating an immune response to an antigen in a subject is provided according to embodiments of the present invention which includes administering a composition including a sialoadhesin binding moiety conjugated to an antigen to a subject.
[0025] In further embodiments of the present invention, a method of screening a compound for sialoadhesin binding activity and/or sialoadhesin binding stimulated cell internalization activity is provided which includes administering a cytokine effective to induce or enhance sialoadhesin expression; administering the compound ; and performing an assay for specific binding of the compound to sialoadhesin and/or performing an assay for sialoadhesin binding stimulated cell internalization activity. In particular embodiments, the cytokine effective to induce or enhance sialoadhesin expression is INF-alpha. A compound is illustratively an anti-sialoadhesin antibody or a sialoadhesin ligand. Examples of assays to determine specific binding of the compound include incubation of the compound with the cell under typical sialoadhesin binding moiety binding conditions, such as under substantially physiological conditions, and detection of binding. Detection of binding may include, for instance, detection of a reporter bound to the compound. Detection of internalization of the compound is illustratively accomplished by permeabilization of a cell and incubation with a reagent that binds to the compound, such as, but not limited to, an antibody, followed by detection of the reagent. [0026] A method of transfecting a cell is provided which includes administering a sialoadhesin binding moiety conjugated to an expression construct to a cell expressing sialoadhesin. The cell expressing sialoadhesin is a cell transfected with a sialoadhesin expression construct in particular embodiments. In further embodiments, the cell is a cell line stably expressing sialoadhesin. In yet further embodiments, the cell is treated with a cytokine to induce or enhance sialoadhesin expression. [0027] A kit for delivering a cargo to a cell is provided by the present invention which includes a cell expressing sialoadhesin and a sialoadhesin binding moiety. Optionally, a provided kit includes a reagent for use in conjugation of a cargo to the sialoadhesin binding moiety. A cell included in an inventive kit is optionally a cell line. In a further option the sialoadhesin binding moiety included in the kit is conjugated to a cargo. In particular embodiments, the cargo conjugated to the sialoadhesin binding moiety is an expression construct.
[0028] A method of treating a pathological condition in a subject is provided including [0029] administering a therapeutically effective amount of a sialoadhesin binding moiety conjugated to a therapeutic cargo moiety to the subject, wherein the therapeutic cargo moiety is delivered to a sialoadhesin expressing cell in the subject, thereby treating the pathological condition. In particular embodiments, the therapeutic cargo moiety is an inhibitor of the cell, such as, but not limited to, a cytotoxic agent. An example of an inhibitor is saporin. A pathological condition treated according to an inventive
method is characterized by presence of a pathogen in the cell in particular embodiments. In further embodiments, the pathological condition is an autoimmune disease or cancer. An included cargo moiety is an inhibitor of macrophage activation and/or inflammation in embodiments for treating autoimmune disease. Such inhibitors include, but are not limited to, aninhibitor of macrophage activation and/or inflammation such as IL- 10, TGF-beta, 6-(methylsulfinyl)hexyl isothiocyanate, a sesquiterpene chromones, and a combination thereof.
BRIEF DESCRIPTION OF THE DRAWINGS
[0030] Figure 1 is a graph illustrating specific binding and internalization of a sialoadhesin binding moiety at different times after incubation of macrophages at 37 0 C with mAb 41D3;
[0031] Figure 2A is a graph showing the mean ±SEM of antigen-specific IgM serum titers after primary immunization with a sialoadhesin binding moiety/antigen conjugate according to the present invention in which square symbols indicate pigs immunized with HSA coupled to Sn-specific mAb 41D3; triangle symbols indicate pigs immunized with HSA coupled to irrelevant control mAb; and circle symbols indicate pigs immunized with free HSA;
[0032] Figure 2B is a graph showing the mean ±SEM of antigen-specific IgG serum titers after primary immunization with a sialoadhesin binding moiety/antigen conjugate according to the present invention in which square symbols indicate pigs immunized with HSA coupled to Sn-specific mAb 41D3; triangle symbols indicate pigs immunized with HSA coupled to irrelevant control mAb; and circle symbols indicate pigs immunized with free HSA;
[0033] Figure 2C is a graph illustrating means ±SEM of antigen-specific IgG serum titers after booster immunization in which square symbols indicate pigs immunized with HSA coupled to Sn-specific mAb 41D3; triangle symbols indicate pigs immunized with HSA coupled to irrelevant control mAb; and circle symbols indicate pigs immunized with free HSA. ; [0034] Figure 3 is a graph illustrating the percentage of living cells in a population of sialoadhesin expressing cells treated with sialoadhesin binding moiety/cytotoxic agent conjugate compared to cells treated with a non-sialoadhesin binding moiety/cytotoxic agent conjugate;
[0035] Figure 4 is a graph illustrating the percentage of living cells in a population of sialoadhesin expressing cells treated with sialoadhesin binding moiety/cytotoxic agent conjugate compared to non- sialoadhesin expressing cells treated with a sialoadhesin binding moiety/cytotoxic agent conjugate;
[0036] Figure 5 is a set of histograms generated from flow cytometric analysis showing binding and internalization of a particular sialoadhesin binding moiety;
[0037] Figure 6A is a xerographic reproduction of a digital image showing SDS-PAGE analysis of the presence and purity of native influenzavirus haemagglutinin in different fractions obtained during purification includes detection of HA via western blotting using a monoclonal antibody directed against
HA of the HlNl virus;
[0038] Figure 6B is a xerographic reproduction of a digital image showing detection of total protein in the samples shown in Figure 6 A using Coomassie blue staining;
[0039] Figure 7A is a xerographic reproduction of a digital image showing SDS-PAGE analysis of the production of recombinant HA with a V5-His tag where the protein is produced in the absence of fetal bovine serum;
[0040] Figure 7B is a xerographic reproduction of a digital image showing SDS-PAGE analysis of the production of recombinant HA with a V5-His tag where the protein is produced in the presence of fetal bovine serum; [0041] Figure 8 A is a xerographic reproduction of a digital image showing SDS-PAGE Western blot analysis of different fractions taken during the purification process of HA;
[0042] Figure 8B is a xerographic reproduction of a digital image showing SDS-PAGE Coomassie blue analysis of the same fractions taken during the purification process of HA shown in Figure 8A;
[0043] Figure 9A is a xerographic reproduction of a digital image showing SDS-PAGE Western blot analysis showing visualization of coupling of antibody 13D12 with isolated native HA;
[0044] Figure 9B is a xerographic reproduction of a digital image showing SDS-PAGE Western blot analysis showing visualization of coupling of antibody 41D3 with isolated native HA;
[0045] Figure 10 is a set of histograms generated from flow cytometric analysis showing binding and internalization of a particular sialoadhesin binding moiety; [0046] Figure 11 is a xerographic reproduction of a digital image showing SDS-PAGE and Coomassie blue staining of different samples taken during the antibody-saporin conjugation protocol; and
[0047] Figure 12 is a graph showing mean immuno-peroxidase monolayer assay titers of pigs immunized with 13D12-HA or 41D3-HA.
DETAILED DESCRIPTION OF THE INVENTION
[0048] Few effective targeted delivery compositions and methods are capable of delivering a desired cargo to a targeted cell. A particular receptor, sialoadhesin (Sn), is identified as a target for targeted delivery compositions and methods according to the present invention. [0049] Sialoadhesin, also called sheep erythrocyte receptor (SER) or sialic acid binding immunoglobulin-like lectin 1 (Siglec-1) belongs the Siglec family of I-type lectins and is expressed exclusively on subsets of macrophages that are found mostly in spleen, lymph nodes, bone marrow, liver, colon and lungs but not on blood monocytes as described in Crocker, P. R., et al.,1991, Embo J 10:1661-9 ; Crocker, P. R., et al, 1994, Embo J 13:4490-503 ; Duan, X., et al, 1998, J Virol 72:4520-3 ; Hartnell, A., et al., 2001, Blood 97:288-96 ; and Vanderheijden, N., et al., 2003, J Virol 77:8207-15. High Sn expression has also been detected on inflammatory macrophages in tissues from patients with rheumatoid arthritis, and
on infiltrating macrophages that make close contact with breast carcinoma cells as described in Hartnell, A., et al, 2001, Blood 97:288-96; and Nath, D., et al, 1999, Immunology 98:213-9. Sialoadhesin (Sn) was initially identified as a sialic acid dependent-sheep erythrocyte receptor (SER) on resident bone marrow cells of mice, and is now also characterized in a number of mammals including human, rat and swine, described in Crocker, P. R., and S. Gordon, 1989, J Exp Med 169:1333-46; Crocker, P. R., and S. Gordon, 1986, J Exp Med 164:1862-75; and Vanderheijden, N., et al., 2003, J Virol 77:8207-15. [0050] A conjugate composition is provided according to the present invention which includes a sialoadhesin binding moiety conjugated to a cargo moiety. Conjugate compositions including a sialoadhesin binding moiety conjugated to a cargo moiety may be used to deliver a cargo moiety to a sialoadhesin expressing cell.
[0051] The term "nucleic acid" as used herein refers to RNA or DNA molecules having more than one nucleotide in any form including single-stranded, double-stranded, oligonucleotide or polynucleotide. The term "nucleotide sequence" is used to refer to the ordering of nucleotides in an oligonucleotide or polynucleotide in a single-stranded form of nucleic acid. It is appreciated that, due to the degeneracy of the genetic code, multiple nucleic acids encode an identical polypeptide.
[0052] The terms "protein," "polypeptide" and "peptide" are used interchangeably herein to refer to two or more amino acids linked by peptide bonds. The term protein includes modified proteins and peptides exemplified by, but not limited to, glycosylated, phosphorylated, ubiquitinated, myristoylated, palmitoylated, and acetylated proteins and peptides. [0053] The term "expression construct" refers to a recombinant or synthetic nucleic acid including a nucleic acid encoding a protein, and one or more regulatory nucleic acid sequences operably linked to the nucleic acid encoding the protein that direct transcription of at least the nucleic acid encoding the protein in a cell. [0054] The term "transfection" refers to introduction of an exogenous nucleic acid into a cell. [0055] The term "operably linked" refers to a nucleic acid in functional relationship with a second nucleic acid. In general, operably linked nucleic acids are contiguous. An exception is operable linkage of an enhancer, which may be non-contiguous and in functional relationship with another nucleic acid. [0056] The term "vaccine" refers to a pharmaceutical composition including at least one antigen that stimulates an immune response in a subject. [0057] The term "vaccination" refers to administration of a vaccine to stimulate an immune response in a subject. Vaccination of a subject may be performed to prevent or treat a disease in the subject. [0058] The term "antigen" refers to a molecule that includes one or more epitopes that stimulate an antigen-specific response by a component of a host immune system, such as an immune cell. An antigen can include peptide, proteins, glycoproteins, polysaccharides, lipids, gangliosides, portions thereof, and combinations thereof.
[0059] The term "stimulation of an immune response" refers to eliciting or enhancement of an immune response.
[0060] The term "homologue" refers to a protein characterized by an amino acid sequence and/or structural homology to a reference protein. In general, a homologue of the reference protein is at least 50%, preferably at least 75%, more preferably at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or greater, identical to the reference protein. A homologue is illustratively an orthologue of the reference protein isolated from another species. A homologue includes a protein having one or more amino acid substitutions, deletions or insertions compared with the reference protein. [0061] The term "biologically active homologue" of a reference protein refers to a protein characterized by an amino acid sequence and/or structural homology to the reference protein which has substantially similar functional, structural, and/or biochemical properties compared to the reference protein, particularly the naturally occurring reference protein.
[0062] One type of homologue is a conservatively modified protein and/or fragment thereof. A conservatively modified protein or fragment thereof is a protein or peptide which includes substitution of an amino acid with a chemically similar amino acid. For example, each amino acid may be described as having one or more of the following characteristics: electropositive, electronegative, aliphatic, aromatic, polar, hydrophobic and hydrophilic. A conservative substitution is a substitution of one amino acid having a specified structural or functional characteristic for another amino acid having the same characteristic. Acidic amino acids include aspartate and glutamate; basic amino acids include histidine, lysine and arginine; aliphatic amino acids include isoleucine, glycine, leucine and valine; aromatic amino acids include phenylalanine, tyrosine and tryptophan; polar amino acids include aspartate, glutamate, histidine, lysine, asparagine, glutamine, arginine, serine, threonine and tyrosine; hydrophobic amino acids include alanine, cysteine, phenylalanine, glycine, isoleucine, leucine, methionine, proline, valine, tyrosine and tryptophan; and hydrophilic amino acids include asparagine, aspartate, glutamine, glutamate, histidine, serine and threonine. Amino acids may also be described in terms of relative size, alanine, cysteine, aspartate, glycine, asparagine, proline, threonine, serine, valine, all typically considered to be small. [0063] Percent identity is determined by comparison of amino acid or nucleic acid sequences, including a reference sequence and a putative homologue sequence. Algorithms used for determination of percent identity illustratively include the algorithms of S. Karlin and S. Altshul, PNAS, 90:5873-5877, 1993; T. Smith and M. Waterman, Adv. Appl. Math. 2:482-489, 1981, S. Needleman and C. Wunsch, J. MoI. Biol, 48:443-453, 1970, W. Pearson and D. Lipman, PNAS, 85:2444-2448, 1988 and others incorporated into computerized implementations such as, but not limited to, GAP, BESTFIT, FASTA, TFASTA; and BLAST, publicly available from the National Center for Biotechnology Information, for instance at http://www.ncbi.nlm.nih.gov. Sialoadhesin Binding Moiety
[0064] A sialoadhesin binding moiety binds specifically to sialoadhesin. The term "binds specifically"
as used herein is intended to indicate that a sialoadhesin binding moiety included in an inventive conjugate interacts preferentially with sialoadhesin and does not significantly interact with other proteins or other molecules. A sialoadhesin binding moiety conjugated to a cargo moiety has sialoadhesin-specific binding activity and thus confers sialoadhesin-specific binding activity on an inventive conjugate. In particular, a sialoadhesin binding moiety conjugated to a cargo moiety binds to an extracellular portion of sialoadhesin expressed by a cell. Further, a sialoadhesin binding moiety binds specifically with sialoadhesin present in the cell membrane of a target cell and stimulates uptake of an inventive conjugate into the cell [0065] In one embodiment, a sialoadhesin binding moiety is an antibody. The term "antibody" refers to polyclonal antibodies, monoclonal antibodies (mAbs), chimeric antibodies, humanized antibodies, as well as antigen binding antibody fragments and molecules having antigen binding functionality.
[0066] The term "antibody" includes an intact immunoglobulin having four polypeptide chains, two heavy (H) chains and two light (L) chains linked by disulfide bonds. The term "antibody" also includes sialoadhesin binding antibody fragments illustratively including, but not limited to, such fragments as an Fab fragment, an Fab' fragment, an F(ab')2 fragment, an Fd fragment, an Fv fragment, an scFv fragment, and a domain antibody (dAb).
[0067] An anti-sialoadhesin antibody and/or sialoadhesin binding antibody fragment included in a conjugate of the present invention is capable of binding sialoadhesin and stimulating uptake of the conjugate into the cell. [0068] An antibody or antibody fragment included in a conjugate according to the invention specifically binds to sialoadhesin. A preferred sialoadhesin binding moiety binds sialoadhesin with greater affinity than it binds another member of the Siglec family.
[0069] A preferred sialoadhesin binding moiety included in an inventive conjugate is characterized by specific binding activity for sialoadhesin of at least about IxIO 5 M "1 . In further embodiments, a preferred sialoadhesin binding moiety has a specific binding affinity for sialoadhesin of at least about IxIO 6 M "1 . In still further embodiments, a preferred sialoadhesin binding moiety has a specific binding affinity for sialoadhesin of at least about IxIO 7 M "1 .
[0070] Anti-sialoadhesin antibodies and sialoadhesin binding antibody fragments may be provided by any method, illustratively including, but not limited to, immunization, isolation and purification, enzymatic cleavage of an intact immunoglobulin, chemical synthesis of a desired sialoadhesin binding peptide or protein, production by recombinant nucleic acid technology. Combinations of such methods may also be used.
[0071] An anti-sialoadhesin antibody can be made by immunization using as an antigen a full length sialoadhesin or a peptide fragment of sialoadhesin. Such proteins and peptides may be, illustratively a human, pig, sheep, rat, mouse, or other sialoadhesin protein or peptide. Exemplary human, mouse and porcine sialoadhesin protein sequences and nucleic acid sequences encoding human, mouse and porcine
sialoadhesins included herein as SEQ ID No. 5, SEQ ID No. 6, SEQ ID No. 7, SEQ ID No. 8, SEQ ID No. 9, and SEQ ID No. 10.
[0072] Extracellular portions of sialoadhesin from various species have been characterized, as have sialic acid binding sites, as exemplified in Nath, D. et al, J. Biol. Chem., 270:26184-26191, 1995; Vinson, M. et al., J. Biol. Chem., 271:9267-9272, 1996; Hartnell, A. et al., Blood, 97:288-296; and Vanderheijden, N. et al., 2003, J. Virol. 77:8207-15. For example, an extracellular portion of human sialoadhesin extends from amino acid 1 -1642, an extracellular portion of porcine sialoadhesin extends from amino acid 1 - 1643 and an extracellular portion of mouse sialoadhesin extends from amino acid 1 -1638, each with reference to the sequences described herein. A sialoadhesin fragment used as an antigen in preparation of a sialadhesin binding antibody preferably includes one or more Ig-like domains.
[0073] Antigens may be prepared by any of various methods, including isolation from natural sources, recombinant production or by chemical synthetic techniques. Sialoadhesin proteins and peptides for use as antigens in preparation of a sialadhesin binding antibody are similarly prepared by any of various techniques. [0074] A peptide portion of a sialoadhesin or other antigen may be made more immunogenic if desired by linkage to a carrier molecule such bovine serum albumin or keyhole limpet hemocyanin. Such a linkage may be accomplished by any of various techniques, illustratively including, but not limited to, conjugation and expression of a fusion protein. [0075] Recombinantly expressed proteins and peptides, such as, but not limited to, sialoadhesin and sialoadhesin fragments, may be tagged to allow for easier isolation. For instance, such proteins and peptides may be Fc-tagged.
[0076] Antibodies, antigen binding fragments and methods for their generation are known in the art and such antibodies, antigen binding fragments and methods are described in further detail, for instance, in Antibody Engineering, Kontermann, R. and Dubel, S. (Eds.), Springer, 2001; Harlow, E. and Lane, D., Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, 1988; Ausubel, F. et al., (Eds.), Short Protocols in Molecular Biology, Wiley, 2002, particularly chapter 11; J. D. Pound (Ed.) Immunochemical Protocols, Methods in Molecular Biology, Humana Press; 2nd ed., 1998; B.K.C. Lo (Ed.), Antibody Engineering: Methods and Protocols, Methods in Molecular Biology, Humana Press, 2003 ; and Kohler, G. and Milstein, C, Nature, 256:495-497 (1975). [0077] The term "antigen" in the context of making a sialoadhesin binding moiety refers to sialoadhesin or an antigenic peptide portion thereof. In a particular embodiment, an antigenic portion of sialoadhesin includes a portion of sialoadhesin present external to a cell expressing sialoadhesin. Such a portion preferably includes a sialic acid binding domain. [0078] An antibody which is a sialoadhesin binding moiety may be made using a native sialoadhesin, such as exemplified by amino acid sequences appended hereto, and/or peptide fragments thereof, as an
antigen. An antibody which is a sialoadhesin binding moiety may be also be made using a sialoadhesin homologue, modified sialoadhesin and/or fragment thereof as an antigen.
[0079] In a specific embodiment, a sialoadhesin binding moiety is a monoclonal antibody 41D3. Monoclonal antibody 41D3 (mAb 41D3) is a mouse monoclonal anti-porcine sialoadhesin antibody. Monoclonal antibody 41D3 is described in Vanderheijden, N. et al., 2003, J Virol 77:8207-15 ; and in Duan, X. et al., 1998, J Virol 72:4520-3. A hybridoma producing monoclonal antibody 41D3 was deposited with the CNCM (Collection Nationale de Cultures de Microorganisms) at the Institute Pasteur, 28, Rue du Docteur Roux, F-75724 Paris Cedex 15and given Accession number 1-2719. [0080] In a further specific embodiment, a sialoadhesin binding moiety is mouse monoclonal antibody 7D2 (mAb 7D2) which binds human sialoadhesin. MAb 7D2 was raised against an Fc fusion protein containing the N-terminal four domains of human sialoadhesin. MAb 7D2 is further described in Hartnell, A. et al., Blood, 97:288-96, 2001 and is commercially available.
[0081] Another specific example of a sialoadhesin binding moiety is mouse anti-porcine sialoadhesin monoclonal antibody MCA2316 described, for example, in Bullido, R., Tissue Antigens, 1997, 49(4):403- 13 and commercially available.
[0082] A sialoadhesin binding moiety is a sialoadhesin ligand in a further embodiment of a conjugate composition according to the present invention. As noted above, sialoadhesin is a sialic acid-binding immunoglobulin-like lectin. Sialoadhesin binds sialic acid, and in particular, α2-3 sialic acid residues and some α2-6 and α2-8 sialic acid residues. Such sialic acid residues illustratively include Siaα2-3Galβl- 3GaINAc; Siaα2-3Galβl-3GlcNAc; and Siaα2-3Galβl -4GIcNAc, Siaα2-6Galβl -3GaINAc and Siaα2- 8Neu5Acα2-3Galβl-3GalNAc. Thus, in an embodiment in which a sialoadhesin binding moiety is a sialoadhesin ligand, a sialoadhesin binding moiety preferably includes a sialylated organic structure such as, but not limited to, a sialylated protein or peptide, lipid, and/or carbohydrate. [0083] In a further embodiment, a sialoadhesin binding moiety includes a natural sialylated ligand for sialoadhesin. A natural sialylated ligand for sialoadhesin is a sialylated structure which occurs naturally and binds sialoadhesin in vivo. Natural sialylated ligands illustratively include CD43, galactose-type C- type lectin 1, and MUCl antigen. A natural sialylated ligand of sialoadhesin may be isolated from a natural source or recombinantly produced for inclusion in a conjugate composition according to the present invention. [0084] A further natural sialoadhesin ligand is a porcine arterivirus protein. Cargo Moiety
[0085] As noted above, a conjugate composition according to the present invention includes a sialoadhesin binding moiety and a cargo moiety. A cargo moiety is a substance to be delivered to a target cell. [0086] In one embodiment, a cargo moiety is a stimulator of a response in a target cell. For instance, a
cargo moiety is optionally a stimulator of an immune response in a macrophage. A cargo moiety may also be a stimulator of nitric oxide production in a target cell.
[0087] Examples of cargo moieties which are macrophage stimulators illustratively include interleukin-4, interleukin-10, interleukin-13, macrophage stimulating protein, CD40 ligand, and interferon- gamma. Additional stimulators include lipoteichoic acid, muramyl tripeptide TNF-alpha, GM-CSF, a lipopolysaccharide and an extracellular matrix protein.
[0088] In a particular example, a cargo moiety which is a stimulator of an immune response is an antigen. An antigen included in an inventive conjugate may be any type of antigen, illustratively including, but not limited to, a peptide, a protein, a lipid, a carbohydrate, and combinations of these or other antigenic substances. An antigen may be derived from any source and thus may be an isolated natural substance, a recombinantly produced substance, a chemically synthesized substance, or otherwise provided. The identity of the antigen will depend on the desired result. In general, an antigen is included as a cargo moiety to be delivered to an antigen presenting cell in order to stimulate the immune system of a subject to produce an immune response to the antigen. [0089] In a specific embodiment, an antigen included as a cargo moiety is a porcine arterivirus peptide or protein.
[0090] Also provided is a conjugate including a cargo moiety which is an inhibitor of a target cell. Exemplary inhibitors include inhibitors of macrophage activation, inhibitors of inflammation and general cell inhibitors. [0091] Inhibitors of macrophage activation and inflammation are useful as cargo moieties to decrease macrophage activation and inflammation where problematic, such as in autoimmune diseases illustratively including, but not limited to, endotoxemia, multiple sclerosis, rheumatoid arthritis, and lupus erythematosus. Inhibitors of macrophage activation and inflammation include anti-inflammatory cytokines and anti-inflammatory compounds such as, but not limited to, IL-10, TGF-beta, 6-(methylsulfinyl)hexyl isothiocyanate, and sesquiterpene chromones including those isolated from Ferula fukanensis.
[0092] In a further embodiment, a cargo moiety which is an inhibitor of a target cell is a cytotoxic agent. A cytotoxic agent may be included in an inventive conjugate for delivery to a cell in order to inhibit or destroy the cell. For example, a macrophage may be targeted for inhibition of destruction by a cytotoxic agent in order to inhibit a macrophage activity, such as an inflammatory activity. In a further example, a cytotoxic agent is delivered to a sialoadhesin expressing cell in order to inhibit a microbial infection. A cytotoxic agent may be any cytotoxic agent which can be conjugated with a sialoadhesin binding moiety to produce a conjugate according to the invention.
[0093] Exemplary cytotoxic cargo moieties are drugs used as anti-tumoral agents. Anti-tumoral agents are described, for example, in Goodman et al., Goodman and Gilman's The Pharmacological Basis of Therapeutics, 8th Ed., Macmillan Publishing Co., 1990.
[0094] Such drugs illustratively include acivicin, aclarubicin, acodazole, acronine, adozelesin, aldesleukin, alitretinoin, allopurinol, altretamine, ambomycin, ametantrone, amifostine, aminoglutethimide, amsacrine, anastrozole, anthramycin, arsenic trioxide, asparaginase, asperlin, azacitidine, azetepa, azotomycin, batimastat, benzodepa, bicalutamide, bisantrene, bisnafide dimesylate, bizelesin, bleomycin, brequinar, bropirimine, busulfan, cactinomycin, calusterone, capecitabine, caracemide, carbetimer, carboplatin, carmustine, carubicin, carzelesin, cedefingol, celecoxib, chlorambucil, cirolemycin, cisplatin, cladribine, crisnatol mesylate, cyclophosphamide, cytarabine, dacarbazine, dactinomycin, daunorubicin, decitabine, dexormaplatin, dezaguanine, dezaguanine mesylate, diaziquone, docetaxel, doxorubicin, droloxifene, droloxifene, dromostanolone, duazomycin, edatrexate, eflomithine, elsamitrucin, enloplatin, enpromate, epipropidine, epirubicin, erbulozole, esorubicin, estramustine, estramustine, etanidazole, etoposide, etoposide, etoprine, fadrozole, fazarabine, fenretinide, floxuridine, fludarabine, fluorouracil, flurocitabine, fosquidone, fostriecin, fulvestrant, gemcitabine, gemcitabine, hydroxyurea, idarubicin, ifosfamide, ilmofosine, interleukin II (IL-2, including recombinant interleukin II or rIL2), interferon alfa- 2a, interferon alfa-2b, interferon alfa-nl, interferon alfa-n3, interferon beta-I a, interferon gamma-I b, iproplatin, irinotecan, lanreotide, letrozole, leuprolide, liarozole, lometrexol, lomustine, losoxantrone, masoprocol, maytansine, mechlorethamine hydrochlride, megestrol, melengestrol acetate, melphalan, menogaril, mercaptopurine, methotrexate, methotrexate, metoprine, meturedepa, mitindomide, mitocarcin, mitocromin, mitogillin, mitomalcin, mitomycin, mitosper, mitotane, mitoxantrone, mycophenolic acid, nelarabine, nocodazole, nogalamycin, ormnaplatin, oxisuran, paclitaxel, pegaspargase, peliomycin, pentamustine, peplomycin, perfosfamide, pipobroman, piposulfan, piroxantrone hydrochloride, plicamycin, plomestane, porfimer, porfiromycin, prednimustine, procarbazine, puromycin, puromycin, pyrazofurin, riboprine, rogletimide, safingol, safingol, semustine, simtrazene, sparfosate, sparsomycin, spirogermanium, spiromustine, spiroplatin, streptonigrin, streptozocin, sulofenur, talisomycin, tamoxifen, tecogalan, tegafur, teloxantrone, temoporfin, teniposide, teroxirone, testolactone, thiamiprine, thioguanine, thiotepa, tiazofurin, tirapazamine, topotecan, toremifene, trestolone, triciribine, trimetrexate, triptorelin, tubulozole, uracil mustard, uredepa, vapreotide, verteporfin, vinblastine, vincristine sulfate, vindesine, vindesine, vinepidine, vinglycinate, vinleurosine, vinorelbine, vinrosidine, vinzolidine, vorozole, zeniplatin, zinostatin, zoledronate, and zorubicin. A cytotoxic cargo moiety may also be a pharmaceutically acceptable salts, esters, amides, hydrates, and/or prodrug of any of these or other cytotoxins. [0095] In a further specific example, a cytotoxic cargo moiety is the cytotoxic ribosome-inactivating protein saporin.
[0096] In some embodiments, a toxic agent may be included to inhibit or destroy a pathological microbial organism associated with the cell. For example, bacteria, viruses and protozoa are known to be sequestered within certain cells. Pathogens, illustratively including, but not limited to, Trypanosoma cruzi, Mycobacterium tuberculosis, Salmonella sp., Neisseria meningitidis, HIV, and Ross River virus, can hide in macrophages from the host's immune system and thereby cause persistent infections as described in
Aquaro, S., et al., 2002, Antiviral Res 55:209-25; Brodsky, I. E., et al., 2005, MoI Microbiol 55:954-72; Jones, C, et al., 2003, MoI Microbiol 49:1213-25 ; Monack, D. M., et al., 2004, J Exp Med 199:231-41; Monteiro, V. G., et al., 2005, Parasitol Res 97:380-5; Rengarajan, J., et al., 2005, Proc Natl Acad Sci U S A 102:8327-32; and Way, S. J., et al., 2002, Virology 301:281-92. A fungus is a further example of a pathogen which may be present in a host immune system. Thus, in one embodiment of a conjugate composition according to the present invention, a toxic agent effective to inhibit an organism is a cargo moiety delivered to a cell infected by the organism. Such toxic agents illustratively include an antibacterial agent, an antiviral agent, an antifungal agent and an antiprotozoal agent. [0097] Specific examples of antibacterial agents include tetracyclines such as, but not limited to, doxycycline, tetracycline oxytetracycline, demeclocycline, and minocycline; beta-lactams such as, but not limited to, penicillins and cephalosporins; aminoglycosides such as, but not limited to, gentamycin, neomycin and streptomycin; macrolides such as, but not limited to, azithromycin, clarithromycin, lincomycin and erythromycin; nitroimidazoles such as, but not limited to, metronidazole and tinidazole; quinolones such as, but not limited to, cinoxacin, ciprofloxacin, norfloxacin, ofloxacin, and levofloxacin; rifampin, vancomycin, and clindamycin.
[0098] Specific examples of antiviral agents include abacavir, acyclovir, amprenavir, aplaviroc, atazanavir, brecanavir, darunavir, delavirdine, dexelvucitabine, didanosine, disoproxil, efavirenz, emtricitabine, enfuvirtide, etravirine, famciclovir, fosamprenavir, ganciclovir, indinavir, lamivudine, lopinavir, maraviroc, nelfinavir, nevirapine, ritonavir, saquinavir, stavudine, tenofovir fumarate, tipranavir, vicriviroc, zalcitabine, and zidovudine.
[0099] Specific examples of antiprotozoal agents include azanidazole, chloroquine, metronidazole, nimorazole, ornidazole, secnidazole, sinefungin, tenonitrozole, temidazole, tinidazole. [00100] Examples of antifungal agents include azoles illustratively including, but not limited to, miconazole, ketonazole, itraconazole, fluconazole, voriconazole, posaconazole, ravuconazole, terconazole, clotrimazole, sertaconazole, econazole, and fenticonazole; and polyenes illustratively including, but not limited to, natamycin, filipin, nystatin and amphotericin B.
[00101] A cargo moiety is a nucleic acid in particular embodiments. A cargo nucleic acid may be DNA, RNA, a polynucleotide, an oligonucleotide, an antisense polynucleotide or oligonucleotide, or siRNA for example. The nucleic acid may encode a protein or peptide, such as an mRNA. A cargo nucleic acid may be linear, circular, supercoiled, single stranded, or double, triple or quadruple stranded
[00102] In particular embodiments, a cargo nucleic acid includes an expression construct. Delivery of a conjugate including a sialoadhesin binding moiety and a cargo nucleic acid expression construct to a cell expressing sialoadhesin allows expression of an expression construct encoded protein or peptide in the cell. [00103] In further embodiments, a cargo moiety which is an inhbitor or stimulator of a target cell may be a nucleic acid. A nucleic acid inhibitor may encode an inhibitor or stimulator for example.
Alternatively, the nucleic acid itself may act as a stimulator or inhibitor.
[00104] A nucleic acid cargo is an inhibitor in one embodiment, delivered to a sialoadhesin expressing cell in order to inhibit expression of a protein, and/or transcription and/or translation of a nucleic acid. Illustrative examples of nucleic acid inhibitors include siRNA, an antisense polynucleotide, an antisense oligonucleotide, and a ribozyme. Nucleic acid inhibitors may contain naturally occurring nucleic acids and/or may contain modified nucleic acids such as, but not limited to, phosphorothioates. [00105] Preparation of nucleic acid inhibitors such as these are known in the art, as described for example in Crooke, S. T., Antisense Drug Technology: Principles, Strategies, and Applications, CRC Press, 2001; and Engelke, D., RNA Interference (RNAi): The Nuts & Bolts of siRNA Technology, DNA Press, 2004.
[00106] A nucleic acid inhibitor is delivered to inhibit a desired target in a sialoadhesin expressing cell in vitro, ex vivo and/or in vivo, particularly a macrophage. For example, a nucleic acid inhibitor of function or synthesis of a microbial protein or nucleic acid infecting the sialoadhesin expressing cell is delivered to inhibit microbial infection. [00107] In a further example, a nucleic acid inhibitor is delivered to inhibit a process or function of the sialoadhesin expressing cell. For example, it may be desired to inhibit or eliminate a cell expressing sialoadhesin. Inflammation and/or macrophage activation are processes or functions of a sialoadhesin expressing cell that may be inhibited. An inhibitory nucleic acid cargo, such as a nucleotide analog, may be delivered to inhibit or eliminate such a cell. [00108] A nucleic acid cargo is a stimulator in one embodiment, delivered to a sialoadhesin expressing cell in vitro, ex vivo and/or in vivo in order to stimulate a process or function of the sialoadhesin expressing cell. For example, a nucleic acid cargo includes a plasmid encoding a peptide or protein to which an immune response is desired. The plasmid cargo is delivered to a sialoadhesin expressing macrophage in an organism wherein the peptide or protein is produced and stimulates an immune response. [00109] A plasmid encoding a peptide or protein is preferably an expression construct containing a nucleic acid encoding the peptide or protein along with one or more regulatory nucleic acid sequences required or desirable for expression of the peptide or protein. Such regulatory sequences illustratively include a promoter, an enhancer, a splicing signal, a transcription start site, a transcription termination signal, a polyadenylation signal, an internal ribosome entry site (IRES) and combinations thereof. Suitable promoters include constitutively active promoters, inducible promoters and cell-type specific promoters. [00110] A nucleic acid cargo may be conjugated to a sialoadhesin binding moiety directly or indirectly. [00111] For example, a nucleic acid may be conjugated to a sialoadhesin binding moiety forming a bond between the nucleic acid and the sialoadhesin binding moiety. For example, a carbodiimide, such as l-ethyl-3-[3-dimethylaminopropyl]carbodiimide hydrochloride (EDC), may be used to form a phosphate ester with a 5 ' terminal phosphate group present on a nucleic acid and then coupled with an amine group of
a sialoadhesin binding moiety to produce a conjugate including a phosphoramidate linkage. [00112] In a further embodiment, a nucleic acid is indirectly conjugated to a sialoadhesin binding moiety, such as through a linker or other molecule. For example, a sialoadhesin binding moiety may be conjugated to a positively charged protein. The positively charged protein may be brought into contact with a nucleic acid to allow charge-based bonding between the positively charged protein and the negatively charged nucleic acid. Examples of positively charged proteins in this context include protamine and polylysine.
[00113] A cargo moiety optionally includes a microorganism and/or an antigenic molecule derived from such an organism. For example, a cargo moiety may be a virus, a bacterium, a protozoan, and/or an antigenic molecule derived from such an organism. A microorganism included in such a conjugate is preferably killed or inactivated.
[00114] In a preferred embodiment, a viral cargo moiety is an intact virus or portion thereof conjugated to a sialoadhesin binding antibody. Such a virus may be any type of virus, including viruses useful in stimulating an antigenic response to the virus. [00115] In particular embodiments, a virus included in a conjugate as a cargo moiety is a swine viral disease virus. Swine viral disease viruses include Porcine Reproductive and Respiratory Syndrome virus (PRRSV), Porcine circovirus type 2, Parvovirus and Pseudorabies virus. In particular embodiments, a swine viral disease virus is included as a cargo moiety in a conjugate according to the present invention for administration to stimulate an immune response to the virus. A particular swine viral disease virus protein or antigenic portion of a swine viral disease virus protein is included in a conjugate according to the present invention as a cargo moiety in particular embodiments. For example, a PRRSV membrane protein GP3, GP4, GP5 or Matrix (M) and/or an antigenic portion thereof is a cargo moiety in some embodiments of an inventive conjugate. In further embodiments, a cargo moiety is a Porcine circovirus type 2 Capsid protein (CAP), a Parvovirus Capsid protein VP2 and/or a Pseudorabies virus gB, gC and/or gD protein, and/or an antigenic portion thereof. A combination of viral proteins and/or antigenic portions thereof is optionally included as a cargo moiety in embodiments of a conjugate of the present invention. [00116] PRRSVs are exemplified by European type PRRSV Lelystad virus, Accession No.
M96262 and American type PRRSV VR-2332, Accession No. U87392. [00117] In further embodiments, a virus included in a conjugate as a cargo moiety is a human viral disease virus. Human viral disease viruses Herpes simplex virus type 1, Herpes simplex virus type 2, Varicella Zoster Virus, Cytomegalovirus, Measles virus, Mumps virus, Rubella virus, Hepatitis A virus, Hepatitis B virus, Hepatitis C virus, Human immunodeficiency virus (HIV), Poliovirus, Human papillomavirus, and Coronaviruses. In particular embodiments, a human viral disease virus is included as a cargo moiety in a conjugate according to the present invention for administration to stimulate an immune response to the virus. A particular human viral disease virus protein or antigenic portion of a human viral disease virus protein is included in a conjugate according to the present invention as a cargo moiety in
particular embodiments. For example, a cargo moiety is optionally a Herpes simplex virus type 1 gB, gC and/or gD protein; a Herpes simplex virus type 2 gB, gC and/or gD protein; a Varicella Zoster Virus gH:gL complex, gB, and/or gC protein; a Cytomegalovirus gM:gN complex and/or gB protein; a Measles virus Hemagglutinin protein (H) and/or fusion protein (F); a Mumps virus Hemagglutinin-Neuraminidase protein (HN) and/or fusion protein (F); a Rubella virus Envelope protein El and/or E2; a Hepatitis A virus Capsid protein VPl and/or VP2; a Hepatitis B virus Envelope protein S, M, L and/or HbsAb; a Hepatitis C virus Envelope glycoproteins El and/or E2; a Human immunodeficiency virus (HIV) gpl20; a Poliovirus VPl, VP2 and/or VP3 protein; a Human papillomavirus Ll protein; a Coronavirus spike protein, such as, but not limited to, SARS Coronavirus Spike protein (S); and/or an antigenic portion of any of these. In particular embodiments, Human papillomavirus Ll protein is a Human papillomavirus type 16, 18, 6 and/or 11 Ll protein and/or an antigenic portion thereof. A combination of viral proteins is optionally included as a cargo moiety in embodiments of a conjugate of the present invention.
[00118] Influenza viruses are a major cause of human and animal disease. Influenza viruses are classed and named according to the specific characteristics of two proteins on the surface of the virus, haemagglutinin (also called hemagglutinin) and neuraminidase. At least sixteen different influenza virus subtypes have been identified according to haemagglutin protein characteristics. These subtypes are called Hl, H2, H3, H4, H5, H6, H7, H8, H9, HlO, HI l, H12, H13, H14, H15 and H16. Numerous influenza virus strains of each subtype have been identified and many have been characterized by nucleic acid sequencing and/or protein sequencing of the viral glycoprotein haemagglutinin. Nucleotide and protein sequences of the influenza virus protein haemagglutinin are known in the art and are available to the public via the National Center for Biotechnology Information (NCBI) Entrez protein and nucleotide search and retrieval system which have been compiled from a variety of sources, including GenBank, RefSeq, and PDB, and including SwissProt, PIR, PRF, PDB, genpept and translations from annotated coding regions in GenBank and RefSeq under accession numbers included herein. The protein and nucleic acid sequences associated with the accession numbers included herein characterize influenza virus haemagglutinins suitable for inclusion as a cargo moiety in conjugates according to the present invention. [00119] In particular, protein sequences of influenza virus subtype Hl haemagglutinin suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI) Entrez protein search and retrieval system:
[00120] AAF87274; AAF87282; AAF87284; AAN64900; AAN64902; AAN83988; AAQ10372; AAQ10387; AAQ10394; AAT81327; AAT81329; AAT81330; AAT81336; AAT81338; ABB19551; ABB19618; ABB79979; ABC02277; ABD62781; ABD94965; ABD95075; ABD95152; ABD95229; ABD95284; ABD95306; ABF47869; ABF82896; ABG66974; ABI21200; ABI21222; ABJ09327; ABK40028; ABO21716; ABO21724; ABO32992; ABP49327; ABP49382; ABP49481; BAE53729; BAE96533; BAE96534; BAE96536; BAF03629; CAA40728; AAF87278; AAF87279; AAF87280;
AAF87281; AAN64903; AAN64904; AAN64905; AAQ10390; AAQ10391; AAR90881; AAT81331;
AAT81332; AAT81333; AAT81334; AAT81335; AAT93388; AAY56898; ABA43189; ABB19562;
ABB21772; ABC86237; ABD61518; ABD62843; ABD79255; ABD94987; ABD95240; ABD95251;
ABD95273; ABF47891; ABF82662; ABF82684; ABF82841; ABF82863; ABF82918; ABI84478; ABI84948; ABI93028; ABJ16686; ABK40006; ABK40557; ABN50917; ABN51066; ABN51O88;
ABO21709; ABO21723; CAA40730; CAA86563; CAA91082; AAA16808; AAA16813; AAA16880;
AAA19935; AAA43142; AAA43153; AAA43168; AAA43170; AAA43171; AAA43175; AAA43231;
AAA43240; AAC57415; AAK40318; AAK51344; AAK51345; AAK51347; AAN46827; AAN64894;
AAN64896; AAP69688; AAP69691; AAP79971; AAU09400; ABA08519; ABA42247; ABB03123; ABB04972; ABB80045; ABB84190; ABB86887; ABD77675; ABD78071; ABD94789; ABE12248;
ABF47693; ABG72868; ABG72869; ABG79952; ABI54437; ABI54444; ABI54445; ABO21730;
ABO21731; ABO33006; ABO52038; ABO52258; ABP49305; ABP49360; BAF31892; CAA86560;
CAA86561; CAA86562; CAC18524; AAA43158; AAA43169; AAA43173; AAA43176; AAA43190;
AAA43194; AAA43225; AAA43232; AAA43283; AAK40314; AAK40315; AAK51348; AAN64897; AAN64898; AAN64899; AAP79977; AAX56530; AAZ79549; ABA08497; ABA12707; ABA42258;
ABB51962; ABB53603; ABB82194; ABB82205; ABB82216; ABB86877; ABB86917; ABB86929;
ABB86937; ABB86946; ABC40522; ABD77708; AAA43661; AAA43680; AAF06945; AAF06946;
AAF87275; AAF87276; AAF87283; AAN64901; AAQ10369; AAQ10373; AAQ10380; AAQ10385;
AAQ10386; AAQ1O388; AAQ10395; AAQ10396; AAT81328; AAT81337; AAT81339; AAT81340; AAT85679; ABA12729; ABB19571; ABB19607; ABB19628; ABB20429; ABB79990; ABC40631;
ABD61540; ABD61735; ABD62061; ABD79101; ABD85261; ABD95053; ABD95064; ABD95086;
ABD95163; ABD95218; ABD95295; ABF71860; ABF82852; ABF82874; ABF82885; ABF82907;
ABI92379; AB 196088; ABI96091; AB 196093; ABI96097; AB 196098; ABI96101; AB 196107; ABI96108;
ABI96111; ABJ09151; ABJ53493; ABK40510; ABK40579; ABK40601; ABM22246; ABO38384; ABO38406; BAA96109; BAA96114; BAA96115; BAA96122; BAA96124; BAA96125; CAA35094;
AAA58799; AAA588O1; AAA65544; AAA65546; AAA65551; AAA65553; AAA65554; AAA74285;
AAA74289; AAA74291; AAA74293; AAA74299; AAA91616; AAA92279; AAB03291; AAB27052;
AAB29091; AAB39351; AAB50958; AAB50966; AAG22555; ABD77917; ABD77928; ABD77950;
ABD78038; ABD94778; ABE12634; ABE26991; ABF47583; ABG48049; ABG72867; AB 120826; ABI51313; AB 154438; ABI84617; AB 192302; ABI95250; AB 196094; ABI96095; AB 196096; ABI96104;
ABI96105; ABI96106; ABJ53427; ABJ53504; ABK40689; ABM22224; ABO38318; ABO38340;
ABO44046; BAA96111; BAA96112; BAA96117; BAA96118; BAA96121; BAA96126; BAA96127;
BAA96128; BAA96131; BAF47397; AAA65547; AAA65548; AAA65549; AAA65550; AAA65556;
AAA65557; ABG37362; ABG66973; ABG66975; ABI21211; AB 121233; ABJ16609; ABM21960; ABM66864; ABN50928; ABN51077; ABN59423; ABN59434; ABO21725; ABO52104; ABP49316;
ABP49338; ABP49349; BAE53730; BAE96535; BAE96537; BAE96541; BAE96542; BAF03627;
CAA40729; CAA82950; CAA91083; AAA16779; AAA16809; AAA16812; AAA16879; AAA16905;
AAA43161; AAA43167; AAA43172; AAA43206; AAA43209; AAA43233; AAA43234; AAA43238;
AAC53845; AAC53846; AAC57166; AAK40317; AAK51342; AAK51343; AAK51346; AAF06947;
AAF75994; AAF80098; AAF80099; AAF87277; AAQ10367; AAQ10368; AAQ10389; AAQ10392; AAQ10393; AAZ38627; ABA42575; ABB19574; ABB19667; ABD63063; ABD79112; ABD85123;
ABD94976; ABD94998; ABD95130; ABD95141; ABD95262; ABF47880; ABF82673; ABF82819;
ABF82830; ABF82929; ABG66976; ABG66977; ABG88344; ABK39995; ABK40534; ABK40546;
ABK40568; ABN50756; ABN50900; ABO33025; ABO52280; ABP49393; ABP49448; BAE96538;
BAE96539; BAE96540; CAA40731; CAA42444; AAL60444; AAL87869; AAL87871; AAM76686; AAM76689; AAM76690; AAP34322; AAP69678; AAP69679; AAP69681; AAZ74374; ABA08464;
ABA18037; ABB19518; ABB19529; ABB19540; ABC66233; ABC66236; ABD77719; ABD77807;
ABD77818; ABD77972; ABD94811; ABD95328; ABD95339; ABE11657; ABE11723; ABE11812;
ABE11922; ABE12032; ABF21277; ABG26243; ABG26791; ABG26813; ABG26824; ABG26945;
ABG67477; ABI21530; AB 121552; AB 121574; ABI22109; AB 130367; ABI96117; ABI96118; AB 196123; AAA67338; AAA72339; AAA74296; AAA74297; AAA74298; AAA79714; AAA79727; AAB03292;
AAB39352; AAB50960; AAB50961; AAB50962; AAB50963; AAB50964; AAB50965; AAL60449;
AAL87868; AAM22277; AAM22278; AAM76691; AAP34323; AAP34324; AAT65329; AAZ83977;
ABA06510; ABA42324; ABC66239; ABD78093; ABD95350; ABD95712; ABEl 1668; ABEl 1690;
ABE11834; ABE11856; ABE11878; ABE11889; ABF21278; ABF47561; ABF82940; ABG26835; ABG883OO; ABG88311; ABG88333; ABG88542; ABI85225; AAK51352; AAN64893; AAN64895;
AAP69687; AAP69692; AAP79964; AAZ79392; AAZ79538; ABA12715; ABA42280; ABB03134;
ABB03145; ABB86899; ABB86907; ABC40533; ABD77939; ABD94800; ABF47605; ABF47704;
ABG72870; ABG88256; ABI20848; ABI54442; ABI54443; ABI54446; ABI95217; ABI96089;
AB 196090; AB 196092; AB 196099; AB 196100; AB 196102; AB 196109; AB 196110; ABO38065; ABO38362; ABO38373; ABO38395; BAA96110; BAA96113; BAA96116; BAA96123; CAA24272;
CAA35097; AAA588OO; AB 196114; AB 196115; AB 196120; AB 196121; AB 196122; AB 196127;
AB 196130; ABI96137; ABI96140; ABI96141; AB 196145; AB 196146; ABI96147; AB 196150; ABK79959;
ABL67253; ABM22202; ABO37988; ABO38010; ABO38021; AAB52910; AAB81460; AAB81463;
AAD25308; AAK67319; AAK67320; AAK67325; AAK67326; AAK67327; AAK67328; AAK67335; AAK67336; AAK67337; AAK67344; AAK70451; AAK70452; AAK70453; AAK70458; AAK70459;
AAK71687; AAK73325; AAK73326; AAK73331; AAK73332; AAK73333; AAA65545; AAA65552;
AAA65555; AAA74286; AAA74290; AAA74292; AAA74300; AAA99877; AAB39851; AAB50957;
AAB50959; AAL60443; AAL87870; AAM76687; AAM76688; AAP69676; AAP69677; AAP69680;
AAP69682; ABA18145; ABB19507; ABB53729; ABB53740; ABC66234; ABC66235; ABD77730; ABD77796; ABD77961; ABD77983; ABD78082; ABD78104; ABD95317; ABE11701; ABE11712;
ABEl 1734; ABEl 1823; ABEl 1900; ABEl 1942; ABF21274; ABF21276; ABF47572; ABG26242;
ABG26244; ABG26245; ABG26780; AAK73334; AAK73341; AAK73342; AAK73343; AAK73344;
AAL29701; AAL29707; AAO65612; AAV68006; AAW50829; AAW50830; AAW50831; AAW50832;
AAY42117; AAY42118; AAY42121; AAY42122; AAZ17358; AAZ17359; AAZ79604; ABA87057;
ABB02792; ABB02814; ABB02913; ABB02936; ABB83026; ABB83127; ABC66240; ABD59849; ABD60944; ABD60955; ABD78016; ABD94756; ABD95042; ABD95119; ABD95174; ABF47638;
ABF47660; ABF47715; ABF47759; ABF47770; ABF47792; ABF47814; ABG37395; ABG47807;
ABI96124; ABI96126; ABI96134; ABI96143; ABI96144; ABI96151; ABI96153; ABK79948;
ABK80036; ABK80047; ABM22169; ABO38032; ABO52225; BAA00308; BAA00718; BAA00720;
BAA01280; BAA21641; AAB52905; AAB52907; AAB57740; AAB81456; AAB81457; AAB81459; AAC14275; AAD25304; AAD25305; AAD25307; AAK67322; AAK67324; AAK67329; AAK67332;
AAK67338; AAK67339; AAK67341; AAK67343; AAK70449; AAK70450; AAK70456; AAK73322;
AAK73324; AAK73328; AAK73330; AAK73338; AAK73340; AB 121541; AB 121563; AB 130378;
ABI85231; ABI96116; ABI96119; AB 196125; AB 196132; AB 196135; ABI96142; AB 196152; ABJ09184;
ABK80025; ABO38043; BAA00309; BAA00719; BAA02765; BAA21642; AAB52904; AAB52906; AAB52908; AAB81458; AAD05215; AAD17229; AAD25303; AAD25306; AAD25312; AAK67321;
AAK67323; AAK67330; AAK67331; AAK67333; AAK67340; AAK67342; AAK70455; AAK70457;
AAK70464; AAK73321; AAK73323; AAK73327; AAK73329; AAK73336; AAK73337; AAK73339;
AAL29694; AAK73345; AAL02002; AAL29695; AAL29702; AAL29708; AAL29710; AAL29711;
AAL47668; AAO65768; AAW50828; AAW50836; AAY42114; AAY42115; AAZ15839; AAZ15840; AAZ15842; AAZ83253; ABA87080; ABA87231; ABB03101; ABB53707; ABB83015; ABC66243;
ABC66246; ABD15515; ABD60779; ABD60856; ABD60878; ABD60900; ABD60933; ABD60966;
ABD94943; ABD95020; ABD95097; ABD95207; ABF47748; ABF47825; ABF47847; ABG8O183;
ABG88212; ABI30565; ABI55088; ABI96154; ABI96160; ABI96166; ABG47829; ABI20870;
ABI54447; AB 195272; ABI96155; AB 196156; ABI96157; AB 196162; ABI96163; AB 196171; ABI96172; ABI96173; ABJ51891; ABM22279; ABM66886; ABM66908; ABN51143; ABO32948; ABO32970;
ABO32981; BAC82844; BAC82847; BAC82848; BAC82853; BAC82854; BAC82860; BAC82869;
BAC82870; BAC82880; BAC82889; BAC82890; BAC82898; BAD02346; CAC86333; CAC86334;
CAC86621; CAD29905; CAD29906; CAD29915; CAD29916; CAD29921; CAD29922; CAD29923;
CAD29931; CAD29932; CAD29941; AAL29696; AAL29697; AAL29703; AAL29709; AAL29712; AAL29713; AAL47667; AAO88265; AAT00437; AAT00438; AAV67984; AAW22156; AAW50827;
AAW50834; AAW50835; AAW50837; AAW56635; AAY42116; AAZ15838; AAZ15841; AAZ15843;
ABA87045; ABA87091; ABB02825; ABB80103; ABB83138; ABC66244; ABC66245; ABD15258;
ABD59847; ABD60867; ABD60889; ABD60911; ABD95108; ABD95185; ABD95196; ABF47726;
ABF47737; ABF47836; ABG88201; AB 196159; AB 196161; AB 196165; AB 196167; AB 196168; ABI96169; ABI96170; ABJ51892; ABJ51894; ABJ51895; ABJ53449; ABK40634; ABK57093;
ABL67055; ABL67066; ABL67209; ABM22026; ABM22268; ABN50940; ABN50962; ABN50973;
ABO44123; BAC82843; BAC82850; BAC82851; BAC82857; BAC82859; BAC82866; BAC82867;
BAC82873; BAC82876; BAC82877; BAC82879; BAC82886; BAC82887; BAC82893; BAC82896;
BAC82897; BAD02356; CAC86337; CAC86605; CAC86608; CAC86609; CAC86617; CAC86618;
CAC86620; CAC86625; CAD29902; CAD29909; CAD29912; CAD29918; ABJ16719; ABJ51890; ABJ51893; ABK57092; ABL67187; ABM22257; ABO44134; ABP49217; BAC82842; BAC82849;
BAC82852; BAC82858; BAC82864; BAC82865; BAC82868; BAC82874; BAC82875; BAC82878;
BAC82884; BAC82885; BAC82888; BAC82894; BAC82895; CAC86336; CAC86606; CAC86607;
CAC86610; CAC86611; CAC86616; CAC86619; CAD29900; CAD29901; CAD29903; CAD29910;
CAD29911; CAD29917; CAD29919; CAD29926; CAD29927; CAD29933; CAD29936; CAD29937; CAD29939; CAD29943; CAD29946; CAD29947; CAD29924; CAD29925; CAD29928; CAD29934;
CAD29935; CAD29938; CAD29944; CAD29945; CAD29948; CAD35680; CAD35682; CAD57617;
CAD57619; CAA86567; CAA91080; CAA91081; AAA16778; AAA16810; AAA16811; AAA16814;
AAA16815; AAA19934; AAA43157; AAA43166; AAA43235; AAA43236; AAC57167; AAC57168;
AAC57169; AAK40313; AAK40316; AAK51341; AAK51349; AAK51350; AAK51351; AAN64892; AAP69685; AAP69686; AAP69689; AAP69690; AAU25851; ABA08475; ABA08486; ABAO85O8;
ABA12696; ABA42236; ABB96487; ABC41714; ABD78060; ABE27153; ABF47671; ABG72863;
ABG72864; ABG72865; ABG72866; AB 120837; AB 120859; AB 154439; ABI54440; ABI54441;
ABI84855; ABI92181; ABI92313; ABI95294; ABI96103; ABJ53438; ABJ53515; ABK40590;
ABM22213; ABM22235; ABO32678; ABO38329; ABO38351; ABO52797; BAA96119; BAA96120; BAA96129; BAA96130; AAA67181; AAA67182; AAA67183; AAA74287; AAA74288; AAA74294;
AAA74295; AAA92280; AAB39353; AAL87865; AAL87866; AAL87867; AAL87872; AAM75158;
AAP34325; AAP60036; AAP60037; AAP69673; AAP69674; AAP69675; AAP69683; AAP69684;
AAZ83299; AAZ85126; ABA06542; ABC66232; ABC66237; ABC66238; ABD77994; ABEl 1679;
ABE11845; ABE11867; ABF21272; ABG26246; ABG37120; ABG67491; ABG88322; ABG88553; AB 121519; AB 196112; ABI96113; AB 196128; ABI96129; AB 196138; ABI96139; AB 196148; ABI96149;
ABJ16675; ABK40039; ABK40050; ABK79970; ABL67264; ABM22180; ABM22191; ABN59401;
ABN59412; ABO37999; ABO38054; BAA00721; BAA00722; BAA01027; BAA02766; BAA02767;
BAA02768; BAA02769; BAA05874; BAA06719; AAB52909; AAB81461; AAB81462; AAD05216;
CAD29942; CAD35678; CAD35679; CAD35686; CAD35687; CAD35688; CAD57616; CAD57620; CAD57623; CAD35681; CAD35683; CAD35684; CAD57618; AAD05217; AAD05218; AAD05219;
AAD17218; AAD17219; AAD25301; AAD25302; AAD25309; AAD25310; AAD25311; AAK67334;
AAK70454; AAK73320; AAK73335; AAL15459; AAL29693; AAL29698; AAL29699; AAL29700;
AAL29704; AAL29705; AAL29706; AAL29714; AAL29715; AAO65769; AAT00436; AAT12706;
AAW50833; AAY42119; AAY42120; AAY78939; AAZ15844; ABB02781; ABB02803; ABB02924; ABC42750; ABC66241; ABC66242; ABD59848; ABD78005; ABD78027; ABD95009; ABD95031;
ABF47627; ABF47649; ABF47781; ABF47803; ABF47955; ABG37384; ABG47818; ABG47840;
ABG80172; AB 121189; ABI95261; ABI95283; AB 196158; ABI96164; AB 196174; ABJ16642; ABJ16653;
ABJ16664; ABJ16730; ABM22158; ABM22290; ABM66897; ABM67051; ABN50951; ABO32959;
BAC82845; BAC82846; BAC82855; BAC82856; BAC82861; BAC82862; BAC82863; BAC82871;
BAC82872; BAC82881; BAC82882; BAC82883; BAC82891; BAC82892; CAC86335; CAC86612; CAC86613; CAC86614; CAC86615; CAC86622; CAC86623; CAC86624; CAD29898; CAD29899;
CAD29904; CAD29907; CAD29908; CAD29913; CAD29914; CAD29920; CAD29929; CAD29930;
CAD29940; CAD29958; CAD35685; CAD57621 and CAD57622.
[00121] Protein sequences of influenza virus subtype H2 haemagglutinin suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI) Entrez protein search and retrieval system:
[00122] BAC43764; BAF02312; AAO46270; AAO46271; AAO46272; AAO46273; AAO46274;
AAO46275; AAO46276; AAO46277; AAO46278; AAO46279; AAO46280; AAO46281; AAO46282;
AAO46283; AAO46284; AAO46285; AAO46286; AAO46287; AAO46288; AAO46289; AAO46290; AAO46291; AAO46292; AAO46293; AAO46294; AAO46295; AAO46296; AAO46297; AAO46298;
AAO46299; AAO46300; AAO46301; AAO46302; AAO46303; AAO46304; AAO46305; AAS57527;
AAS57528; AAS57529; AAS57530; AAT65325; AAT65327; AAT65331; AAT65348; AAT65351;
AAV91219; ABB17150; ABB17670; ABB17681; ABB17692; ABB17703; ABB17714; ABB18378;
ABB17725; ABB17736; ABB17756; ABB17813; ABB18025; ABB18036; ABB18047; ABB18O58; ABB18069; ABB18O8O; ABB19639; ABB20141; ABB20229; ABB20240; ABB20466; ABB20509;
ABI84382; ABI84384; ABI84450; ABI84458; ABI84459; ABI84588; ABI84744; ABI84755; ABI84959;
ABI85183; ABL67022; ABM21949; ABO38098; ABO38296; ABO38307; ABO38701; ABO38712;
ABO38723; ABO38734; ABO44057; ABO44090; ABO44101; ABO52236; ABO52247; ABO52302;
ABO52379; ABP49437; ABP49459; ABP49470; BAA02770; BAA02771; BAA02772; BAA02773; BAA02774; BAA02775; AAY23639; AAY23640; AAY28987; AAY87410; AAY87419; ABF21270;
ABF21275; AAA43185; AAA43196; AAA43089; AAA43090; AAA43659; AAA43243; AAA43117;
AAA43284; AAA43450; AAA43096; AAA43247; AAA43248; AAA43088; AAA43345; AAA43576;
AAA43578; AAA43658; AAA43660; AAA43662; AAA43678; AAA64362; AAA64364; AAA64365;
AAA64363; AAA64366; BAF33428; BAF33438; BAF33398; BAF33408; BAF34322; BAF34377; BAF47131; BAF48641; BAF49415; AAD43235; AAD43236; AAD43237; AAD43238; AAD43239;
AAD43240; AAD43241; AAD43242; AAD43243; AAD43244; AAD43245; AAD43246; AAD43247;
AAD43248; AAD43249; AAK14980; AAF82100; AAF82101; AAF82102; AAF82103; AAF82104;
AAF82105; AAF82106; AAF82107; AAF82108; AAF82109; AAF82110; AAF82111; AAF82112;
AAN83926; AAN83927; AAN83928; AAN83929; AAN83930; AAN83931; AAO46268 and AAO46269. [00123] Protein sequences of influenza virus subtype H3 haemagglutinin suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and
are available to the public via the National Center for Biotechnology Information (NCBI) Entrez protein search and retrieval system::
[00124] BAA77284; BAA77285; BAA77286; BAA77287; BAA77288; BAA77289; BAA77290;
BAA77291; BAA77292; BAA77293; BAA77294; BAA86062; BAA86063; BAA86064; BAA86065; BAA96300; BAA96301; BAA96302; BAA96303; BAE75900; BAE75901; BAE75902; BAE75903;
BAE75904; BAE75905; BAE75906; BAE75907; BAE75908; BAE75909; BAE75910; BAE75911;
BAE75912; BAE75913; BAE75914; BAE75915; BAE75916; BAE75917; BAE75918; BAE75919;
BAE54256; BAE54257; BAE54258; BAE54259; BAE54260; BAE54261; BAE54262; BAE75854;
BAE94240; BAE94241; BAE94242; BAE94243; BAE94244; BAE94245; BAE94246; BAE94247; BAE94248; BAE94249; BAE94250; BAE94251; BAE94568; BAE94569; BAE94570; BAE96004;
BAE96005; BAE96006; BAE96007; BAF46357; BAF46358; BAF46359; BAF46360; BAF46361;
BAF46362; BAF46363; BAF46364; BAF46365; BAF46366; BAF46367; BAF46375; BAF46376;
BAF46377; BAF46378; BAF46379; BAF46380; BAF46381; BAF46382; BAF46383; BAF46384;
BAF46317; BAF46318; BAF46319; BAF46320; BAF46325; BAF46326; BAF46327; BAF46328; BAF46329; BAF46330; BAF46331; BAF46338; BAF46339; BAF46340; BAF46341; BAF46342;
BAF46343; BAF46344; BAF47998; BAF47999; BAF48000; BAF48001; BAF48002; BAF48003;
BAF48004; BAF48005; BAF48006; BAF48007; BAF48008; BAF48009; BAF48010; BAF48011;
BAF48012; BAF48013; BAF48014; BAF48015; BAF48016; BAF48017; BAF48018; BAF48019;
BAF48020; BAF48021; BAF48022; BAF48023; BAF48024; BAF48025; BAF48026; BAF48027; BAF48028; BAF48029; BAF48030; BAF48031; BAF48032; BAF48033; BAF48034; BAF48035;
BAF48036; BAF48037; BAF48038; BAF48039; BAF33059; BAF34375; BAF34924; BAF37221;
BAF43466; BAF46752; BAF46760; BAF46902; BAF46910; BAF48361; AAB66723; AAB66724;
AAB66725; AAB66726; AAB66727; AAB66728; AAB66729; AAB66730; AAB66731; AAB66732;
AAB66733; AAB66734; AAB66735; AAB66736; AAB66737; AAB66738; AAB66739; AAB66740; AAB66741; AAB66742; AAB66743; AAB66744; AAB66745; AAB66746; AAB66747; AAB66748;
AAB66749; AAB66750; AAB66751; AAB66752; AAB66753; AAB66754; AAB66755; AAB66756;
AAB66757; AAB66758; AAB66759; AAB66760; AAB66761; AAB66762; AAB66763; AAB66764;
AAB66765; AAB66766; AAB66767; AAB66768; AAB66769; AAB66770; AAB66771; AAB66772;
AAB66773; AAB66774; AAB66775; AAB66776; AAB66777; AAB66778; AAB66779; AAB66780; AAB66781; AAB66782; AAB66783; AAB66784; AAB66785; AAB66786; AAB66787; AAB66788;
AAB66789; AAB66790; AAB66791; AAB66792; AAB66793; AAB66794; AAB66795; AAB66796;
AAB66797; AAB66798; AAB66799; AAB66800; AAB66801; AAB66802; AAB66803; AAB66804;
AAB66805; AAB66806; AAB66807; AAB66808; AAB66809; AAB66810; AAB63681; AAB63682;
AAB63683; AAB63684; AAB63685; AAB63686; AAB63687; AAB63688; AAB63689; AAB63690; AAB63691; AAB63692; AAB63693; AAB63694; AAB63695; AAB63696; AAB63697; AAB63698;
AAB63699; AAB63700; AAB63701; AAB63702; AAB63703; AAB63704; AAB63705; AAB63706;
AAB63707; AAB63708; AAB63709; AAB63710; AAB63711; AAB63712; AAB63713; AAB63714;
AAB63715; AAB63716; AAB63717; AAB63718; AAB63719; AAB63720; AAB63721; AAB63722;
AAB63723; AAB63724; AAB63725; AAB63726; AAB63727; AAB63728; AAB63729; AAB63730;
AAB63731; AAB63732; AAB63733; AAB63734; AAB63735; AAB63736; AAB63737; AAB63738; AAB63739; AAB63740; AAB63741; AAB63742; AAB63743; AAB63744; AAB63745; AAB63746;
AAB63747; AAB63748; AAB63749; AAB63750; AAB63751; AAB63752; AAB63753; AAB63754;
AAB63755; AAB63756; AAB63757; AAB63758; AAB63759; AAB63760; AAB63761; AAB63762;
AAB63763; AAB63764; AAB63765; AAB63766; AAB63767; AAB69773; AAB69774; AAB69775;
AAB69776; AAB69777; AAB69778; AAB69779; AAB69780; AAB69781; AAB69782; AAB69783; AAB69784; AAB69785; AAB69786; AAB69787; AAB69788; AAB69789; AAB69790; AAB69791;
AAB69792; AAB69793; AAB69794; AAB69795; AAB69796; AAB69797; AAB69798; AAB69799;
AAB69800; AAB69801; AAB69802; AAB69803; AAB69804; AAB69805; AAB69806; AAB69807;
AAB69808; AAB69809; AAB69810; AAB69811; AAB69812; AAB69813; AAB69814; AAB69815;
AAB69816; AAB69817; AAB69818; AAB69819; AAB69820; AAB69821; AAB69822; AAB69823; AAB69824; AAB69825; AAB69826; AAB69827; AAB69828; AAB69829; AAB69830; AAB69831;
AAB69832; AAB69833; AAB69834; AAB69835; AAB69836; AAB69837; AAB69838; AAB69839;
AAB69840; AAB69841; AAB69842; AAB69843; AAB69844; AAB69845; AAB69846; AAB69847;
AAB69848; AAB69849; AAB69850; AAB69851; AAC59602; AAC59603; AAC59604; AAC63474;
AAC63475; AAC63476; AAC63477; AAC63478; AAC31556; AAC36729; AAC36730; AAC36731; AAC36732; AAC36733; AAC36734; AAC36735; AAC36736; AAC36737; AAC36738; AAC78086;
AAC78087; AAC78088; AAC78089; AAC78090; AAC78091; AAC78092; AAC78093; AAC78094;
AAC78095; AAC78096; AAC78097; AAC78098; AAC83790; AAC83791; AAC83792; AAC83793;
AAC83794; AAC83795; AAC83796; AAC83797; AAC83798; AAC83799; AAC838OO; AAF06948;
AAF06949; AAF06950; AAD34847; AAD34848; AAD34849; AAD34850; AAD34851; AAD34852; AAD34853; AAD34854; AAD34855; AAD34856; AAD34857; AAD51239; AAD51240; AAD51241 ;
AAD51242; AAF16416; AAF16417; AAF16418; AAF16419; AAF16420; AAF16421; AAF16422;
AAF16423; AAF16424; AAF16425; AAF16426; AAF16427; AAF16428; AAF16429; AAF16430;
AAF16431; AAF16432; AAF16433; AAF16434; AAF16435; AAF16436; AAF16437; AAF16438;
AAF16439; AAF16440; AAF16441; AAF16442; AAF16443; AAF16444; AAF16445; AAF16446; AAF16447; AAF16448; AAF16449; AAF16450; AAF16451; AAF16452; AAF16453; AAF16454;
AAF16455; AAF16456; AAF16457; AAF16458; AAF16459; AAF16460; AAF16461; AAF16462;
AAF16463; AAF16464; AAF16465; AAF16466; AAF16467; AAF16468; AAF16469; AAF16470;
AAF16471; AAF16472; AAF16473; AAF16474; AAF16475; AAF16476; AAF16477; AAF16478;
AAF16479; AAF16480; AAF16481; AAF16482; AAF16483; AAF16484; AAF16485; AAF16486; AAF16487; AAF16488; AAF16489; AAF16490; AAF16491; AAF16492; AAF16493; AAF16494;
AAF16495; AAF16496; AAF16497; AAF16498; AAF16499; AAF16500; AAF16501; AAF16502;
AAF16503; AAF16504; AAF16505; AAF16506; AAF16507; AAF16508; AAF16509; AAF16510;
AAF16511; AAF16512; AAF16513; AAF16514; AAF16515; AAF16516; AAF16517; AAF16518;
AAF22345; AAF22346; AAF22347; AAF22348; AAF22349; AAF22350; AAF22351; AAF22352;
AAF22353; AAF18089; AAF18090; AAF18091; AAF18092; AAF18093; AAF13705; AAF13706; AAF19421; AAL59048; AAL59049; AAL59050; AAL59051; AAO15354; AAO15355; AAO15356;
AAO15357; AAF60285; AAG01749; AAG01758; AAG01767; AAG01776; AAG01785; AAK49194;
AAK49195; AAK49196; AAK49197; AAK49198; AAK49199; AAK49200; AAK49201; AAK49202;
AAK49203; AAK49204; AAG10735; AAG10736; AAG10737; AAG10738; AAG10739; AAG10740;
AAG33221; AAG33222; AAG33223; AAG33224; AAG47797; AAG47798; AAG47799; AAG47800; AAG47801 ; AAG47802 ; AAG47803 ; AAG47804 ; AAG47805 ; AAG47806 ; AAG47807 ; AAG47808 ;
AAG47809; AAG47810; AAG47811; AAG47812; AAG47813; AAG47814; AAG47815; AAG47816;
AAG47817; AAG47818; AAG47819; AAG49302; AAG49303; AAG49304; AAG49305; AAG49306;
AAG49307; AAG49308; AAG49309; AAG49310; AAG49311; AAG49312; AAG49313; AAG49314;
AAG49335; AAG49336; AAG49337; AAG49338; AAG49339; AAK51718; AAL18558; AAL18559; AAL18560; AAL18561; AAL18562; AAL18563; AAL18564; AAL18565; AAL18566; AAL18567;
AAL18568; AAL18569; AAL18570; AAL18571; AAL18572; AAL18573; AAL18574; AAL18575;
AAL18576; AAL18577; AAL18578; AAL18579; AAL1858O; AAL18581; AAL18582; AAL18583;
AAL18584; AAL18585; AAL18586; AAL18587; AAL18588; AAL18589; AAL18590; AAL18591;
AAL18592; AAL18593; AAL18594; AAL18595; AAL18596; AAL18597; AAL18598; AAK82853; AAK82854; AAK82855; AAK82856; AAK82857; AAK82858; AAK82859; AAK82860; AAK82861 ;
AAK82862; AAK82863; AAK82864; AAK82865; AAK82866; AAK82867; AAK82868; AAK82869;
AAK52910; AAK52911; AAK52912; AAK54141; AAK54142; AAK54143; AAK54144; AAK54145;
AAK54146; AAK54147; AAK54148; AAK54149; AAK54150; AAK54151; AAK63816; AAK63817;
AAK63818; AAK63819; AAK63820; AAK63821; AAK63822; AAK63823; AAK63824; AAK63825; AAK63826; AAK67171; AAK67172; AAK67173; AAK67174; AAK67175; AAK67176; AAK67177;
AAK67178; AAK67179; AAK67180; AAK67181; AAK67182; AAK67183; AAK67184; AAK67185;
AAK67186; AAK67187; AAK67188; AAK67189; AAK67190; AAK67191; AAK67192; AAK67193;
AAK67194; AAK67195; AAK67196; AAK67197; AAK67198; AAK67199; AAK67200; AAK67201;
AAL30462; AAL30463; AAL30464; AAL60147; AAL60148; AAL60149; AAL60150; AAL60151; AAL60152; AAL60153; AAL77301; AAL77302; AAL77303; AAL77304; AAL77305; AAL77306;
AAL77307; AAL77308; AAL77309; AAL77310; AAL77311; AAL77312; AAL77313; AAL77314;
AAL77315; AAL77316; AAL77317; AAL77318; AAL77319; AAL77320; AAL77321; AAL77322;
AAL77323; AAL77324; AAL77325; AAL77326; AAL77327; AAL77328; AAL77329; AAL62329;
AAM46871; AAM46872; AAM46873; AAM46874; AAM46875; AAM46876; AAM46877; AAM46878; AAM46879; AAM46880; AAM46881; AAM46882; AAM46883; AAM46884; AAM46885; AAM46886;
AAM46887; AAM46888; AAM46889; AAM46890; AAM46891; AAM82560; AAM82561; AAM82562;
AAM88280; AAM88283; AAN01150; AAN01151; AAN01152; AAN01153; AAN01154; AAN01155;
AANOl 156; AANOl 157; AANOl 158; AANOl 159; AANOl 160; AANOl 161; AANOl 162; AANOl 163;
AANOl 164; AANOl 165; AANOl 166; AANOl 167; AAQ10355; AAQ10356; AAQ10357; AAQ10358;
AAQ10359; AAQ10360; AAQ10361; AAQ10362; AAQ10363; AAQ10364; AAQ10365; AAQ10366; AAQ10370; AAQ10371; AAQ10374; AAQ10375; AAQ10376; AAQ10377; AAQ10378; AAQ10379;
AAQ10381; AAQ10382; AAQ10383; AAQ10384; AAQ10397; AAQ10398; AAQ10399; AAQ10400;
AAQ10401; AAQ10402; CAA11167; CAA11168; CAA11169; CAA11170; CAA11171; CAA11172;
CAC81013; CAC81016; CAC81017; CAC81O18; CAC40044; CAC40045; CAC40046; CAC40047;
CAC40048; CAC40049; CAC40050; CAC40051; CAC36995; CAC37007; CAC37327; CAC86626; CAD20322; CAD20336; CAD44999; CAG27339; CAG27340; CAG27341; CAG27342; CAG28960;
CAG28961; CAG28962; CAG34129; CAH56424; CAJ32551; CAJ32558; CAD22811; CAD22818;
AAK53066; AAK62039; AAK62040; AAK62041; AAK62042; AAK62043; AAL06634; AAL06635;
AAL06636; AAL06637; AAL06638; AAN17779; AAN63953; AAN63954; AAN63955; AAN63956;
AAN63957; AAN63958; AAN83932; AAN83933; AAN83934; AAN83935; AAN83936; AAN83937; AAN83938; AAN83939; AAN83940; AAN83941; AAN83942; AAN83943; AAN83944; AAN83945;
AAN83946; AAN83947; AAN83948; AAN83949; AAN83950; AAN83951; AAN83952; AAN83953;
AAN83954; AAN83955; AAN83956; AAN83957; AAN83958; AAN83959; AAN83960; AAN83961;
AAP21996; AAP21997; AAP23238; AAQ18434; AAQ18435; AAP79943; AAP79947; AAP79953;
AAP79961; AAP79966; AAP79973; AAP79975; AAR12332; AAR12333; AAR12334; AAR12335; AAR12336; AAR12337; AAR12338; AAR12339; AAR12340; AAR12341; AAR12342; AAR12343;
AAR12344; AAR12345; AAR12346; AAR12347; AAR12348; AAR12349; AAQ86988; AAQ85O81;
AAQ85082; AAQ85083; AAQ85084; AAQ85085; AAQ85086; AAQ85087; AAQ85O88; AAQ85089;
AAQ85090; AAQ85091; AAT12703; AAT12704; AAR90879; AAQ90291; AAQ92920; AAQ92921;
AAQ92922; AAQ92923; AAQ92924; AAQ92925; AAQ92926; AAQ92927; AAQ92928; AAQ92929; AAQ92930; AAQ92931; AAR25201; AAR33033; AAT07998; AAT08000; AAT08002; AAT08004;
AAT12654; AAT12655; AAT12656; AAT12657; AAT12658; AAT12659; AAT12660; AAT12661;
AAT12662; AAT12663; AAT12664; AAT12665; AAT12666; AAT12667; AAT12668; AAT12669;
AAT12670; AAT12671; AAT12672; AAT12673; AAT12674; AAT12675; AAT12676; AAS93870;
AAS93871; AAS93872; AAS93873; AAS93874; AAS93875; AAS93876; AAS93877; AAS93878; AAS93879; AAS93880; AAS93881; AAS93882; AAS93883; AAS93884; AAT09637; AAT09638;
AAT09639; AAT81341; AAT81342; AAT81343; AAT81344; AAT81345; AAT81346; AAT81347;
AAT81348; AAT81349; AAT81350; AAT81351; AAT81352; AAT81353; AAT81354; AAT81355;
AAT81356; AAT81357; AAT81358; AAT81359; AAT81360; AAT81361; AAT81362; AAU25861 ;
AAU25871; AAT79527; AAT79528; AAT79529; AAT65319; AAT65321; AAT65324; AAT65333; AAT65334; AAT65345; AAT65349; AAT51806; AAT51807; AAT518O8; AAT51809; AAT51810;
AAT51811; AAT51812; AAT51813; AAT51814; AAT51815; AAT51816; AAT51817; AAT51818;
AAT51819; AAT51820; AAT51821; AAT51822; AAT51823; AAT51824; AAT51825; AAT51826;
AAT51827; AAT51828; AAT51829; AAT51830; AAT51831; AAT51832; AAT51833; AAT51834;
AAT51835; AAT51836; AAT51837; AAT51838; AAT51839; AAT51840; AAT51841; AAT51842;
AAT51843; AAT51844; AAT51845; AAT51846; AAT51847; AAT51848; AAT51849; AAT51850; AAT51851; AAT51852; AAT51853; AAT51854; AAT51855; AAT51856; AAT51857; AAT51858;
AAT51859; AAT64666; AAT64667; AAT64668; AAT64669; AAT64670; AAT64671; AAT64672;
AAT64673; AAT64674; AAT64675; AAT64676; AAT64677; AAT64678; AAT64679; AAT64680;
AAT64681; AAT64682; AAT64683; AAT64684; AAT64685; AAT64686; AAT64687; AAT64688;
AAT64689; AAT64690; AAT64691; AAT64692; AAT64693; AAT64694; AAT64695; AAT64696; AAT64697; AAT64698; AAT64699; AAT64700; AAT64701; AAT64702; AAT64703; AAT64704;
AAT64705; AAT64706; AAT64707; AAT64708; AAT64709; AAT64710; AAT64711; AAT64712;
AAT64713; AAT64714; AAT64715; AAT64716; AAT64717; AAT64718; AAT64719; AAT64720;
AAT64721; AAT64722; AAT64723; AAT64724; AAT64725; AAT64726; AAT64727; AAT64728;
AAT64729; AAT64730; AAT64731; AAT64732; AAT64733; AAT64734; AAT64735; AAT64736; AAT64737; AAT64738; AAT64739; AAT64740; AAT64741; AAT64742; AAT64743; AAT64744;
AAT64745; AAT64746; AAT64747; AAT64748; AAT64749; AAT64750; AAT64751; AAT64752;
AAT64753; AAT64754; AAT64755; AAT64756; AAT64757; AAT64758; AAT64759; AAT64760;
AAT64761; AAT64762; AAT64763; AAT64764; AAT64765; AAT64766; AAT64767; AAT64768;
AAT64769; AAT64770; AAT64771; AAT64772; AAT64773; AAT64774; AAT64775; AAT64776; AAT64777; AAT64778; AAT64779; AAT64780; AAT64781; AAT64782; AAT64783; AAT64784;
AAT64785; AAT64786; AAT64787; AAT64788; AAT64789; AAT64790; AAT64791; AAT64792;
AAT64793; AAT64794; AAT64795; AAT64796; AAT64797; AAT64798; AAT64799; AAT64800;
AAT64801; AAT64802; AAT64803; AAT64804; AAT64805; AAT64806; AAT64807; AAT64808;
AAT64809; AAT64810; AAT64811; AAT64812; AAT64813; AAT64814; AAT64815; AAT64816; AAT64817; AAT64818; AAT64819; AAT64820; AAT64821; AAT64822; AAT64823; AAT64824;
AAT64825; AAT64826; AAT64827; AAT64828; AAT64829; AAT64830; AAT64831; AAT64832;
AAT64833; AAT64834; AAT64835; AAT64836; AAT64837; AAT64838; AAT64839; AAT64840;
AAT64841; AAT64842; AAT64843; AAT64844; AAT64845; AAT64846; AAT64847; AAT64848;
AAT64849; AAT64850; AAT64851; AAT64852; AAT64853; AAT64854; AAT64855; AAT64856; AAT64857; AAT64858; AAT64859; AAT64860; AAT64861; AAT64862; AAT64863; AAT64864;
AAT64865; AAT64866; AAT64867; AAT64868; AAT64869; AAT64870; AAT64871; AAT64872;
AAT64873; AAT64874; AAT64875; AAT64876; AAT64877; AAT64878; AAT64879; AAT64880;
AAT64881; AAT64882; AAT64883; AAT64884; AAT64885; AAT64886; AAU07825; AAU07826;
AAU07827; AAU07828; AAU07829; AAU07830; AAU07831; AAU09399; AAW24444; AAW24445; AAW24446; AAW24447; AAW24448; AAW24449; AAW24450; AAW24451; AAUl 1522; AAU25949;
AAV80797; AAV80798; AAW65986; AAW65987; AAW65988; AAW65989; AAW65990; AAW34374;
AAW34375; AAW34376; AAW34377; AAW34378; AAW50838; AAW50839; AAW50840; AAW50841;
AAX23575; AAW78047; AAW78048; AAW78049; AAW78050; AAW78051; AAW78052; AAX77666;
AAX77667; AAX77668; AAX77669; AAX77670; AAX77671; AAX77672; AAX77673; AAX77674;
AAX14851; AAX47732; AAX47733; AAX47734; AAX47735; AAX47736; AAX47737; AAX47738; AAX47739; AAX47740; AAX47741; AAX47742; AAX47743; AAX47744; AAX47745; AAX47746;
AAX47747; AAX47748; AAX47749; AAX47750; AAX47751; AAX47752; AAX47753; AAX47754;
AAX47755; AAX47756; AAX47757; AAX49559; AAX49562; AAY85891; AAY85892; AAY85893;
AAY85894; AAY85895; AAY85896; AAY85897; AAY85898; AAY85899; AAY85900; AAY85901;
AAY85902; AAY85903; AAY85904; AAY85905; AAY85906; AAY85907; AAY85908; AAY85909; AAY85910; AAY85911; AAX63815; AAX63816; AAX63817; AAX63818; AAX63819; AAX63820;
AAX63821; AAX63822; AAX63823; AAX63824; AAX63825; AAX63826; AAX63827; AAX63828;
AAY42043; AAY42044; AAY42045; AAY42046; AAY42047; AAY42048; AAY42049; AAY42050;
AAY42051; AAY42052; AAY42053; AAY42054; AAY42055; AAY42056; AAY42057; AAY42058;
AAY42059; AAY42060; AAY42061; AAY42062; AAY42063; AAY42064; AAY42065; AAY42066; AAY42067; AAX84524; AAX84525; AAX84526; AAX84527; AAX84528; AAX84529; AAX84530;
AAX84531; AAX84532; AAX84533; AAX84534; AAX84535; AAX84536; AAX84537; AAX84538;
AAX84539; AAX84540; AAX84541; AAX84542; AAX84543; AAX84544; AAX84545; AAX84546;
AAX84547; AAX84548; CAL40875; AAXl 1455; AAXl 1475; AAXl 1485; AAXl 1495; AAX56420;
AAXl 1505; AAY28295; AAXl 1515; AAXl 1565; AAXl 1575; AAXl 1585; AAXl 1595; AAXl 1605; AAX11615; AAX11635; AAX12731; AAX11465; AAY28571; AAX12751; AAX11525; AAX11535;
AAX11545; AAX11555; AAX11625; AAX12741; AAX12761; AAX12771; AAX12781; AAX12791;
AAX12801; AAX12811; AAX34061; AAX35821; AAX35831; AAX38237; AAX35841; AAX35851;
AAX47525; AAX56490; AAX47515; AAX35861; AAX47535; AAX35871; AAX56380; AAX56390;
AAX56400; AAX56410; AAX56430; AAX56440; AAX56450; AAX56460; AAX56470; AAX56480; AAX56500; AAX56510; AAX56520; AAX56540; AAX56550; AAX56560; AAX56570; AAX56580;
AAX56590; AAX56600; AAX57644; AAX57654; AAX57664; AAX57674; AAX57684; AAX57694;
AAX57704; AAX57714; AAX57733; AAX57734; AAX57744; AAX57754; AAX57764; AAX57774;
AAX57784; AAX57794; AAX57804; AAX57814; AAX57824; AAX57834; AAX57844; AAX57854;
AAX57864; AAX57874; AAX57884; AAX57894; AAX57904; AAX57914; AAX57924; AAX57934; AAX57944; AAX76623; AAX76633; AAX76643; AAX76653; AAX76663; AAY59035; AAX76673;
AAX76683; AAX76693; AAX76703; AAX76713; AAY28375; AAX76723; AAX76733; AAX76743;
AAX76753; AAX76763; AAY18086; AAY18096; AAY18611; AAY18585; AAY18106; AAY18116;
AAY18564; AAY18126; AAY18136; AAY18146; AAY18156; AAY18166; AAY18176; AAY18186;
AAY18196; AAY27863; AAY28385; AAY27843; AAY28561; AAY28345; AAY28395; AAY27853; AAY28325; AAY27959; AAY27994; AAY28004; AAY28014; AAY28265; AAY28275; AAY28285;
AAY28363; AAY28648; AAY28305; AAY28315; AAY28335; AAY28355; AAY28638; AAY28405;
AAY28486; AAY28521; AAY28531; AAY28541; AAY28628; AAY28551; AAY28618; AAY28581;
AAY28591; AAY28608; AAY44610; AAY44906; AAY44620; AAY44621; AAY44631; AAY44896;
AAY44641; AAY44796; AAY44795; AAY44785; AAY44775; AAY44765; AAY44755; AAY44651;
AAY44661; AAY46371; AAY46381; AAY47013; AAY47023; AAY47052; AAY46391; AAY47075; AAY47085; AAY46416; AAY46426; AAY46436; AAY64192; AAY64202; AAY64212; AAY64252;
AAY64272; AAY64292; AAY64222; AAY64312; AAY64232; AAY64242; AAY64322; AAY64262;
AAY64282; AAY64342; AAY64302; AAY64352; AAY64332; AAY64392; AAY64362; AAY64372;
AAY64382; AAY64402; AAY98770; AAY98037; AAY98047; AAY98187; AAY98057; AAY98067;
AAY98077; AAY98087; AAY98097; AAY98107; AAY98117; AAY98127; AAY98137; AAY98147; AAY98157; AAY98167; AAY98177; AAY98195; AAY98217; AAY98207; AAY98237; AAY98227;
AAY98247; AAY98319; AAY98329; AAY98339; AAY98353; AAY98366; AAY98376; AAY98386;
AAY98396; AAY98406; AAZ38539; AAZ38561; AAZ38462; AAZ38473; AAZ38484; AAZ38495;
AAZ38506; AAZ38517; AAZ38528; AAZ38583; AAZ38605; AAZ38550; AAZ38572; AAZ38594;
AAZ38616; AAZ38638; AAZ38650; AAZ43370; AAZ43383; AAZ43394; AAZ43405; AAZ74386; AAZ74352; AAZ74363; AAZ74430; AAZ74397; AAZ74408; AAZ74419; AAZ74441; AAZ74452;
AAZ74507; AAZ74463; AAZ74474; AAZ74485; AAZ74496; AAZ74529; AAZ74518; AAZ74540;
AAZ74573; AAZ74606; AAZ74551; AAZ74595; AAZ74562; AAZ74584; AAZ74617; AAZ79505;
AAZ79516; AAZ79527; AAZ79560; AAZ79571; AAZ79582; AAZ79626; AAZ79944; AAZ79593;
AAZ79615; AAZ79627; AAZ79941; AAZ79963; AAZ79974; AAZ79985; AAZ80017; AAZ79996; AAZ80007; AAZ80030; AAZ83288; AAZ83242; AAZ83312; AAZ83266; AAZ83277; AAZ83323;
AAZ83371; AAZ83382; AAZ83649; AAZ83688; ABA12740; ABA12751; ABA12762; ABA12780;
ABA12773; ABA16214; ABA18048; ABA18134; ABA18156; ABA18026; ABA18123; ABA26799;
ABA26700; ABA26711; ABA26722; ABA26733; ABA26744; ABA26755; ABA26766; ABA26777;
ABA26788; ABA42269; ABA43167; ABA43178; ABA42291; ABA43336; ABA43200; ABA42302; ABA42313; ABA42335; ABA42346; ABA42989; ABA42357; ABA42368; ABA42379; ABA42390;
ABA42401; ABA42412; ABA42443; ABA42454; ABA42465; ABA42476; ABA42487; ABA42498;
ABA42978; ABA42939; ABA42928; ABA42509; ABA42520; ABA42531; ABA42542; ABA42553;
ABA42564; ABA87242; ABA87253; ABB96509; ABB02836; ABB02847; ABB02858; ABB02869;
ABB02880; ABB02891; ABB02902; ABB04283; ABB04294; ABB04305; ABB04316; ABB04327; ABB04338; ABB04349; ABB04360; ABB04371; ABB02947; ABB02958; ABB02969; ABB02980;
ABB02991; ABB03002; ABB03013; ABB03024; ABB03035; ABB03046; ABB03057; ABB03068;
ABB03079; ABB03090; ABB03112; ABB04906; ABB04917; ABB04928; ABB04939; ABB04950;
ABB04961; ABB04983; ABB05183; ABB05194; ABB05205; ABB05216; ABB04994; ABB05005;
ABB19704; ABB19712; ABB19723; ABB19744; ABB19758; ABB86785; ABB86796; ABB87034; ABB87377; ABB87388; ABB87399; ABB87410; ABB87421; ABB87429; ABB87440; ABB87451 ;
ABB87462; ABB87789; ABB88149; ABB8815O; ABB88152; ABB88162; ABB88173; ABB88183;
ABB88256; ABB88309; ABB88342; ABB88369; ABB46547; ABB46392; ABB46403; ABB46414;
ABB46425; ABB46436; ABB46447; ABB46458; ABB53614; ABB53625; ABB53652; ABB53663;
ABB53674; ABB53685; ABB53696; ABB53718; ABB53751; ABB54514; ABB52376; ABB77853;
ABB59996; ABB77864; ABC50167; ABC50178; ABC50189; ABB79716; ABB60007; ABB79731 ; ABB80034; ABB80023; ABB79788; ABB79799; ABB79810; ABB79957; ABB79968; ABB80001 ;
ABB80012; ABB80137; ABB80148; ABB80159; ABB8OO81; ABB80092; ABB8O185; ABB80196;
ABB80207; ABB80229; ABB80492; ABB80503; ABB80514; ABB80748; ABB80218; ABB80529;
ABB80641; ABB80661; ABB80240; ABB80251; ABB80672; ABB80682; ABB80693; ABB80704;
ABB80737; ABB80715; ABB80724; ABB82183; ABB82227; ABB96319; ABB96330; ABB96341 ; ABB96352; ABB96363; ABB96374; ABB96395; ABB96498; ABB96520; ABB96531; ABC02234;
ABC02288; ABC02299; ABC02332; ABC02321; ABC02255; ABC02266; ABC02310; ABC39805;
ABC40642; ABC40544; ABC40555; ABC40608; ABC40619; ABC41692; ABC41703; ABC41725;
ABC41952; ABC41736; ABC41953; ABC41964; ABC42014; ABC42114; ABC42125; ABC42136;
ABC42147; ABC42929; ABC42940; ABC42158; ABC42169; ABC42180; ABC42192; ABC42951 ; ABC42307; ABC42318; ABC42346; ABC42461; ABC42962; ABC42494; ABC42505; ABC42516;
ABC42527; ABC42973; ABC42984; ABC42995; ABC43006; ABC43017; ABC42574; ABC43028;
ABC43039; ABC43050; ABC43061; ABC43072; ABC43083; ABC43094; ABC43105; ABC43116;
ABC42585; ABC42596; ABC43127; ABC42607; ABC42618; ABC42629; ABC43138; ABC43149;
ABC42640; ABC43160; ABC42651; ABC43171; ABC43182; ABC42662; ABC42673; ABC42684; ABC43475; ABC42695; ABC43486; ABC43497; ABC43508; ABC42706; ABC42717; ABC42728;
ABC42739; ABC42761; ABC42772; ABC42783; ABC42794; ABC42805; ABC43519; ABC43530;
ABC42816; ABC43541; ABC42827; ABC42838; ABC42849; ABC43552; ABC42860; ABC42871 ;
ABC42882; ABC42893; ABC46554; ABC46565; ABC46576; ABC54668; ABC54679; ABC50200;
ABC50211; ABC50222; ABC50233; ABC50244; ABC50255; ABC50266; ABC50277; ABC50288; ABC50299; ABC50310; ABC50321; ABC50332; ABC50343; ABC50354; ABC50365; ABC50376;
ABC50387; ABC50398; ABC50409; ABC50420; ABC67319; ABC67817; ABC68233; ABC67850;
ABC67883; ABC67894; ABC67967; ABC67978; ABC67454; ABC67989; ABC68000; ABC68049;
ABC68060; ABC67471; ABC68071; ABC68093; ABC67543; ABC67554; ABC68082; ABC67565;
ABC67576; ABC67587; ABC67598; ABC67609; ABC67620; ABC67631; ABC67642; ABC67653; ABC67664; ABC67675; ABC67686; ABC67697; ABC67708; ABC67719; ABC67733; ABC67806;
ABC67828; ABC67839; ABC67861; ABC67872; ABC68222; ABC84389; ABC84400; ABC86148;
ABC84411; ABC86124; ABC86040; ABC84422; ABC86029; ABC86018; ABC84433; ABC86007;
ABC85996; ABC85985; ABC85974; ABC84444; ABC85963; ABC85952; ABD38134; ABC85941;
ABC85930; ABC85919; ABC85908; ABC85897; ABC85886; ABC85875; ABC84498; ABC84509; ABC85864; ABC85853; ABC85842; ABC84520; ABC85831; ABC85765; ABC85820; ABC85809;
ABC85798; ABC84531; ABC84542; ABC86137; ABC85787; ABC85776; ABC85754; ABC84560;
ABC84571; ABD15526; ABD15537; ABD16538; ABD16527; ABD16516; ABD16560; ABD16505;
ABD16494; ABD16483; ABD16472; ABD16358; ABD16347; ABD16336; ABD16325; ABD16314;
ABD16303; ABD16549; ABD16762; ABD17334; ABD17323; ABC97374; ABD16751; ABD16740;
ABD16729; ABD16718; ABD16593; ABD16582; ABD16571; ABD16292; ABD15790; ABD15779; ABD15768; ABD15757; ABD15746; ABD15735; ABD15724; ABD15713; ABD15702; ABD15691;
ABD15680; ABD15669; ABD15658; ABD15647; ABD15504; ABD15493; ABD15482; ABD15471;
ABD15460; ABD15449; ABD15625; ABD15614; ABD15603; ABD15592; ABD15581; ABD15570;
ABD15559; ABD15548; ABD15636; ABD60790; ABD60801; ABD61293; ABD60812; ABD61304;
ABD60823; ABD61529; ABD61757; ABD61777; ABD61315; ABD61326; ABE12078; ABD60834; ABD61337; ABD61348; ABD61359; ABD61370; ABD61381; ABD60845; ABD61392; ABD61403;
ABD61260; ABD61271; ABD60922; ABD61282; ABD61551; ABD61249; ABE12532; ABE12623;
ABD62833; ABD62794; ABD77598; ABD77609; ABD77620; ABD77631; ABD77642; ABD77653;
ABD77664; ABD79123; ABD79134; ABD79145; ABD77686; ABE12645; ABD77697; ABD79156;
ABD79167; ABD79178; ABD77741; ABD77752; ABD77763; ABD77774; ABD77785; ABD79032; ABD77829; ABD79189; ABD77840; ABD79200; ABD79211; ABD77851; ABD79222; ABD77862;
ABD77873; ABD79233; ABD77884; ABD77895; ABD79244; ABD77906; ABD78049; ABD78115;
ABD78126; ABD94734; ABD94745; ABD94767; ABD94822; ABD94833; ABD94844; ABD94855;
ABD94866; ABD94877; ABD94888; ABD94899; ABD94910; ABD94921; ABD94932; ABD94954;
ABE11911; ABE12123; ABE27164; ABE13076; ABE13323; ABE13471; ABE13555; ABE13595; ABE13606; ABE13617; ABE13628; ABE13639; ABE13652; ABE13824; ABE14019; ABE14030;
ABE14041; ABE14052; ABE14063; ABE14124; ABE14464; ABE14840; ABE15578; ABF47550;
ABF47594; ABF47616; ABF47858; ABF47902; ABI47947; ABI48006; ABF82651; ABF83447;
ABF82695; ABF82706; ABG26758; ABG26769; ABG26802; ABG26846; ABG26857; ABG26868;
ABG26879; ABG26890; ABG26901; ABG26912; ABG26923; ABG26934; ABG26956; ABG37131; ABG37142; ABG37153; ABG37164; ABG37175; ABG37186; ABG37197; ABG37208; ABG37219;
ABG37230; ABG37241; ABG37252; ABG37263; ABG37274; ABG37285; ABG37296; ABG37307;
ABG37318; ABG37329; ABG37340; ABG37351; ABG37373; ABG37406; ABG37417; ABG37428;
ABG37439; ABG37450; ABG37461; ABG37472; ABG37483; ABG37494; ABG37505; ABG37516;
ABG37527; ABG37538; ABG37549; ABG37560; ABG37571; ABG37582; ABG37593; ABG37604; ABG37615; ABG47851; ABG47862; ABG47873; ABG47884; ABG47895; ABG47906; ABG47917;
ABG47928; ABG47939; ABG47950; ABG47961; ABG47972; ABG47983; ABG47994; ABG48005;
ABG48016; ABG48027; ABG48038; ABG48060; ABG48071; ABG48082; ABG48093; ABG48104;
ABG48115; ABG48126; ABG48137; ABG48148; ABG48159; ABG48170; ABG48181; ABG48192;
ABG48203; ABG48214; ABG48225; ABG48236; ABG48247; ABG48258; ABG48269; ABG48280; ABG48291; ABG48302; ABG48313; ABG48324; ABG48335; ABG48346; ABG48357; ABG48368;
ABG67135; ABG67146; ABG67667; ABG67157; ABG67168; ABG67179; ABG67190; ABG67201;
ABG67212; ABG67223; ABG67234; ABG67245; ABG67502; ABG67513; ABG67524; ABG67535;
ABG67546; ABG67557; ABG67568; ABG67579; ABG67590; ABG67601; ABG67612; ABG67623;
ABG67634; ABG67645; ABG67656; ABG79941; ABG79963; ABG79974; ABG79985; ABG79996;
ABG80007; ABG8OO18; ABG80029; ABG80040; ABG80051; ABG80062; ABG80073; ABG80084; ABG80095; ABG80106; ABG80117; ABG80128; ABG80139; ABG80150; ABG80161; ABG80194;
ABG80205; ABG80216; ABG80227; ABG80238; ABG80249; ABG80260; ABG80271; ABG80282;
ABG80293; ABG80304; ABG80315; ABG80326; ABG80337; ABG80348; ABG80359; ABG80370;
ABG8O381; ABG80392; ABG80403; ABG80414; ABG80425; ABG80436; ABG88289; ABG88355;
ABG88366; ABG88377; ABG88388; ABG88399; ABG88410; ABG88421; ABG88432; ABG88443; ABG88454; ABG88465; ABG88476; ABG88487; ABG88498; ABG88509; ABG88520; ABG88531;
ABG88564; ABG88575; ABG88586; ABG88597; ABG88608; ABG88619; ABG88630; ABG88641;
ABG88652; ABG88663; ABG88674; ABG88685; ABG88696; ABG88707; ABG88718; ABG88729;
ABG88740; ABG88751; ABG88762; ABG88773; ABG88784; ABG88795; ABG88806; ABG88817;
AB 120793; AB 120815; AB 120881; AB 120892; AB 120903; AB 120914; ABI20925; AB 120936; ABI20947; AB 120958; AB 120969; AB 121736; AB 120980; AB 120991; AB 121002; ABI21013; AB 121024; ABI21035;
AB 121046; AB 121057; AB 121068; AB 121079; AB 121090; AB 130444; ABI21101; AB 121112; ABI21123;
AB 126646; AB 121134; AB 121145; AB 121156; AB 121167; AB 121178; ABI21244; AB 121255; ABI21266;
AB 121277; AB 121288; AB 121299; AB 121310; AB 121321; AB 121332; ABI21343; AB 121354; ABI21365;
AB 121376; AB 121387; AB 121398; AB 121409; AB 121420; AB 121431; ABI21442; AB 121453; ABI21464; AB 121475; AB 121486; AB 121497; AB 122159; AB 121508; AB 130389; ABI30400; ABI30411; ABI30422;
ABI30433; AB 130455; ABI30466; AB 130477; ABI30488; AB 130499; ABI30510; AB 130521; ABI30532;
ABI30543; AB 130554; ABI30576; AB 130587; ABI30598; AB 130609; ABI30620; AB 130733; ABI30744;
ABI30755; AB 130766; ABI30777; AB 130788; ABI30799; AB 130810; ABI30821; AB 130832; ABI30843;
ABI30854; AB 130865; ABI30876; ABI84400; ABI84412; ABI84471; ABI84486; ABI84577; ABI84806; ABI84938; AB 192258; AB 192269; AB 192280; AB 192291; AB 192324; ABI92335; AB 192346; ABI92357;
AB 192368; AB 192390; AB 192401; AB 192412; AB 192423; AB 192434; ABI92445; AB 192456; ABI92467;
AB 192478; AB 192489; AB 192500; AB 192511 ; AB 192522; AB 192533; ABI92544; AB 192555; ABI92566;
AB 192577; AB 192588; AB 192599; AB 192610; AB 192621; AB 192632; ABI92643; AB 192654; ABI92665;
ABI92676; AB 192687; ABI92698; AB 192709; ABI92720; AB 192731; ABI92742; AB 192753; ABI92764; ABI92775; AB 192786; ABI92797; AB 192808; ABI92819; AB 192830; ABI92841; AB 192852; ABI92863;
ABI92874; AB 192885; ABI92896; AB 192907; ABI92918; AB 192929; ABI92940; AB 192951; ABI92962;
ABI92973; AB 192984; ABI92995; AB 193006; ABI93017; AB 193039; ABI93050; AB 193061; ABI93072;
ABI93083; ABI93094; ABI93105; ABI93116; AB 195474; ABK79937; ABI95228; ABI95239; AB 195305;
ABJ09096; ABJ09107; ABJ09118; ABJ09140; ABJ09162; ABJ09173; ABJ09195; ABJ09206; ABJ09217; ABJ09228; ABJ09239; ABJ09250; ABJ09261; ABJ09272; ABJ09283; ABJ09294; ABJ09305; ABJ09316;
ABJ09338; ABJ09349; ABJ09360; ABJ09371; ABJ09382; ABJ16587; ABJ16598; ABJ16620; ABJ16631;
ABJ16697; ABJ16708; ABJ16741; ABJ16752; ABJ16763; ABJ16774; ABJ16785; ABJ53460; ABJ53471;
ABJ53482; ABK39951; ABK39962; ABK39973; ABK39984; ABK40017; ABK40061; ABK40075;
ABK40612; ABK40623; ABK40645; ABK40656; ABK40667; ABK40678; ABK40700; ABK40711;
ABK40722; ABK40733; ABK40744; ABK79981; ABK79992; ABK80014; ABK8OO58; ABK80069; ABK8OO8O; ABK80091; ABK80102; ABK80113; ABK80124; ABK80300; ABK80135; ABK80146;
ABK80157; ABK80168; ABK80179; ABK80190; ABK80201; ABK80212; ABK80223; ABK80234;
ABK80245; ABK80256; ABK80267; ABK80278; ABK80289; ABK80311; ABL67044; ABL67110;
ABL67132; ABL67165; ABL67176; ABL67198; ABL67220; ABL67841; ABL67275; ABL67286;
ABL67297; ABL67308; ABL67319; ABL67330; ABL67341; ABL67352; ABL67363; ABL67374; ABL67385; ABL67396; ABL67407; ABL67418; ABL75563; ABM21938; ABM22015; ABM22037;
ABM22059; ABM22070; ABM22081; ABM22092; ABM22103; ABM22114; ABM22125; ABO32816;
ABM22136; ABM22147; ABM22301; ABM22312; ABM22323; ABM22334; ABM22345; ABM22356;
ABM22367; ABM66853; ABM66875; ABM66919; ABM66930; ABM66941; ABM66952; ABM66963;
ABM66974; ABM66985; ABM66996; ABM67007; ABM67018; ABM67029; ABM67040; ABN50767; ABN50984; ABN50995; ABN51010; ABN51021; ABN51032; ABN51043; ABN51054; ABN51099;
ABN51110; ABN51121; ABN51132; ABN51154; ABN59390; ABO32656; ABO32667; ABO32692;
ABO32751; ABO32762; ABO32775; ABO32790; ABO32803; ABO32827; ABO32838; ABO32849;
ABO32860; ABO32871; ABO32882; ABO32893; ABO32904; ABO32915; ABO32926; ABO32937;
ABO33036; ABO33047; ABO33058; ABO33069; ABO38076; ABO38087; ABO38230; ABO38241; ABO38252; ABO38274; ABO38285; ABO38417; ABO44035; ABO44068; ABO44079; ABO51829;
ABO51862; ABO51884; ABO76913; ABO52071; ABO52126; ABO52214; ABO52291; ABO52313;
ABO52324; ABO52335; ABO52346; ABO52357; ABO52368; ABO52423; ABO52522; ABO52566;
ABO52577; ABO52588; ABO52599; ABO52632; ABO52643; ABO52676; ABO64343; ABO76946;
ABO76957; ABP49184; ABP49371; ABP49404; ABP49415; ABP49426; ABP49492; ABP49503; ABP49514; BAA00769; BAA00770; BAA00771; BAA00772; BAA01025; BAA01026; BAA02776;
BAA02777; BAA02778; BAA02779; BAA04707; BAA04708; BAA04709; BAA04710; BAA04711;
BAA04712; BAA04713; BAA04714; BAA04715; BAA04716; BAA04717; BAA04718; BAA04719;
BAA21644; BAA21645; BAA21646; BAA21647; BAA21648; BAA33866; BAA33938; BAA33939;
BAA33940; BAA33941; BAA33942; BAA33943; BAA33944; BAA33945; BAA33946; BAA33947; BAA07844; BAA07845; BAA07846; BAA07847; BAA07848; BAA07849; BAA07850; BAA08713;
BAA08714; BAA21070; BAA08715; BAA08716; BAA08717; BAA08718; BAA21071; BAA08719;
BAA13091; AAY23641; AAY23642; AAY25498; AAY46201; AAY46202; AAY58320; AAZ06795;
AAZ32943; AAZ32944; AAZ32945; AAZ32946; AAZ32947; AAZ32948; AAZ32949; AAZ32950;
AAZ32951; AAZ32952; AAZ32953; AAZ29151; AAZ29152; AAZ29153; AAZ29154; AAZ29155; AAZ29156; AAZ29157; AAZ29158; AAZ29159; AAZ29160; AAZ29161; AAZ29162; AAZ29163;
AAZ29164; AAZ29165; AAZ29166; AAZ29167; AAZ29168; AAZ29169; AAZ29170; AAZ29171;
AAZ29172; AAZ29173; AAZ29174; AAZ29175; AAZ29176; AAZ29177; AAZ29178; AAZ29179;
AAZ29180; AAZ29181; AAZ29182; AAZ29183; AAZ29184; AAZ29185; AAZ29186; AAZ29187;
AAZ29188; AAZ29189; AAZ29190; AAZ29191; AAZ29192; ABA39842; ABA39843; ABA39844;
ABA39845; ABA39846; ABA39847; ABA39848; ABA39849; ABA39850; AAZ57437; AAZ74350; ABA46957; ABA41538; ABA27432; ABA27440; AAZ91962; AAZ91963; AAZ91964; ABA60253;
ABA60254; ABA60255; ABA60256; ABA60257; ABA60258; ABA60259; ABA60260; ABA60261;
ABA60262; ABA60263; ABA60264; ABA60265; ABA60266; ABA60267; ABA60268; ABA60269;
ABA60270; ABA60271; ABA60272; ABA60273; ABA60274; ABA60275; ABA60276; ABA60277;
ABA60278; ABA60279; ABA60280; ABA60281; ABA60282; ABA60283; ABA60284; ABA60285; ABA60286; ABA60287; ABA60288; ABA60289; ABA60290; ABA60291; ABA60292; ABA60293;
ABA60294; ABA60295; ABA60296; ABA60297; ABA60298; ABA60299; ABA60300; ABA60301;
ABA60302; ABA60303; ABA60304; ABA60305; ABA60306; ABA60307; ABA60308; ABA60309;
ABA06580; ABA06581; ABA06582; ABA06583; ABA06584; ABA06585; ABA60900; ABA60901;
ABA60902; ABA60903; ABA60904; ABA60905; ABA60906; ABA60907; ABA60908; ABA60909; ABA60910; ABA60911; ABA60912; ABA60913; ABA60914; ABA60915; ABA60916; ABA60917;
ABA60918; ABA60919; ABA60920; ABA60921; ABA60922; ABA60923; ABA60924; ABA60925;
ABA60926; ABA60927; ABA60928; ABA60929; ABA60930; ABA60931; ABA60932; ABA60933;
ABA60934; ABA60935; ABA60936; ABA60937; ABA60938; ABA60939; ABA60940; ABA60941;
ABA60942; ABA60943; ABA60944; ABA60945; ABA60946; ABA60947; ABA60948; ABA60949; ABA60950; ABA60951; ABA60952; ABA60953; ABA60954; ABA60955; ABA60956; ABA60957;
ABA60958; ABA60959; ABA60960; ABA60961; ABA60962; ABA60963; ABA60964; ABA60965;
ABA60966; ABA60967; ABA60968; ABA60969; ABA60970; ABA60971; ABA60972; ABA60973;
ABA60974; ABA60975; ABA60976; ABA60977; ABA60978; ABA60979; ABA60980; ABA60981;
ABA60982; ABA60983; ABA60984; ABA60985; ABA60986; ABA60987; ABA60988; ABA60989; ABA60990; ABA60991; ABA60992; ABA60993; ABA60994; ABA60995; ABA60996; ABA60997;
ABA60998; ABA60999; ABA61000; ABA61001; ABA61002; ABA61003; ABA61004; ABA61005;
ABA61006; ABA61007; ABA61008; ABA61009; ABA61010; ABA61011; ABA61012; ABA61013;
ABA61014; ABA61015; ABA61016; ABA61017; ABA61018; ABA61019; ABA61020; ABA61021;
ABA61022; ABA61023; ABA61024; ABA61025; ABA61026; ABA61027; ABA61028; ABA61029; ABA61030; ABA61031; ABA61032; ABA61033; ABA61034; ABA61035; ABA61036; ABA61037;
ABA61038; ABA61039; ABA61040; ABA61041; ABA61042; ABA61043; ABA61044; ABA61045;
ABB17173; ABB71825; ABB71826; ABB71827; ABB71828; ABB71829; ABB71830; ABB71831 ;
ABB71832; ABB71833; ABB51981; ABB51982; ABB51983; ABB51961; ABB51963; ABB51964;
ABB76697; ABB76698; ABB76699; ABB76700; ABB84191; ABB84192; ABB84193; ABB84194; ABB84195; ABB84196; ABB84197; ABB84198; ABB84199; ABB84200; ABB84201; ABB84202;
ABC59709; ABC66247; ABC66248; ABC66249; ABC66250; ABC66251; ABC66252; ABC66253;
ABC66254; ABC66255; ABC66256; ABC66257; ABC66258; ABD59850; ABD59851; ABD59852;
ABD59853; ABD59854; ABD59855; ABD59856; ABD59857; ABD85122; ABF17954; ABF17955;
ABF17956; ABF17957; ABF17958; ABF17959; ABE73114; ABE73115; ABF21268; ABF21269;
ABF21271; ABF21273; ABF21281; ABG26247; ABG26248; ABG26249; ABG26250; ABG26251; ABG26252; ABG26253; ABG26254; ABG26255; ABG26256; ABG02860; ABG02861; ABG02862;
ABG02863; ABH00993; ABH00994; ABH00995; ABH00996; ABH00997; ABH00998; ABH00999;
ABHOlOOO; ABHOlOOl; ABH01002; ABH01003; ABH01004; ABH01005; ABH01006; ABH01007;
ABH01008; ABH01009; ABHOlOlO; ABHOlOI l; ABH01012; ABH01013; ABH01014; ABH01015;
ABH01016; ABH01017; ABH01018; ABH01019; ABH01020; ABH01021; ABH01022; ABI22056; AB 122057; AB 122058; AB 122059; AB 122060; AB 122061; AB 122062; ABI22063; AB 122064; ABI22065;
AB 122066; AB 122067; AB 122068; AB 122069; AB 122070; AB 122071; ABI22072; AB 122073; ABI22074;
AB 122075; AB 122076; AB 122077; AB 122078; AB 122079; AB 122080; ABI22081; AB 122082; ABI22083;
AB 122084; AB 122085; AB 122086; AB 122087; AB 122088; AB 122089; ABI22090; AB 122091; ABI22092;
AB 122093; AB 122094; AB 122095; AB 122096; AB 122097; AB 122098; ABI22099; AB 122100; ABI22101; AB 122102; AB 154388; ABI54389; ABJ51896; ABI49169; ABI49170; ABI49171; ABI49172; ABI49173;
ABI49174; ABI49175; ABI49176; ABI49177; ABI49178; ABI49179; ABI49180; ABI49181; ABI49182;
ABI49183; ABI49184; ABI51314; AB 151315; ABI51316; AB 155257; ABI55258; AB 155259; ABI55260;
ABI55261; AB 155262; ABI55263; AB 155264; ABI55265; AB 155266; ABI55267; AB 155268; ABI55269;
ABI55270; AB 155271; ABI55272; AB 155273; ABI55274; AB 155275; ABI55276; AB 155277; ABI55278; ABJ53158; ABM47075; ABK60213; ABK60214; ABK60215; ABL86145; ABM98421; ABM98422;
ABO10165; ABO10166; ABO10167; ABO10168; ABO10169; ABO10170; ABO10171; ABO10172;
ABO10173; ABO10174; ABO10175; ABO10182; ABO20947; ABO20952; ABO20953; ABO20954;
ABO20955; ABO20956; ABO20957; ABO20958; ABO21717; ABO21718; ABO21719; ABO21720;
ABO21721; ABO21722; ABO21726; ABO21727; ABO21728; ABO21729; ABO20959; ABO20960; ABO21733; ABO37477; ABO37478; ABO37479; ABO37480; ABO37481; ABO37482; ABO37483;
ABO37484; ABO37485; ABO37486; ABO37487; ABO37488; ABO37489; ABO37490; ABO37491;
ABO37492; ABO37493; ABO37494; ABO37495; ABO37496; ABO37497; ABO37498; ABO37499;
ABO37500; ABO37501; ABO37502; ABO37503; ABO37504; ABO37505; ABO37506; ABO37507;
ABO37508; ABO37509; ABO37510; ABO37511; ABO37512; ABO37513; ABO37514; ABO37515; ABO37516; ABO37517; ABO37518; ABO37519; ABO37520; ABO37522; ABO37523; ABO37524;
ABO37525; ABO37526; ABO37527; ABO37528; ABO37529; ABO37530; ABO37531; ABO37532;
ABO37533; ABO37534; ABO37535; ABO37536; ABO37537; ABO37538; ABO37539; ABO37540;
ABO37541; ABO37542; ABO37543; ABO37544; ABO37545; ABO37546; ABO37547; ABO37548;
ABO37549; ABO37550; ABO37551; ABO37552; ABO37553; ABO37554; ABO37555; ABO37556; ABO37557; ABO37558; ABO37559; ABO37560; ABO37561; ABO37562; ABO37563; ABO37564;
ABO37565; ABO37566; ABO37567; ABO37568; ABO37569; ABO37570; ABO37571; ABO37572;
ABO37573; ABO37574; ABO37575; ABO37576; ABO37577; ABO37578; ABO37579; ABO37580;
ABO37581; ABO37582; ABO37583; ABO37584; ABO37585; ABO37586; ABO37587; ABO37588;
ABO37589; ABO37590; ABO37591; ABO37592; ABO37593; ABO37594; ABO37595; ABO37596;
ABO37597; ABO37598; ABO37599; ABO37600; ABO37601; ABO37602; ABO37603; ABO37604; ABO37605; ABO37606; ABO37607; ABO37608; ABO37609; ABO37610; ABO37611; ABO37612;
ABO37613; ABO37614; ABO37615; ABO37616; ABO37617; ABO37618; ABO37619; ABO37620;
ABO37621; ABO37622; ABO37623; ABO37624; ABO37625; ABO37626; ABO37627; ABO37628;
ABO37629; ABO37630; ABO37631; ABO37632; ABO37633; ABO37634; ABO37635; ABO37636;
ABO37637; ABO37638; ABO37639; ABO37640; ABO37641; ABO37642; ABO37643; ABO37644; ABO37645; ABO37646; ABO37647; ABO37648; ABO37649; ABO37650; ABO37651; ABO37652;
ABO37653; ABO37654; ABO37655; ABO37656; ABO37657; ABO37658; ABO37659; ABO37660;
ABO37661; ABO37662; ABO37663; ABO37664; ABO37665; ABO37666; ABO37667; ABO37668;
ABO37669; ABO37670; ABO37671; ABO37672; ABO37673; ABO37674; ABO37675; ABO37676;
ABO37677; ABO37678; ABO37679; ABO37680; ABO37681; ABO37682; ABO37683; ABO37684; ABO37685; ABO37686; ABO37687; ABO37688; ABO37689; ABO37690; ABO37691; ABO37692;
ABO37693; ABO37694; ABO37695; ABO37696; ABO37697; ABO37698; ABO37699; ABO37700;
ABO37701; ABO37702; ABO37703; ABO37704; ABO37705; ABO37706; ABO37707; ABO37708;
ABO37709; ABO37710; ABO37711; ABO37712; ABO37713; ABO37714; ABO37715; ABO37716;
ABO37717; ABO37718; ABO37719; ABO37720; ABO37721; ABO37722; ABO37723; ABO37724; ABO37725; ABO37726; ABO37727; ABO37728; ABO37729; ABO37730; ABO37731; ABO37732;
ABO37733; ABO37734; ABO37735; ABO37736; ABO37737; ABO37738; ABO37739; ABO37740;
ABO37741; ABO37742; ABO37743; ABO37744; ABO37745; ABO37746; ABO37747; ABO37748;
ABO37749; ABO37750; ABO37751; ABO37752; ABO37753; ABO37754; ABO37755; ABO37756;
ABO37757; ABO37758; ABO37759; ABO37760; ABO37761; ABO37762; ABO37763; ABO37764; ABO37765; ABO37766; ABO37768; ABO37769; ABO37770; ABO37771; ABO37772; ABO37773;
ABO37774; ABO37775; ABO37776; ABO37777; ABO37778; ABO37779; ABO37780; ABO37781;
ABO37782; ABO37783; ABP35587; ABP35588; ABP35589; ABP35590; ABP35591; ABP35592;
ABP35593; ABP35594; ABP35595; ABP35596; ABP35597; ABP35598; ABP35599; ABP35600;
ABP35601; ABP35602; AAA43178; AAA43182; AAA43187; AAA43200; AAA43184; AAA43195; AAA62328; AAA62335; AAA62329; AAA62331; AAA62327; AAA62330; AAA62339; AAA62338;
AAA62332; AAA43230; AAA43229; AAA43228; AAA43227; AAA43226; ABG66978; ABE73717;
ABG66979; ABG66980; ABG66981; ABG57281; ABG57282; ABG57283; ABG57284; AAA62470;
AAA64229; AAA64228; AAB36975; AAB36976; AAB36977; AAB36978; AAB36979; AAB36980;
AAB19009; AAB19010; AAB19011; AAB19012; AAB19013; AAB19014; AAB19015; AAB19016; AAB19017; AAB19018; AAB19019; AAB19020; AAB19021; AAB19022; AAB19023; AAB19024;
AAB19025; AAB19028; AAB19026; AAB19027; AAA43143; AAA43144; AAA43145; AAA43146;
AAA43147; AAA43148; AAA43149; AAA43211; AAA43212; AAA43275; AAA43114; AAA43105;
AAA43111; AAA43100; AAA43107; AAA43101; AAA43109; AAA43110; AAA43112; AAA43102;
AAA43103; AAO49821; AAA43163; AAA43164; AAA43099; AAA43239; AAA43155; AAA43156;
AAA43162; AAA43165; AAA43151; ABF60581; ABF60577; ABF60576; ABF60580; ABF60579; ABF60578; AAB27733; AAB33340; AAA85781; AAA18781; AAA18782; AAC79579; AAA87553;
AAB09413; AAB09414; AAB09415; AAB09416; AAB09417; AAB09418; AAB09419; AAB09420;
AAB09421; AAA92927; AAB02560; AAD00123; AAD00124; AAC80152; AAD00125; AAD00126;
AAC80153; AAD00127; AAD00128; AAC80154; AAF24003; AAC08288; AAC08289; AAC08290;
AAC08291; AAC08292; AAC08293; AAC08294; AAC08295; AAC08296; AAC08297; AAB58297; CAA24269; CAA24270; CAA24271; CAA24273; CAA24281; CAA24290; CAA24291; CAA29337;
CAA48482; CAA51904; CAA51905; CAA51906; CAA53437; CAA59412; CAA59413; CAA59414;
CAA59415; CAA59416; CAA59417; CAA64893; CAA64894; CAA74382; CAA74383; CAA74384;
CAA74385; CAA74386; CAA74387; CAA74388; CAA86526; CAA86527; CAA86528; CAA86529;
CAA86530; CAA86531; CAA86532; CAA86533; CAA86534; CAA86535; CAA86536; CAA86537; CAA86538; CAA86539; CAA86540; CAA86541; CAA86542; CAA86543; CAA86544; CAA86545;
CAA86546; CAA86547; CAA86548; CAA86549; CAA86550; CAA86551 and CAA86552.
[00125] Protein sequences of influenza virus subtype H4 haemagglutinin suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI) Entrez protein search and retrieval system::
[00126] BAF43432; BAF43456; ABB87539; ABB87550; ABB87561; ABB87572; ABB87583;
ABB87594; ABB87604; ABB87615; ABB87626; ABB87637; ABB87648; ABB87656; ABB87667;
ABB87678; ABB87689; ABB87700; ABB88194; ABB88267; ABB88298; ABI47995; ABI48017;
ABG88223; ABG88234; ABI92225; ABI84388; ABI84423; ABI84483; ABI84604; ABI84643; ABI84795; ABI84885; ABI84894; ABI84905; ABI92203; ABI92214; AB 197487; ABL67033; ABL67088;
ABO51840; ABO51851; ABO51873; ABO51895; ABO51906; ABO51928; ABO51939; ABO51950;
ABO52192; ABO52500; ABO52511; ABO52533; ABO52654; ABO52665; ABO52687; BAA14332;
AAY88147; AAY88148; AAY88149; AAY8815O; AAY88151; AAY88152; AAY88153; AAY88154;
AAY88155; AAY88156; AAY88157; AAY88158; AAY88159; AAY88160; AAY88161; AAY88162; AAY88163; AAY88164; AAY88165; AAY88166; AAY88167; ABB80525; ABC59902; ABI17551;
ABJ53168; AAA43179; AAA43216; AAA43217; AAA43218; AAA43219; AAA43220; AAA43221;
AAA43222; AAA43223; AAA43224; BAF43458; BAF46756; BAF46758; BAF46904; BAF48476;
BAF48478; AAG17427; AAG17429; AAF99711; CAD45001; CAD45000; AAN83962; AAN83963;
AAN83964; AAN83965; AAN83966; AAN83967; AAN83968; AAN83969; AAN83970; AAN83971; AAT09640; AAT09641; AAT09642; AAT65318; AAT65320; AAT65322; AAT65335; AAT65336;
AAT65338; AAT65346; AAT65347; ABB19802; ABB19847; ABB19867; ABB19878; ABB19886;
ABB20362; ABB20372; ABB87473; ABB87484; ABB87495; ABB87506; ABB90165; ABB87517 and
ABB87528.
[00127] Protein sequences of influenza virus subtype H5 haemagglutinin suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI) Entrez protein search and retrieval system::
[00128] AB166862; AB188816; AB188824; AB189053; AB 189061; AB212054; AB212280;
AB212649; AB233319; AB233320; AB233321; AB233322; AB239125; AB241614; AB241615;
AB241616; AB241617; AB241618; AB241619; AB241620; AB241621; AB241622; AB241623; AB241624; AB241625; AB241626; AB259712; AB261853; AB263192; AB263752; AB275420;
AB275421; AB275422; AB275423; AB275424; AB275425; AB275426; AB275427; AB275428;
AB275429; AB275430; AB275431; AB275432; AB275433; AB275434; AB284324; AB295603;
AF028709; AF036356; AF046080; AF046088; AF046096; AF046097; AF046098; AF046099; AF046100;
AF057291; AF082034; AF082035; AF082036; AF082037; AF082038; AF082039; AF082040; AF082041; AF082042; AF082043; AF084279; AF084280; AF084281; AF084532; AF098537; AF098538; AF098539;
AF098540; AF098541; AF098542; AF098543; AF098544; AF098545; AF098546; AF100179; AF100180;
AF102671; AF102672; AF102673; AF102674; AF102675; AF102676; AF102677; AF102678; AF102679;
AF102680; AF102681; AF102682; AF144305; AF148678; AF164655; AF164656; AF164657; AF164658;
AF164659; AF164660; AF164661; AF164662; AF164663; AF164664; AF164665; AF194169; AF194990; AF194991; AF194992; AF216713; AF216721 ; AF216729; AF216737; AF290443; AF303057; AF364334;
AF377870; AF398417; AF398418; AF420254; AF439407; AF439408; AF468837; AF501234; AF501235;
AF509016; AF509017; AF509018; AF509019; AF509020; AF509021; AF509022; AF509023; AF509024;
AF509025; AF509026; AF509027; AF509028; AF509029; AF509030; AF509031; AF509032; AF509033;
AF509034; AF509035; AF509036; AF509037; AF509038; AF509039; AJ305306; AJ621807; AJ621811; AJ632268; AJ632269; AJ715872; AJ867074; AJ971297; AJ971298; AJ972673; AM087222; AM183669;
AM183670; AM183671; AM183672; AM183673; AM183674; AM183675; AM183676; AM183677;
AM231714; AM236074; AM262541; AM262542; AM262543; AM262546; AM262547; AM262553;
AM262572; AM397634; AM400972; AM400973; AM400974; AM400975; AM400976; AM400977;
AM400978; AM400979; AM400980; AM400981; AM403460; AM403461; AM403462; AM403463; AM403464; AM403465; AM403466; AM403467; AM403468; AM403469; AM403470; AM403471;
AM403472; AM403473; AM403474; AM403475; AM408209; AM408210; AM408211; AM408212;
AM408213; AM408214; AM408215; AM408216; AM492165; AY059474; AY059475; AY059476;
AY059477; AY059478; AY059479; AY059480; AY059481; AY059482; AY075027; AY075030;
AY075033; AY221521; AY221522; AY221523; AY221524; AY221525; AY221526; AY221527; AY221528; AY221529; AY296064; AY296065; AY296066; AY296067; AY296068; AY296069;
AY296070; AY296071; AY296072; AY296073; AY296074; AY296075; AY296076; AY296077;
AY296078; AY296079; AY296080; AY296081; AY296082; AY296083; AY296084; AY296085;
AY296086; AY497063; AY497064; AY497065; AY497066; AY497067; AY497068; AY497069;
AY497070; AY497071; AY497072; AY497073; AY497074; AY497075; AY497076; AY497077;
AY497078; AY497079; AY497080; AY497081; AY497082; AY497083; AY497084; AY497085; AY497086; AY497087; AY497088; AY497089; AY497090; AY497091; AY497092; AY497093;
AY497094; AY497095; AY497096; AY500365; AY518362; AY526745; AY531029; AY534913;
AY534914; AY535020; AY535021; AY535022; AY535023; AY536212; AY552000; AY552001;
AY553784; AY553785; AY553786; AY553787; AY553788; AY553789; AY553790; AY553791;
AY553792; AY553793; AY553794; AY553795; AY553796; AY553797; AY553798; AY553799; AY553800; AY553801; AY553802; AY553803; AY553804; AY553805; AY553806; AY553807;
AY553808; AY553809; AY553810; AY553811; AY555150; AY555153; AY573917; AY574187;
AY574190; AY575869; AY575870; AY575871; AY575872; AY575873; AY575874; AY575875;
AY575876; AY575877; AY575878; AY575879; AY575880; AY576927; AY576930; AY577314;
AY585357; AY585358; AY585359; AY585360; AY585361; AY585362; AY585363; AY585364; AY585365; AY585366; AY585367; AY585368; AY585369; AY585370; AY585371; AY585372;
AY585373; AY585374; AY585375; AY585376; AY585377; AY590563; AY590568; AY590569;
AY590570; AY590571; AY590572; AY590577; AY609312; AY623430; AY626143; AY627885;
AY639405; AY646167; AY646175; AY646424; AY649382; AY651320; AY651321; AY651322;
AY651323; AY651324; AY651325; AY651326; AY651327; AY651328; AY651329; AY651330; AY651331; AY651332; AY651333; AY651334; AY651335; AY651336; AY651337; AY651338;
AY651339; AY651340; AY651341; AY651342; AY651343; AY651344; AY651345; AY651346;
AY651347; AY651348; AY651349; AY651350; AY651351; AY651352; AY651353; AY651354;
AY651355; AY651356; AY651357; AY651358; AY651359; AY651360; AY651361; AY651362;
AY651363; AY651364; AY651365; AY651366; AY651367; AY651368; AY651369; AY651370; AY651371; AY651372; AY651373; AY653200; AY676033; AY676034; AY676035; AY676036;
AY679514; AY684706; AY684894; AY720942; AY720945; AY720950; AY724783; AY724785;
AY724787; AY724789; AY724791; AY724793; AY724795; AY728892; AY728894; AY737289;
AY737296; AY737304; AY741213; AY741215; AY741217; AY741219; AY741221; AY747609;
AY747617; AY770079; AY770991; AY779048; AY779050; AY786078; AY818135; AY818136; AY818137; AY830774; AY834279; AY842935; AY849793; AY854190; AY861372; AY866475;
AY950230; AY950231; AY950232; AY950233; AY950234; AY950235; AY950236; AY972539;
AY972540; AY972541; AY972542; AY995883; AY995884; AY995885; AY995886; AY995887;
AY995888; AY995889; AY995890; AY995891; AY995892; AY995893; AY995894; AY995895;
AY995896; AY995897; AY995898; CY005575; CY005918; CY005926; CY005927; CY005969; CY006028; CY006036; CY006040; CYOl 1248; CY014168; CY014177; CY014185; CY014193;
CY014197; CY014198; CY014199; CY014200; CY014201; CY014202; CY014203; CY014204;
CY014205; CY014206; CY014207; CY014208; CY014209; CY014210; CY014211; CY014212;
CY014213; CY014272; CY014280; CY014288; CY014296; CY014303; CY014311; CY014368;
CY014376; CY014384; CY014393; CY014401; CY014409; CY014417; CY014425; CY014433;
CY014441; CY014449; CY014457; CY014465; CY014477; CY014481; CY014489; CY014497; CY014510; CY014518; CY014529; CY014537; CY014543; CY014580; CY014615; CY014640;
CY014642; CY014717; CY014722; CY014726; CY014849; CY014872; CY014984; CY015073;
CY015081; CY015089; CY015115; CY016276; CY016284; CY016292; CY016300; CY016611;
CY016779; CY016787; CY016795; CY016803; CY016811; CY016819; CY016827; CY016835;
CY016843; CY016851; CY016859; CY016867; CY016875; CY016883; CY016891; CY016899; CY016907; CY016915; CY016923; CY016931; CY016939; CY016947; CY017027; CY017035;
CY017043; CY017051; CY017059; CY017067; CY017179; CY017187; CY017403; CY017638;
CY017646; CY017654; CY017662; CY017670; CY017678; CY017688; CY018949; CY019352;
CY019360; CY019368; CY019376; CY019384; CY019392; CY019400; CY019408; CY019416;
CYO 19424; CYO 19432; CY020229; CY020349; CY020621; CY020629; CY020637; CY020645; CY020653; CY020661; CY020669; CY020677; CY020693; CY020701; CY020709; CY021373;
CY021381; CY021389; CY021397; CY021517; CY021525; DQ003215; DQ007623; DQ017270;
DQ017271; DQ017272; DQ017273; DQ017274; DQ017275; DQ017276; DQ017277; DQ017278;
DQ017279; DQ017280; DQ017281; DQ017282; DQ017283; DQ017284; DQ017285; DQ017286;
DQ017287; DQ017288; DQ017289; DQ017290; DQ017291; DQ017292; DQ017293; DQ017294; DQ017295; DQ017296; DQ017297; DQ017298; DQ017299; DQ017300; DQ017301; DQ017302;
DQ017303; DQ017304; DQ017305; DQ017306; DQ017307; DQ017308; DQ023145; DQ076201;
DQ080022; DQ083550; DQ083551; DQ083552; DQ083553; DQ083554; DQ083555; DQ083556;
DQ083557; DQ083558; DQ083559; DQ083560; DQ083561; DQ083562; DQ083563; DQ083564;
DQ083565; DQ083566; DQ083567; DQ083568; DQ083569; DQ083570; DQ083571; DQ083572; DQ083573; DQ083574; DQ083575; DQ083576; DQ083577; DQ083578; DQ083579; DQ083580;
DQ083581; DQ083582; DQ083583; DQ083584; DQ083585; DQ092869; DQ095612; DQ095613;
DQ095614; DQ095615; DQ095616; DQ095617; DQ095618; DQ095619; DQ095620; DQ095621;
DQ095622; DQ095623; DQ095624; DQ095625; DQ095626; DQ095627; DQ095628; DQ095629;
DQ095630; DQ095631; DQ099755; DQ099756; DQ099757; DQ099758; DQ099759; DQ099760; DQ100554; DQ100555; DQ100556; DQ100557; DQ104701; DQ122147; DQ137873; DQ153251;
DQ153252; DQ182483; DQ188905; DQ188906; DQ188907; DQ188908; DQ190857; DQ190858;
DQ190859; DQ190860; DQ190861; DQ191688; DQ191689; DQ201829; DQ211922; DQ211923;
DQ211924; DQ211925; DQ212792; DQ230521; DQ230522; DQ231240; DQ231241; DQ231242;
DQ236077; DQ236085; DQ251447; DQ251796; DQ251797; DQ251798; DQ251799; DQ251800; DQ256383; DQ279301; DQ309440; DQ320137; DQ320875; DQ320876; DQ320877; DQ320878;
DQ320879; DQ320880; DQ320881; DQ320882; DQ320883; DQ320884; DQ320885; DQ320886;
DQ320887; DQ320888; DQ320889; DQ320890; DQ320891; DQ320892; DQ320893; DQ320894;
DQ320895; DQ320896; DQ320897; DQ320898; DQ320899; DQ320900; DQ320901; DQ320902;
DQ320903; DQ320904; DQ320905; DQ320906; DQ320907; DQ320908; DQ320909; DQ320910;
DQ320911; DQ320912; DQ320913; DQ320914; DQ320915; DQ320916; DQ320917; DQ320918; DQ320919; DQ320920; DQ320921; DQ320922; DQ320923; DQ320924; DQ320925; DQ320926;
DQ320927; DQ320928; DQ320929; DQ320930; DQ320931; DQ320932; DQ320933; DQ320934;
DQ320935; DQ320936; DQ320937; DQ320938; DQ320939; DQ320940; DQ323672; DQ334760;
DQ334768; DQ334776; DQ340848; DQ343150; DQ343151; DQ343152; DQ343502; DQ356886;
DQ358746; DQ360835; DQ363918; DQ363923; DQ364996; DQ365004; DQ366306; DQ366314; DQ366322; DQ366330; DQ366338; DQ371928; DQ371929; DQ371930; DQ372591; DQ387854;
DQ389158; DQ399540; DQ399547; DQ406728; DQ407519; DQ412997; DQ434889; DQ435200;
DQ435201; DQ435202; DQ440535; DQ447199; DQ449031; DQ449632; DQ449640; DQ453141;
DQ458992; DQ464354; DQ464377; DQ497642; DQ497643; DQ497644; DQ497645; DQ497646;
DQ497647; DQ497648; DQ497649; DQ497650; DQ497651; DQ497652; DQ497653; DQ497654; DQ497655; DQ497656; DQ497657; DQ497658; DQ497659; DQ497660; DQ497661; DQ497662;
DQ497663; DQ497664; DQ497665; DQ497666; DQ497667; DQ497668; DQ497669; DQ497670;
DQ497671; DQ497672; DQ497673; DQ497674; DQ497675; DQ497676; DQ497677; DQ497678;
DQ497679; DQ497680; DQ497681; DQ497682; DQ497683; DQ497684; DQ497685; DQ497686;
DQ497687; DQ497688; DQ497689; DQ497690; DQ497691; DQ497692; DQ497693; DQ497694; DQ497695; DQ497696; DQ497697; DQ497698; DQ497699; DQ497700; DQ497701; DQ497702;
DQ497703; DQ497704; DQ497705; DQ497706; DQ497707; DQ497708; DQ497709; DQ497710;
DQ497711; DQ497712; DQ497713; DQ497714; DQ497715; DQ497716; DQ497717; DQ497718;
DQ497719; DQ497720; DQ497721; DQ497722; DQ497723; DQ497724; DQ497725; DQ497726;
DQ497727; DQ497728; DQ497729; DQ515984; DQ530173; DQ535724; DQ643809; DQ643982; DQ644955; DQ644956; DQ644957; DQ644958; DQ644959; DQ650659; DQ650663; DQ659113;
DQ659326; DQ659327; DQ659679; DQ661910; DQ666146; DQ673901; DQ676830; DQ676834;
DQ676838; DQ676840; DQ767725; DQ826532; DQ835313; DQ836043; DQ837587; DQ837588;
DQ837589; DQ837590; DQ8385O8; DQ838509; DQ838516; DQ838517; DQ840519; DQ840533;
DQ842487; DQ842489; DQ845348; DQ851561; DQ852600; DQ861291; DQ861999; DQ862000; DQ862001; DQ862002; DQ862003; DQ863503; DQ864711; DQ864715; DQ864716; DQ864717;
DQ864718; DQ864719; DQ864720; DQ864721; DQ885610; DQ885612; DQ885614; DQ885616;
DQ885618; DQ914808; DQ914814; DQ991231; DQ992714; DQ992715; DQ992716; DQ992717;
DQ992718; DQ992719; DQ992720; DQ992721; DQ992722; DQ992723; DQ992724; DQ992725;
DQ992726; DQ992727; DQ992728; DQ992729; DQ992730; DQ992731; DQ992732; DQ992733; DQ992734; DQ992735; DQ992736; DQ992737; DQ992738; DQ992739; DQ992740; DQ992741;
DQ992742; DQ992743; DQ992744; DQ992745; DQ992746; DQ992747; DQ992748; DQ992749;
DQ992750; DQ992751; DQ992752; DQ992753; DQ992754; DQ992755; DQ992756; DQ992757;
DQ992758; DQ992759; DQ992760; DQ992761; DQ992762; DQ992763; DQ992764; DQ992765;
DQ992766; DQ992767; DQ992768; DQ992769; DQ992770; DQ992771; DQ992772; DQ992773;
DQ992774; DQ992775; DQ992776; DQ992777; DQ992778; DQ992779; DQ992780; DQ992781; DQ992782; DQ992783; DQ992784; DQ992785; DQ992786; DQ992787; DQ992788; DQ992789;
DQ992790; DQ992791; DQ992792; DQ992793; DQ992794; DQ992795; DQ992796; DQ992797;
DQ992798; DQ992799; DQ992800; DQ992801; DQ992802; DQ992803; DQ992804; DQ992805;
DQ992806; DQ992807; DQ992808; DQ992809; DQ992810; DQ992811; DQ992812; DQ992813;
DQ992814; DQ992815; DQ992816; DQ992817; DQ992818; DQ992819; DQ992820; DQ992821; DQ992822; DQ992823; DQ992824; DQ992825; DQ992826; DQ992827; DQ992828; DQ992829;
DQ992830; DQ992831; DQ992832; DQ992833; DQ992834; DQ992835; DQ992836; DQ992837;
DQ992838; DQ992839; DQ992840; DQ992841; DQ992842; DQ992843; DQ992844; DQ992845;
DQ992846; DQ992847; DQ992848; DQ992849; DQ992850; DQ992851; DQ992852; DQ992853;
DQ992854; DQ992855; DQ992856; DQ992857; DQ992858; DQ992859; DQ992860; DQ992861; DQ992862; DQ992863; DQ992864; DQ992865; DQ992866; DQ992867; DQ992868; DQ992869;
DQ992870; DQ992871; DQ992872; DQ992873; DQ992874; DQ992875; DQ992876; DQ992877;
DQ992878; DQ992879; DQ992880; DQ992881; DQ992882; DQ992883; DQ992884; DQ992885;
DQ992886; DQ992887; DQ992888; DQ992889; DQ992890; DQ992891; DQ992892; DQ992893;
DQ992894; DQ992895; DQ992896; DQ992897; DQ992898; DQ992899; DQ992900; DQ992901; DQ992902; DQ992903; DQ992904; DQ992905; DQ992906; DQ992907; DQ992908; DQ992909;
DQ992910; DQ992911; DQ992912; DQ992913; DQ992914; DQ992915; DQ992916; DQ992917;
DQ992918; DQ992919; DQ992920; DQ992921; DQ992922; DQ992923; DQ992924; DQ992925;
DQ992926; DQ992927; DQ992928; DQ992929; DQ992930; DQ992931; DQ992932; DQ992933;
DQ992934; DQ992935; DQ992936; DQ992937; DQ992938; DQ992939; DQ992940; DQ992941; DQ992942; DQ992943; DQ992944; DQ992945; DQ992946; DQ992947; DQ992948; DQ992949;
DQ992950; DQ992951; DQ992952; DQ992953; DQ992954; DQ992955; DQ992956; DQ992957;
DQ992958; DQ992959; DQ992960; DQ992961; DQ992962; DQ992963; DQ992964; DQ992965;
DQ992966; DQ992967; DQ992968; DQ992969; DQ992970; DQ992971; DQ992972; DQ992973;
DQ992974; DQ992975; DQ992976; DQ992977; DQ992978; DQ992979; DQ992980; DQ992981; DQ992982; DQ992983; DQ992984; DQ992985; DQ992986; DQ992987; DQ992988; DQ992989;
DQ992990; DQ992991; DQ992992; DQ992993; DQ992994; DQ992995; DQ992996; DQ992997;
DQ992998; DQ992999; DQ993000; DQ993001; DQ993002; DQ993003; DQ993004; DQ993005;
DQ993006; DQ993007; DQ993008; DQ993009; DQ993010; DQ993011; DQ993012; DQ993013;
DQ993014; DQ993015; DQ993016; DQ993017; DQ993018; DQ993019; DQ993020; DQ993021; DQ993022; DQ993023; DQ993024; DQ993025; DQ993026; DQ993027; DQ993028; DQ993029;
DQ993030; DQ993031; DQ993032; DQ993033; DQ993034; DQ993035; DQ993036; DQ993037;
DQ993038; DQ993039; DQ993040; DQ993041; DQ993042; DQ993043; DQ993044; DQ993045;
DQ993046; DQ993047; DQ993048; DQ993049; DQ993050; DQ993051; DQ993052; DQ993053;
DQ993054; DQ993055; DQ993056; DQ993057; DQ993058; DQ993059; DQ993060; DQ993061;
DQ993062; DQ993063; DQ993064; DQ993065; DQ993066; DQ993067; DQ993068; DQ993069; DQ993070; DQ993071; DQ993072; DQ993073; DQ993074; DQ993075; DQ993076; DQ993077;
DQ993078; DQ993079; DQ993080; DQ993081; DQ993082; DQ993083; DQ993084; DQ993085;
DQ993086; DQ993087; DQ993088; DQ993089; DQ993090; DQ993091; DQ993092; DQ993093;
DQ993094; DQ993095; DQ993096; DQ993097; DQ993098; DQ993099; DQ993100; DQ993101;
DQ993102; DQ993103; DQ993104; DQ993105; DQ993106; DQ993107; DQ993108; DQ993109; DQ993110; DQ993111; DQ993112; DQ993113; DQ993114; DQ993115; DQ993116; DQ993117;
DQ997076; DQ997087; DQ997094; DQ997102; DQ997111; DQ997122; DQ997123; DQ997133;
DQ997163; DQ997182; DQ997218; DQ997219; DQ997253; DQ997262; DQ997268; DQ997276;
DQ997283; DQ997308; DQ997325; DQ997352; DQ997355; DQ997361; DQ997370; DQ997377;
DQ997392; DQ997396; DQ997405; DQ997410; DQ997513; DQ997522; DQ997531; DQ997538; DQ997547; DQ999872; DQ999880; DQ999887; EF041479; EF042614; EF042615; EF042616; EF042617;
EF042618; EF042619; EF042620; EF042621; EF042622; EF042623; EF042624; EF061116; EF090647;
EF090648; EF090649; EF090650; EF107522; EFl 10518; EFl 10519; EF124794; EF165048; EF165049;
EF165050; EF165051; EF165052; EF165053; EF165054; EF165055; EF165056; EF165057; EF165058;
EF165059; EF165060; EF165061; EF165062; EF165063; EF165064; EF165065; EF165066; EF200512; EF200513; EF205154; EF205155; EF205156; EF205157; EF205158; EF205159; EF205160; EF382359;
EF395844; EF395845; EF419242; EF419243; EF441263; EF441276; EF441277; EF441278; EF441279;
EF441280; EF441281; EF446771; EF446779; EF447430; EF451059; EF456780; EF456781; EF456795;
EF456798; EF456799; EF456802; EF456803; EF456805; EF467802; EF469650; EF469651; EF469652;
EF469653; EF469654; EF469655; EF469656; EF469657; EF469658; EF469659; EF469660; EF473068; EF473069; EF473070; EF473073; EF473074; EF473075; EF473080; EF473081; EF474450; J02160;
J04325; L46585; L46586; L46587; M10243; M18001; M18450; M18451; M30122; S68489; U05330;
U05331; U05332; U20460; U20472; U20473; U20474; U20475; U28919; U28920; U37165; U37166;
U37167; U37168; U37169; U37170; U37171; U37172; U37173; U37174; U37175; U37176; U37177;
U37178; U37179; U37180; U37181; U37182; U67783; U69277; U79448; U79449; U79450; U79451; U79452; U79453; U79454; U79455; U79456; X07826 and X07869.
[00129] Protein sequences of influenza virus subtype H6 haemagglutinin suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI) Entrez protein search and retrieval system:: [00130] BAF36386; BAF41914; CAC83641; CAC83642; CAC83644; CAC83645; CAC83646;
CAC81274; CAC81276; CAC81279; CAC84237; CAC84238; CAC84239; CAC84240; CAC84241;
CAC84242; CAC84243; CAC84244; CAD20327; CAD45192; CAD45193; CAD45194; CAD45195;
CAD45196; CAD45197; CAD45198; CAG27343; CAG27344; CAG27345; CAG27346; CAG27347;
AAT65326; AAT65328; AAT65330; AAT65332; AAT65340; AAT65341; AAT65342; AAT65343;
AAT65344; AAT65350; AAV91218; AAX07773; AAV41833; AAW78053; AAX78820; ABB18391; ABB18402; ABB18476; ABB 18951; ABB18962; ABB18973; ABB18978; ABB18994; ABB19011;
ABB19020; ABB19026; ABB19032; ABB19042; ABB19055; ABB19072; ABB19083; ABB19094;
ABB19101; ABB19107; ABB19118; ABB19129; ABB19140; ABB19151; ABB19162; ABB19173;
ABB19184; ABB19195; ABB19206; ABB19217; ABB19228; ABB19239; ABB19360; ABB19371 ;
ABB19382; ABB19393; ABB19404; ABB19585; ABB19596; ABB19947; ABB20283; ABB20294; ABB20387; ABB21783; ABO52005; ABG88267; ABI20804; ABI30356; ABI84387; ABI84457;
ABI84466; ABI84473; ABI84516; ABI84663; ABI84827; ABI84838; ABI84866; ABI84916; ABI84927;
ABI85172; AB 192192; ABI92236; AB 192247; ABI95151; AB 195162; ABI95173; AB 195184; ABI95195;
ABJ16576; ABL67154; ABL75574; ABM21971; ABM21993; ABM22004; ABO51917; ABO51961;
ABO51972; ABO51983; ABO51994; ABO52016; ABO52027; ABO52049; ABO52159; ABO52181; ABO52203; ABO52478; ABO52489; ABO76979; ABP49283; BAA14333; AAZ04680; AAZ04681 ;
AAZ04682; AAZ04683; AAZ04684; AAZ04685; AAZ04686; AAZ04687; AAZ04688; AAZ04689;
AAZ04690; AAZ04691; AAZ04692; AAZ04693; AAZ04694; AAZ04695; AAZ04696; AAZ04697;
AAZ04698; AAZ04699; AAZ04700; AAZ04701; AAZ04702; AAZ04703; AAZ04704; AAZ04706;
AAZ04707; AAZ04708; AAZ04709; AAZ04710; AAZ04711; AAZ04712; AAZ04713; AAZ04714; AAZ04715; ABB8883O; ABD35522; ABD35523; ABD35524; ABD35525; ABD35526; ABD35527;
ABD35528; ABD35529; ABD35530; ABD35531; ABD35532; ABD35533; ABD35534; ABD35535;
ABD35536; ABD35537; ABD35538; ABD35539; ABD35540; ABD35541; ABD35542; ABD35543;
ABD35544; ABD35545; ABD35546; ABD35547; ABD35548; ABD35549; ABD35550; ABD35551;
ABD35552; ABD35553; ABD35554; ABD35555; ABD35556; ABD35557; ABD65973; ABD65981; ABD65988; ABH03489; ABH03497; AAA43198; BAF47393; BAF47395; BAF47399; BAF48480;
BAF48639; BAF49413; AAF04721; AAF87507; AAG38550; AAG38551; AAG38552; AAM69944;
AAM69945; AAM69946; AAM69947; AAM69948; AAM69949; AAM69950; AAM69951; AAM69962;
AAM69973; AAM69983; AAM69993; AAM70005; AAM70007; AAO33479; AAO33480; AAO33481;
AAO33482; AAO33483; AAO33484; AAO33485; AAO33486; AAO33487; AAO33488; CAC81746; CAC81747; CAC84981; CAC84982; CAC85087; CAC84852; CAC84860; CAC85O8O; CAC85O81;
CAC85082; CAC85083; CAC85084 and CAC85085.
[00131] Protein sequences of influenza virus subtype H7 haemagglutinin suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI) Entrez protein search and retrieval system::
[00132] BAE96029; AAD26924; AAG10680; AAL37237; AAL37238; AAL37239; AAL37240;
AAL37241; AAL37242; AAK58912; AAK58913; AAK58914; AAK58915; AAK58916; AAK58917;
AAK58918; AAK58919; AAK58920; AAK58921; AAK58922; AAK58923; AAK58924; AAK58925;
AAK58926; AAK58927; AAK58928; AAK58929; AAK58930; AAK58931; AAK58932; AAK58933;
AAK58934; AAK58935; AAK58936; AAK58937; AAK58938; AAK58939; AAK58940; AAK58941 ; AAK58942; AAK58943; AAK58944; AAK58945; AAK58946; AAK58947; AAK58948; AAK58949;
AAK58950; AAK58951; AAM19228; AAM19229; AAM19230; AAM19231; AAM19232; AAM19233;
AAM19234; AAM19235; AAM19236; CAD33826; CAD37074; CAD38049; CAD38050; CAD38051;
CAD38052; CAD38053; CAD38054; CAD38282; CAD38283; CAD38284; CAD38285; CAD38286;
CAD38287; CAD38288; CAE45011; CAE48276; CAF04466; CAF33017; CAF33020; CAG27348; CAG27349; CAG28943; CAG28944; CAG28945; CAG28956; CAG28957; CAG28958; CAG28959;
CAJ32548; CAJ32557; AAO86904; AAO86905; AAO86906; AAO86907; AAO86908; AAO86909;
AAO86910; AAO86911; AAO86912; AAO86913; AAO86914; AAO86915; AAO86916; AAO86917;
AAO86918; AAO86919; AAO86920; AAO86921; AAO86922; AAO86923; AAO86924; AAO86925;
AAO86926; AAO86927; AAO86928; AAO86929; AAO86930; AAO86931; AAO86932; AAO86933; AAO86934; AAO86935; AAO86936; AAO86937; AAO86938; AAO86939; AAO86940; AAO86941 ;
AAO86942; AAO86943; AAO86944; AAO86945; AAO86946; AAO86947; AAO86948; AAO86949;
AAO86950; AAO86951; AAO86952; AAQ77402; AAQ77403; AAQ77404; AAQ77405; AAQ77406;
AAQ77407; AAR02636; AAR02637; AAR02638; AAR02639; AAR02640; AAR02641; AAR02642;
AAR02643; AAQ90292; AAS68158; AAT37403; AAT37404; AAT37405; AAT37406; AAT02538; AAT38819; AAT66415; AAT78582; AAT70170; AAT69348; AAV74187; AAU00821; AAU25838;
AAU25943; AAU85295; AAU33999; AAU44367; AAU50675; AAV98693; AAV98694; AAV98695;
AAY20940; AAY46207; AAY46208; AAY46209; AAY46210; AAY46211; AAY46212; AAY46213;
AAY46214; AAY46215; AAY46216; AAY46217; AAY46218; AAY46219; AAY46220; AAY46221;
ABB87303; ABB87751; ABB87762; ABB87773; ABB87784; ABB87800; ABB87822; ABB87833; ABB87854; ABB88289; ABB88359; ABI84433; ABI84462; ABI84599; ABI84602; ABI84683;
ABI84694; ABI84849; ABI84981 ; ABI85000; ABI85011 ; ABI85029; ABI85038; ABI85084; ABI95206;
ABM21982; ABO44145; ABO44156; ABO44167; ABO44178; ABO44189; ABO45248; ABO52060;
ABO52698; ABO52709; ABO52764; ABO52775; ABO52786; ABO76990; ABO77001; ABO77012;
ABO77056; ABO77067; ABO77078; ABO77089; ABP49206; ABP49228; AAY21164; AAY87433; AAY87443; ABF69256; ABG57088; ABG57089; ABG57090; ABG57091; ABG57092; ABG57093;
ABH04379; ABH04385; ABH05673; ABI26074; ABI26075; ABJ90226; ABJ90237; ABJ90248;
ABJ90259; ABJ90270; ABJ90280; ABO21714; ABO21715; AAA43192; AAR96248; AAA56803;
AAA92244; AAA92245; AAA92246; AAA43152; AAA43154; AAA43150; AAA43237; AAA43087;
AAA43174; AAC54376; AAC54377; AAC54379; AAC54380; AAC54381; AAC54382; AAC54383; AAC54384; AAC54385; AAC54386; AAC54387; AAC54388; AAC54389; CAA43815; CAA44429;
CAA44430; CAA44431; CAA44432; CAA44433; CAA44434; CAA44435; CAA44436; CAA44437;
CAA78263; CAA87393; BAE96040; BAE96041; BAE96042; BAE96043; BAE96044; BAE96045;
BAF02913; BAF02930; BAF02931; BAF02932; BAF02933; BAF02934; BAF03206; BAF03525;
BAF03526; BAF49200; BAF49202; BAF49411; AAC40998; AAC40999; AAD19847; AAD19848;
AAD26922; AAD26923; AAD26925; AAD26926; AAD26927; AAD26928; AAD26929; AAD26930; AAD26931; AAD26932; AAD26933; AAD26934; AAD26935; AAD26936; AAD26937; AAD26938;
AAD26939; AAD26940; AAD26941; AAD37422; AAG10650; AAG10651; AAG10652; AAG10653;
AAG10654; AAG10655; AAG10656; AAG10657; AAG10658; AAG10659; AAG10660; AAG10661;
AAG10662; AAG10663; AAG10664; AAG10665; AAG10666; AAG10667; AAG10668; AAG10669;
AAG10670; AAG10671; AAG10672; AAG10673; AAG10674; AAG10675; AAG10676; AAG10677; AAG10678 and AAG10679.
[00133] Protein sequences of influenza virus subtype H8 haemagglutinin suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI) Entrez protein search and retrieval system:: [00134] BAF43468; AAG38554; AAG38555; AAG38556; ABB87722; ABB87729; ABB87740;
ABI84428; ABI84519; ABI85240; ABL67099; BAA14334; ABK32094 and AAA43177.
[00135] Protein sequences of influenza virus subtype H9 haemagglutinin suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI) Entrez protein search and retrieval system::
[00136] AAA43208; AAD48995; AAD48996; AAD48997; AAD48998; AAD48999; AAD49000;
AAF00701; AAF00702; AAF00703; AAF00704; AAF00705; AAF00706; AAF00707; AAF00708;
AAF00709; AAF00710; AAF00711; AAF00712; AAF15580; AAF15581; AAF15582; AAF15583;
AAF69255; AAF69256; AAF69257; AAF69258; AAF69259; AAF69260; AAF69261; AAF69262; AAG48164; AAG48165; AAG48166; AAG48167; AAG48168; AAG48169; AAG48170; AAG48171;
AAG53035; AAG53036; AAG53037; AAG53038; AAG53039; AAG53040; AAG53041; AAG53042;
AAG53043; AAG53044; AAG53045; AAG53046; AAG53047; AAG53048; AAG53049; AAG53050;
AAG53051; AAG53052; AAG53053; AAG53054; AAG53055; AAG53056; AAG53057; AAG53058;
AAG53059; AAG53060; AAG53061; AAG53062; AAG53063; AAG53064; AAG53065; AAG53066; AAG53067; AAG53068; AAG53069; AAK62979; AAK64189; AAL14080; AAL14081; AAL30486;
AAL30487; AAL32475; AAL32476; AAL32477; AAL32478; AAL32479; AAL65235; AAL65236;
AAL65237; AAL65238; AAL65239; AAL65240; AAL65241; AAL65242; AAL65243; AAL65244;
AAL65245; AAL65246; AAL65247; AAL65248; AAL65249; AAL65250; AAL65251; AAL65252;
AAL65253; AAL65254; AAL65255; AAL65256; AAL65257; AAL65258; AAM03341; AAM03342; AAN05676; AAN05677; AAN05678; AAN05679; AAN05680; AAN05681; AAN05682; AAN05683;
AAN05684; AAN05685; AAN83972; AAN83973; AAN83974; AAN83975; AAN83976; AAN83977;
AAN83978; AAN83979; AAN83980; AAN83981; AAN83982; AAN83983; AAN83984; AAN83985;
AAN83986; AAN83987; AAO46077; AAO46078; AAO46079; AAO46080; AAO46081; AAO46082;
AAO46083; AAO46084; AAO46085; AAO46086; AAO47744; AAO47745; AAO47746; AAO47747;
AAO47748; AAO47749; AAO47750; AAO47751; AAO47752; AAP23303; AAP41031; AAP41032; AAP41033; AAP41034; AAP41035; AAP47821; AAP49029; AAP49030; AAP49031; AAP49032;
AAP49033; AAP49034; AAP49035; AAP49036; AAP49037; AAP49038; AAP49039; AAP49040;
AAP49041; AAP49042; AAP49043; AAP49044; AAP49045; AAP49046; AAP49047; AAP97867;
AAQ04843; AAQ04844; AAQ04845; AAQ04846; AAQ04847; AAQ04848; AAQ04849; AAQ04850;
AAQ04851; AAQ04852; AAQ04853; AAQ04854; AAQ04855; AAQ04856; AAQ04857; AAQ04858; AAQ04859; AAQ04860; AAQ04861; AAQ04862; AAQ04863; AAQ63104; AAQ63105; AAQ63106;
AAQ63107; AAQ63108; AAQ63109; AAQ63110; AAQ63111; AAQ63112; AAQ63113; AAQ63114;
AAQ63115; AAQ63116; AAQ63117; AAQ63118; AAQ63119; AAQ67246; AAQ97375; AAQ97376;
AAQ97377; AAQ97378; AAQ97379; AAR08917; AAR08918; AAR98872; AAS48376; AAS48377;
AAS48378; AAS48379; AAS48380; AAS48381; AAS48382; AAS48383; AAS48384; AAS48385; AAS48386; AAS48387; AAS48388; AAS48389; AAS48390; AAS48391; AAS48392; AAT12413;
AAT37508; AAT45076; AAT65317; AAT65323; AAT65337; AAT65339; AAT70836; AAU00107;
AAU00108; AAU00109; AAU11147; AAU11148; AAU11149; AAU11150; AAU11151; AAU11152;
AAUl 1153; AAUl 1154; AAUl 1155; AAUl 1156; AAUl 1157; AAUl 1158; AAUl 1159; AAUl 1160;
AAUl 1161; AAUl 1162; AAUl 1163; AAUl 1164; AAUl 1165; AAV30213; AAV52598; AAV52599; AAV52600; AAV52601; AAV52602; AAV52603; AAV52604; AAV52605; AAV67992; AAV68000;
AAV68014; AAV68022; AAV68030; AAV68031; AAV68032; AAV68037; AAW29075; AAW29076;
AAW29077; AAW29078; AAW29079; AAW29080; AAW50825; AAW50826; AAW78038; AAW78039;
AAW78040; AAW78041 ; AAW78042; AAW78043; AAW78044; AAW78045; AAW78046; AAX32895;
AAX32896; AAX51299; AAY27556; AAY52492; AAY52493; AAY52494; AAY52495; AAY52496; AAY52497; AAY52498; AAY52499; AAY52500; AAY52501; AAY52502; AAY52503; AAY52504;
AAY52505; AAY52506; AAY52507; AAY52508; AAY52509; AAY52510; AAY52511; AAY52512;
AAY52513; AAY52514; AAY52515; AAY52516; AAY52517; AAY52518; AAY52519; AAZ14102;
AAZ14103; AAZ14104; AAZ14105; AAZ14106; AAZ14107; AAZ14108; AAZ14109; AAZ14110;
AAZ14111; AAZ14112; AAZ14113; AAZ14114; AAZ14115; AAZ14116; AAZ14117; AAZ14118; AAZ14119; AAZ14120; AAZ14121; AAZ14122; AAZ14123; AAZ14124; AAZ14125; AAZ14126;
AAZ14127; AAZ14128; AAZ14129; AAZ14977; AAZ14978; AAZ14979; AAZ14980; AAZ14981;
AAZ14982; AAZ14983; AAZ14984; AAZ14985; AAZ14986; AAZ14987; AAZ14988; AAZ14989;
AAZ14990; AAZ14991; AAZ14992; AAZ14993; AAZ14994; AAZ14995; AAZ14996; AAZ14997;
AAZ14998; AAZ14999; AAZ15000; AAZ15001; AAZ15002; AAZ15003; AAZ15004; AAZ15005; AAZ15006; AAZ15007; AAZ15008; AAZ15009; AAZ15010; AAZ15011; AAZ15012; AAZ15013;
AAZ15014; ABB03902; ABB17027; ABB17191; ABB19481; ABB19693; ABB20314; ABB20324;
ABB20444; ABB51137; ABB58945; ABB58946; ABB58947; ABB58948; ABB58949; ABB58950;
ABB58951; ABB58952; ABB58953; ABB58954; ABB58955; ABB87163; ABB87314; ABB87366;
ABB87864; ABB87875; ABB87886; ABB87896; ABB87907; ABB87918; ABB87929; ABB87939;
ABB87950; ABB88247; ABB88390; ABB90182; ABB90203; ABB90214; ABC48798; ABC48808; ABC48818; ABC48828; ABC48838; ABD61024; ABE02148; ABE27712; ABE27713; ABE27714;
ABE27715; ABE27716; ABE27717; ABE27718; ABE28413; ABF56623; ABF56632; ABF56641;
ABG27038; ABG27042; ABG27051; ABG27056; ABH12262; ABI17549; ABI17550; ABI84463;
ABI84523; ABI94767; ABI94782; ABI96694; AB 196715; AB 196777; ABI97307; ABJ15706; ABKOOl 13;
ABK00119; ABK00143; ABK41621; ABK59023; ABM21875; ABM21876; ABM21877; ABM21878; ABM21879; ABM21880; ABM21881; ABM46227; ABM46228; ABM46229; ABM46230; ABM46231;
ABM46232; ABM46233; ABM46234; ABM46235; ABM46236; ABM46237; ABM46238; ABM46239;
ABM46240; ABM46241; ABM46242; ABM46243; ABM46244; ABM46245; ABM46246; ABM46247;
ABM46248; ABM46249; ABM46250; ABM46251; ABM46252; ABM46253; ABM46254; ABM46255;
ABM46256; ABM46257; ABM46258; ABM46259; ABM46260; ABM46261; ABM46262; ABM46263; ABM46264; ABM46265; ABM46266; ABM46267; ABM46268; ABM46269; ABM46270; ABM46271;
ABM46272; ABM46273; ABM46274; ABM46275; ABM46276; ABM46277; ABM46278; ABM46279;
ABM46280; ABM46281; ABM46282; ABM46283; ABM46284; ABM46285; ABM46286; ABM46287;
ABM46288; ABM46289; ABM46290; ABM46291; ABM46292; ABM46293; ABM46294; ABM46295;
ABM46296; ABM46297; ABM46298; ABM46299; BAA14335; BAB39511; BAB39512; BAB85614; BAB85615; BAB85616; BAB85617; BAB85618; BAD01514; BAD01515; BAD01516; BAD01517;
BAD01518; BAE96033; BAF34373; BAF46427; BAF46437; BAF46447; BAF46457; BAF46467;
BAF46477; BAF46487; BAF46497; BAF46507; BAF46517; BAF46527; BAF48357; CAB95856;
CAB95857; CAC19694; CAD60401; CAD60402; CAD60403; CAH04111; CAH04112; CAH04113;
CAH04114; CAH04115; CAH04116; CAH04117; CAH04118; CAH04119; CAH04120; CAJ32552; CAJ32553; CAL15444 and CAL15445.
[00137] Protein sequences of influenza virus subtype HlO haemagglutinin suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI) Entrez protein search and retrieval system:: [00138] BAF03631; BAF31846; ABB87989; ABB88OOO; ABB88O11; ABB88022; ABB88033;
ABB88044; ABI84469; ABI84499; ABI84534; ABI84626; ABL67143; ABO52082; ABO52093;
ABO52115; ABD23975; AAA43186; AAA79774; AAA79775; BAF43464; BAF46762; BAF46908;
BAF47127; BAF48645; AAG33016; CAJ32549; CAJ32550; ABB87206; ABB87217; ABB87325;
ABB87844; ABB87956; ABB87967 and ABB87978. [00139] Protein sequences of influenza virus subtype Hl 1 haemagglutinin suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and
are available to the public via the National Center for Biotechnology Information (NCBI) Entrez protein search and retrieval system::
[00140] BAF34926; BAF43435; ABD91535; ABD66294; ABD66295; ABD66296; ABD66297;
ABD66298; ABF22671; ABM54148; AAA43188; AAA43191; AAA43183; AAA43203; AAA43181; BAF47125; BAF47129; BAF48643; BAF49417; AAG38553; AAV91221; ABB87228; ABB87239;
ABB88055; ABB88066; ABB88077; ABB88O88; ABI84440; ABI84442; ABI84545; ABI84556;
ABI84600; ABI84723; ABJ53570; ABL67121; ABL67231; ABL75585; ABO52137; ABO52148;
ABO52170; ABO52390; ABO52401; ABO52412; ABO52434; ABO52445; ABO52456; ABO52544;
ABO52555; ABO76924; ABO76935; ABO76968; ABP49195; ABP49239; ABP49250; ABP49261; ABP49272; ABP49294; BAA14336; AAY85533; ABC59903; ABD91532; ABD91533 and ABD91534.
[00141] Protein sequences of influenza virus subtype H12 haemagglutinin suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI) Entrez protein search and retrieval system:: [00142] BAF43416; BAF43433; AAG38557; AAG38558; AAG38559; CAL15446; ABB87195;
ABB87249; ABB88099; ABB8811O; ABB88121; ABG88278; ABI84446; ABI84489; ABJ09129;
ABL67077; ABL67242; ABO52610; ABO52621; BAA14337; ABI17552 and AAA43180.
[00143] Protein sequences of influenza virus subtype Hl 3 haemagglutinin suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI) Entrez protein search and retrieval system::
[00144] BAF37821; BAF38383; BAF46906; CAJ32554; CAJ32555; AAV91212; AAV91213;
ABB86511; ABB87334; ABB87345; ABB87811; ABI84452; ABI84566; ABI84601; BAA14338;
ABG57285; AAA43213; AAA43214 and AAA43215. [00145] Protein sequences of influenza virus subtype H14 haemagglutinin suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI) Entrez protein search and retrieval system::
[00146] BAF43460 and ABI84453. [00147] Protein sequences of influenza virus subtype Hl 5 haemagglutinin suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI) Entrez protein search and retrieval system::
[00148] ABB88138; ABB88320; ABB88331; AAA96134; ABB90704; BAF48363; ABB88132 and AAA92247.
[00149] Protein sequences of influenza virus subtype Hl 6 haemagglutinin suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI) Entrez protein search and retrieval system:: [00150] ABB87356; ABI84447; ABI85221; AAV91214; AAV91215; AAV91216 and AAV91217.
[00151] Nucleic acid sequences encoding influenza virus subtype Hl haemagglutinins suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI)
Entrez nucleotide search and retrieval system: [00152] AF222026; AF222034; AF222036; AF503481; AF503483; AY180460; AF534030;
AF534045; AF534052; AY604795; AY604797; AY604798; AY604804; AY604806; CY004490;
CY004539; CY006355; CY006779; CY009324; CY010092; CY010172; CY010228; CY010284;
CY010324; CY010340; CY010996; CYOl 1208; M59325; CY013565; CY013581; CY016563; CY017139;
EF462556; EF462564; CY020173; CY021709; CY021749; CY021821; AB243744; AB255389; AB255390; AB255392; AB271115; X57491; AF222030; AF222031; AF222032; AF222033; AF503484;
AF503485; AF503486; AF534048; AF534049; AY377936; AY604799; AY604800; AY604801;
AY604802; AY604803; AY684125; DQ058215; CY003016; CY004498; CY005866; CY008148;
CY009204; CY009276; CY009628; CY010108; CY010292; CY010300; CY010316; CYOl 1012;
CYOl 1072; CYOl 1088; CYOl 1168; CYOl 1184; CYOl 1224; CY014627; CY014968; CY016052; CY016699; CY017123; CY017219; CY019763; CY019867; CY019883; EF467821; EF462563; X57493;
Z46437; Z54288; L20111; L20113; L25072; U11858; L33780; L19022; L19016; L19014; M38312;
L19006; L19024; K01331; U85986; AY029292; AF320059; AF320060; AF320062; AY129156;
AF503475; AF503477; AY299509; AY297156; AY303741; AY701753; CY002672; CY002984;
CY003688; CY003761; CY006419; DQ265706; DQ280203; CY009444; CY009868; CY009964; CY010556; CY010868; DQ666649; DQ666650; CY012440; DQ978382; DQ978389; DQ978390;
EF462570; EF462571; CY020181; CY020861; CY021029; CY021693; CY021733; AB274304; Z46434;
Z46435; Z46436; AJ289702; L19028; L19019; L19018; L19008; L19027; J02144; L19017; L19026;
L24362; AY029288; AY029289; AF320063; AF503478; AF503479; AF503480; AY303747; CY000449;
CY002360; CY002648; CY002688; CY003024; DQ249260; CY006107; CY003833; CY006667; CY006675; DQ280195; DQ280227; DQ280236; DQ280243; DQ280250; CY006867; CY009532;
M34335; M33748; AF131993; AF131994; AF222027; AF222028; AF222035; AF503482; AF534027;
AF534031; AF534038; AF534043; AF534044; AF534046; AF534053; AF534054; AY604796;
AY604805; AY604807; AY604808; AY682833; CY002704; CY004504; CY004531; CY004546;
CY005735; CY006363; CY003769; CY009220; CY009332; DQ397950; CY009452; DQ431990; CY010156; CY010164; CY010180; CY010236; CY010276; CY010332; M81707; CYOl 1176; CYOIl 192;
CY011200; CY011216; CY015580; CY016308; CY016311; CY016313; CY016317; CY016318;
CY016321; CY016327; CY016328; CY016331; CY016435; CY017003; CY017195; CY017235;
CY017251; CY019101; CY020469; CY020485; AB043478; AB043483; AB043484; AB043491;
AB043493; AB043494; X17221; J04572; J04574; L33480; L33482; L33487; L33489; L33490; L33755;
L33743; L33745; L33747; L33753; U11703; U08903; U53162; S62154; S67220; U80948; U45451; U46943; AF305218; CY009756; CY009764; CY009780; CY009844; CY009956; CY010572; CY010740;
CY010780; CY011952; DQ666648; CY013271; DQ981739; DQ978383; CY014733; CY015524;
CY016228; CY016314; CY016315; CY016316; CY016324; CY016325; CY016326; CY016955;
CY017011; CY017315; CY019085; CY020421; CY020437; CY020509; AB043480; AB043481;
AB043486; AB043487; AB043490; AB043495; AB043496; AB043497; AB043500; AB294217; L33483; L33484; L33485; L33486; L33492; L33493; CYOl 1584; M59324; M59326; CY013573; CY013589;
CY016643; CYO18885; CY019205; CY019771; CY019875; CY019963; CY019971; EF462565;
CY020917; CY021701; CY021717; CY021725; AB243745; AB255391; AB255393; AB255397;
AB255398; AB271113; X57492; Z30276; Z54289; L20109; L20112; L20110; L25071; M73975; L19015;
L19549; M38353; K01330; J02176; L19025; L19013; L19023; U03719; U03720; U72666; AY029291; AF320057; AF320058; AF320061; AF131995; AF250124; AF268312; AF268313; AF222029; AF534025;
AF534026; AF534047; AF534050; AF534051; CY001952; CY003288; CY004507; CY004592;
CY009212; CY009596; DQ447187; CYOlOlOO; CYOlOl 16; CY010212; CY010220; CY010308;
CYOl 1004; CYOl 1080; CYOl 1152; CYOl 1160; CYOl 1232; M59327; M59328; CY012888; CY017115;
CY017203; CY017211; CY017227; CY019739; CY019755; CY020189; CY021053; CY021757; CY021797; AB255394; AB255395; AB255396; X57494; X59778; AF398875; AF455679; AF455681;
AF494246; AF494249; AF494250; AY289927; AY299499; AY299500; AY299502; CY002152;
CY002616; CY002800; CY004466; CY004474; CY004482; DQ335992; DQ335995; CY009540;
CY009612; CY009620; CY009796; CY009980; CY010356; CY010364; CY010380; CY010428;
CY010444; CY010524; CY010540; DQ508897; DQ534416; CYOl 1280; CYOl 1296; CYOl 1304; CY011392; CY012296; CY013821; CY013837; CY013853; CY013597; CY013871; CY016337;
CY016338; CY016343; U02085; L09063; L33750; L33751; L33752; U37727; U38242; U53163; U80949;
U46020; U46021; U46782; U46783; U46941; U46942; AF398878; AF455678; AY095226; AY095227;
AF494251; AY289928; AY289929; AY633212; CY002536; CY002632; CY003000; DQ335998;
CY009884; CY010372; CY009916; CYO1O388; CY010404; CY010460; CY010476; CY010492; CY010500; DQ508905; CY010764; CYOl 1240; CYOl 1312; CY012856; CY012864; CY012880;
CY013032; CY015163; AF320067; AF503474; AF503476; AY299508; AY297157; AY303734;
DQ139320; CY002352; CY002696; CY002992; CY003696; CY003704; DQ280212; DQ280219;
CY006875; CY009772; CY009972; CY010804; CY010876; DQ666651; CY012824; CY013287;
DQ978387; DQ978388; DQ978391; CY016196; CY016309; CY016310; CY016312; CY016319; CY016320; CY016322; CY016329; CY016330; CY020293; CY020453; CY020461; CY020477;
AB043479; AB043482; AB043485; AB043492; VO1O88; X17224; J04573; CY016334; CY016335;
CY016340; CY016341; CY016342; CY016347; CY016350; CY016357; CY016360; CY016361;
CY016365; CY016366; CY016367; CY016370; CY017371; CY017869; CY019069; CY020237;
CY020253; CY020261; U47310; AF026157; AF026160; AF091313; AF362778; AF362779; AF362784;
AF362785; AF362786; AF362787; AF362794; AF362795; AF362796; AF362803; AF386775; AF386776; AF386777; AF386782; AF386783; AY038014; AY038338; AY038339; AY038344; AY038345;
AY038346; L33481; L33488; L33491; L33756; L33744; L33746; L33754; L19005; K00992; U44482;
U45452; AF398874; AF455680; AF494247; AF494248; AY299497; AY299498; AY299501; AY299503;
CY002808; CY004458; CY006187; CY006195; DQ335993; DQ335994; CY009548; CY009604;
CY009788; CY009804; CY009876; CY009892; CY010348; CY010412; CY010420; CY010436; CY010452; CY010508; CY010532; DQ508873; DQ508889; CY010772; DQ534415; DQ534417;
DQ534418; CYOl 1272; AY038347; AY038354; AY038355; AY038356; AY038357; AY060038;
AY060044; AY233393; AY790289; AY851464; AY851465; AY851466; AY851467; AY971006;
AY971007; AY971010; AY971011; DQ100426; DQ100427; CY002392; CY003296; CY003376;
CY003392; CY003464; CY003480; CY006395; CY006403; DQ335999; DQ415318; CY009292; CY009316; CY009828; CY009940; CY010148; CY010204; CY010244; CY010828; CY010844;
CY010884; CY010916; CY010924; CY010940; CY010956; CYOl 1608; CYOl 1776; CY016344;
CY016346; CY016354; CY016363; CY016364; CY016371; CY016373; CY017363; CY017427;
CY017435; CY019045; CY020269; CY021005; D00406; D00837; D00839; D10477; D29656; U47305;
U47307; U96766; AF026153; AF026154; AF026156; AF055426; AF091309; AF091310; AF091312; AF362781; AF362783; AF362788; AF362791; AF362797; AF362798; AF362800; AF362802; AF386773;
AF386774; AF386780; AY038335; AY038337; AY038341; AY038343; AY038351; AY038353;
CY013829; CY013845; CY013879; CY015167; CY016336; CY016339; CY016345; CY016352;
CY016355; CY016362; CY016372; CY016459; CY017419; CY020277; D00407; DOO838; D13570;
D29657; U47304; U47306; U47308; AF026155; AF085413; AF117241; AF091308; AF091311; AF091317; AF362780; AF362782; AF362789; AF362790; AF362792; AF362799; AF362801; AF386779;
AF386781; AF387491; AY038334; AY038336; AY038340; AY038342; AY038349; AY038350;
AY038352; AY060031; AY038358; AF408859; AY060032; AY060039; AY060045; AY060047;
AY060048; AY063229; AY184805; AY851463; AY851471; AY971003; AY971004; DQ118159;
DQ118160; DQ118162; CY002528; CY003304; CY003328; CY003672; CY006171; CY006387; DQ336002; DQ336005; CY008524; CY008996; CY009172; CY009188; CY009228; CY009284;
CY009340; CY010076; CY010132; CYO1O188; CY010268; CY010908; CY010964; CY010980;
CY012608; CYOl 1040; CY014007; DQ986134; CY016374; CY016380; CY016386; CYOl 1792;
CY013303; DQ978392; CY016244; CY016375; CY016376; CY016377; CY016382; CY016383;
CY016391; CY016392; CY016393; DQ973300; CY019125; CY019221; CY019237; CY019923; CY020141; CY020157; CY020165; AB117167; AB117170; AB117171; AB117176; AB117177;
AB117183; AB117192; AB117193; AB117203; AB117212; AB117213; AB117221; AB126622;
AJ412708; AJ412709; AJ344013; AJ457868; AJ457869; AJ457878; AJ457879; AJ457884; AJ457885;
AJ457886; AJ457894; AJ457895; AJ457904; AY060033; AY060034; AY060040; AY060046;
AY060049; AY060050; AY063228; AF342821; AY590823; AY590824; AY790267; AY701755;
AY851462; AY851469; AY851470; AY851472; AY861443; AY971005; DQ118158; DQ118161; DQ118163; CY003312; CY003320; CY003400; CY006427; CY006411; DQ336003; DQ336004;
CY008988; DQ415316; CY009180; CY009196; CY009236; CY010196; CY010252; CY010260;
CY010892; CY010900; CY010972; CY012800; CY016379; CY016381; CY016385; CY016387;
CY016388; CY016389; CY016390; DQ973301; DQ973303; DQ973304; CY016971; CY017275;
EF101749; CY017717; CY017725; CY017829; CY018933; CY019117; CY019779; CY019795; CY019803; CY020565; AB117166; AB117173; AB117174; AB117180; AB117182; AB117189;
AB117190; AB117196; AB117199; AB117200; AB117202; AB117209; AB117210; AB117216;
ABl 17219; ABl 17220; AB126630; AJ412712; AJ344002; AJ344019; AJ344020; AJ344009; AJ344010;
AJ344012; AJ344022; AJ457865; AJ457872; AJ457875; AJ457881; CY016723; DQ973299; DQ973302;
EF101741; CY017813; CY019109; CY020573; CY021629; AB117165; AB117172; AB117175; AB117181; AB117187; AB117188; AB117191; AB117197; AB117198; AB117201; AB117207;
ABl 17208; ABl 17211; ABl 17217; ABl 17218; AJ412711; AJ344017; AJ344018; AJ344021; AJ344003;
AJ344008; AJ344011; AJ457863; AJ457864; AJ457866; AJ457873; AJ457874; AJ457880; AJ457882;
AJ457889; AJ457890; AJ457896; AJ457899; AJ457900; AJ457902; AJ457906; AJ457909; AJ457910;
AJ457887; AJ457888; AJ457891; AJ457897; AJ457898; AJ457901; AJ457907; AJ457908; AJ457911; AJ489854; AJ489856; AJ517814; AJ517816; Z46441; Z54286; Z54287; L20106; L20117; L20116;
L20108; L20107; U11857; L19021; L19011; L19020; L19012; U72667; U72668; U72669; AY029287;
AY029290; AF320056; AF320064; AF320065; AF320066; AF503473; AY299506; AY299507;
AY297154; AY297155; AY619961; CY002624; CY002640; CY002664; CY002680; CY003008;
CY006747; CY006915; CY009860; CY010580; CY010852; DQ666644; DQ666645; DQ666646; DQ666647; CY013279; CY013295; DQ978384; DQ978385; DQ978386; CY014901; CY015443;
CY015532; CY016260; CY016323; CY016963; CY017019; CY017243; CY019077; CY019093;
CY019997; CY020429; CY020445; CY021037; AB043488; AB043489; AB043498; AB043499; U04857;
U04858; U04859; L33757; L33758; L33748; L33749; U08904; U80950; AF455675; AF455676;
AF455677; AF455682; AF389118; AY289930; AY282756; AY282757; AY299494; AY299495; AY299496; AY299504; AY299505; CY002568; CY002400; CY002656; DQ335991; DQ335996;
DQ335997; CY009812; CY010396; CY010468; CY010484; DQ508857; DQ534419; CYOl 1408;
CY012304; CY012872; CY013040; CY013813; CY016332; CY016333; CY016348; CY016349;
CY016358; CY016359; CY016368; CY016369; CY016691; CY017147; CY017155; CY017379;
CY017877; CY019053; CY019061; CY019947; CY019955; CY020245; CY020285; D00840; D00841; D10163; D13571; D13572; D13573; D13574; D28518; D31949; U47309; AF026158; AF026159;
AF085414; AJ457905; AJ489852; AJ489853; AJ489860; AJ489861; AJ489862; AJ517813; AJ517817;
AJ517820; AJ489855; AJ489857; AJ489858; AJ517815; AF085415; AF085416; AF085417; AF116575;
AFl 16576; AF091306; AF091307; AF091314; AF091315; AF091316; AF362793; AF386778;
AY038333; AY038348; AY052778; AY060030; AY060035; AY060036; AY060037; AY060041;
AY060042; AY060043; AY060051; AY060052; AY184806; AY590822; AY377929; AY851468; AY971008; AY971009; CY001680; DQl 18164 and CY003368.
[00153] Nucleic acid sequences encoding influenza virus subtype H2 haemagglutinins suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI)
Entrez nucleotide search and retrieval system: [00154] AB056699; AB266382; AY209954; AY209955; AY209956; AY209957; AY209958;
AY209959; AY209960; AY209961; AY209962; AY209963; AY209964; AY209965; AY209966;
AY209967; AY209968; AY209969; AY209970; AY209971; AY209972; AY209973; AY209974;
AY209975; AY209976; AY209977; AY209978; AY209979; AY209980; AY209981; AY209982;
AY209983; AY209984; AY209985; AY209986; AY209987; AY209988; AY209989; AY422014; AY422015; AY422016; AY422017; AY633180; AY633196; AY633228; AY633364; AY633388;
AY684893; CY003847; CY003855; CY003863; CY003871; CY003879; CY003887; CY003907;
CY003914; CY003922; CY003936; CY003944; CY003952; CY003960; CY003968; CY003976;
CY003984; CY003992; CY004554; CY005413; CY005538; CY005546; CY005765; CYOO58O8;
CY014556; CY014558; CY014601; CY014608; CY014609; CY014710; CY014821; CY014829; CY014976; CY015135; CY017693; CY018877; CY020317; CY020373; CY020381; CY020389;
CY020397; CY020405; CY020413; CY020517; CY020541; CY020549; CY021013; CY021021;
CY021069; CY021125; CY021789; CY021805; CY021813; D13575; D13576; D13577; D13578; D13579;
D13580; DQ006282; DQ006283; DQ009917; DQ017486; DQ017493; DQ508841; DQ5O8881; J02127;
J02154; L11125; L11126; L11127; L11128; L11129; L11130; L11131; L11132; L11133; L11134; L11135; L11136; L11137; L11138; L11139; L11140; L11141; L11142; L20406; L20407; L20408;
L20409; L20410; AB275406; AB275414; AB275620; AB275628; AB275861; AB276115; AB292785;
AB296074; AB298281; AF116197; AF116198; AF116199; AF116200; AF116201; AF116202;
AF116203; AF116204; AF116205; AF116206; AF116207; AF116208; AF116209; AF116210; AF116211;
AF231356; AF270716; AF270717; AF270718; AF270719; AF270720; AF270721; AF270722; AF270723; AF270724; AF270725; AF270726; AF270727; AF270728; AY180398; AY180399; AY180400;
AY180401; AY180402; AY180403; AY209952 and AY209953.
[00155] Nucleic acid sequences encoding influenza virus subtype H3 haemagglutinins suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI) Entrez nucleotide search and retrieval system:
[00156] AB013806; AB013807; ABO138O8; AB013809; AB013810; AB013811; AB013812;
AB013813; AB014060; AB014061; AB014062; AB019354; AB019355; AB019356; AB019357;
AB043705; AB043706; AB043707; AB043708; AB221016; AB221017; AB221018; AB221019;
AB221020; AB221021; AB221022; AB221023; AB221024; AB221025; AB221026; AB221027;
AB221028; AB221029; AB221030; AB221031; AB221032; AB221033; AB221034; AB221035; AB243867; AB243868; AB243869; AB243870; AB243871; AB243872; AB243873; AB246366;
AB259101; AB259102; AB259103; AB259104; AB259105; AB259106; AB259107; AB259108;
AB259109; AB259110; AB259111; AB259112; AB259739; AB259740; AB259741; AB262301;
AB262302; AB262303; AB262304; AB270992; AB270993; AB270994; AB270995; AB270996;
AB270997; AB270998; AB270999; AB271000; AB271001; AB271002; AB271489; AB271490; AB271491; AB271492; AB271493; AB271494; AB271495; AB271496; AB271497; AB271498;
AB271503; AB271504; AB271505; AB271506; AB271511; AB271512; AB271513; AB271514;
AB271515; AB271516; AB271517; AB271524; AB271525; AB271526; AB271527; AB271528;
AB271529; AB271530; AB271809; AB271810; AB271811; AB271812; AB271813; AB271814;
AB271815; AB271816; AB271817; AB271818; AB271819; AB271820; AB271821; AB271822; AB271823; AB271824; AB271825; AB271826; AB271827; AB271828; AB271829; AB271830;
AB271831; AB271832; AB271833; AB271834; AB271835; AB271836; AB271837; AB271838;
AB271839; AB271840; AB271841; AB271842; AB271843; AB271844; AB271845; AB271846;
AB271847; AB271848; AB271849; AB271850; AB275283; AB276113; AB277754; AB284320;
AB289341; AB292402; AB292410; AB292660; AB292668; AB295605; AF008656; AF008657; AF008658;AF008659;AF008660;AF008661;AF008662;AF008663;AF0086 64;AF008665;AF008666;
AF008667;AF008668;AF008669;AF008670;AF008671;AF008672;AF0 08673;AF008674;AF008675;
AF008676;AF008677;AF008678;AF008679;AF008680;AF008681;AF0 08682;AF008683;AF008684;
AF008685;AF008686;AF008687;AF008688;AF008689;AF008690;AF0 08691;AF008692;AF008693;
AF008694;AF008695;AF008696;AF008697;AF008698;AF008699;AF0 08700;AF008701;AF008702; AF008703;AF008704;AF008705;AF008706;AF008707;AF008708;AF0087 09;AF008710;AF008711;
AF008712;AF008713;AF008714;AF008715;AF008716;AF008717;AF0 08718;AF008719;AF008720;
AF008721;AF008722;AF008723;AF008724;AF008725;AF008726;AF0 08727;AF008728;AF008729;
AF008730;AF008731;AF008732;AF008733;AF008734;AF008735;AF0 08736;AF008737;AF008738;
AF008739;AF008740;AF008741;AF008742;AF008743;AF008744;AF0 08745;AF008746;AF008747; AF008748;AF008749;AF008750;AF008751;AF008752;AF008753;AF0087 54;AF008755;AF008756;
AF008757;AF008758;AF008759;AF008760;AF008761;AF008762;AF0 08763;AF008764;AF008765;
AF008766;AF008767;AF008768;AF008769;AF008770;AF008771;AF0 08772;AF008773;AF008774;
AF008775;AF008776;AF008777;AF008778;AF008779;AF008780;AF0 08781;AF008782;AF008783;
AF008784;AF008785;AF008786;AF008787;AF008788;AF008789;AF0 08790;AF008791;AF008792; AF008793;AF008794;AF008795;AF008796;AF008797;AF008798;AF0087 99;AFOO88OO;AFOO88O1;
AF008802;AFOO88O3;AF008804;AFOO88O5;AF008806;AF008807;AFO O88O8;AF008809;AFOO881O;
AFOO8811;AF008812;AFOO8813;AF008814;AFOO8815;AF008816;AF0 08817;AFOO8818;AF008819;
AF008820;AF008821;AF008822;AF008823;AF008824;AF008825;AF0 08826;AF008827;AF008828;
AF008829;AFOO883O;AFOO8831;AF008832;AF008833;AF008834;AF0 08835;AF008836;AF008837;
AFOO8838;AF008839;AF008840;AF008841;AF008842;AF008843;AF0 08844;AF008845;AF008846; AF008847;AF008848;AF008849;AFOO885O;AFOO8851;AF008852;AF0088 53;AF008854;AF008855;
AF008856;AF008857;AFOO8858;AF008859;AF008860;AF008861;AF0 08862;AF008863;AF008864;
AF008865;AF008866;AF008867;AF008868;AF008869;AF008870;AF0 08871;AF008872;AF008873;
AF008874;AF008875;AF008876;AF008877;AF008878;AF008879;AFO O888O;AFOO8881;AF008882;
AFOO8883;AF008884;AFOO8885;AF008886;AF008887;AFOO8888;AF0 08889;AF008890;AF008891; AF008892;AF008893;AF008894;AF008895;AF008896;AF008897;AF0088 98;AF008899;AF008900;
AF008901;AF008902;AF008903;AF008904;AF008905;AF008906;AF0 08907;AF008908;AF008909;
AF017270;AF017271;AF017272;AF038266;AF038267;AF038268;AF0 38269;AF038270;AF079570;
AF087700;AF087701;AF087702;AF087703;AF087704;AF087705;AF0 87706;AF087707;AF087708;
AF087709;AF092052;AF092053;AF092054;AF092055;AF092056;AF0 92057;AF092058;AF092059; AF092060;AF092061;AF092062;AF092063;AF092064;AF096306;AF0963 07;AF096308;AF096309;
AF096310;AF096311;AF096312;AF096313;AF096314;AF096315;AF0 96316;AF131996;AF131997;
AF131998;AF139930;AF139931;AF139932;AF139933;AF139934;AF1 39935;AF139936;AF139937;
AF139938;AF139939;AF139940;AF153232;AF153233;AF153234;AF1 53235;AF180564;AF180565;
AF180566;AF180567;AF180568;AF180569;AF180570;AFl80571;AFl 80572;AF180573;AF180574; AF180575;AF180576;AF180577;AF180578;AF180579;AF18O58O;AFl805 81;AFl80582;AF180583;
AF180584;AF180585;AF180586;AF180587;AF18O588;AF180589;AF1 80590;AFl80591;AFl80592;
AF180593;AF180594;AF180595;AF180596;AF180597;AF180598;AF1 80599;AF180600;AF180601;
AF180602;AF180603;AF180604;AF180605;AF180606;AF180607;AF1 80608;AF180609;AF180610;
AF180611;AF180612;AF180613;AF180614;AF180615;AF180616;AF1 80617;AF180618;AF180619; AF180620;AFl80621;AF180622;AF180623;AF180624;AF180625;AF1806 26;AF180627;AF180628;
AF180629;AF180630;AFl80631;AFl80632;AF180633;AF180634;AF1 80635;AF180636;AF180637;
AF180638;AF180639;AF180640;AFl80641;AFl80642;AF180643;AF1 80644;AF180645;AF180646;
AF180647;AF180648;AF180649;AF180650;AF180651;AF180652;AF1 80653;AF180654;AF180655;
AF180656;AF180657;AF180658;AF180659;AF180660;AF180661;AF1 80662;AF180663;AF180664; AF180665;AF180666;AF197241;AF197242;AF197243;AF197244;AF1972 45;AF197246;AF197247;
AF197248;AF197249;AF201842;AF201843;AF201844;AF201845;AF2 01846;AF201874;AF201875;
AF204238;AF213900;AF213901;AF213902;AF213903;AF225542;AF2 25543;AF225544;AF225545;
AF233691;AF251395;AF251403;AF251411;AF251419;AF251427;AF2 55019;AF255020;AF255021;
AF255022;AF255023;AF255024;AF255025;AF255026;AF255027;AF2 55028;AF255029;AF268123; AF268124;AF268125;AF268126;AF268127;AF268128;AF297094;AF2970 95;AF297096;AF297097;
AF311676;AF311677;AF311678;AF311679;AF311680;AF311681;AF3 11682;AF311683;AF311684;
AF311685; AF311686; AF311687; AF311688; AF311689; AF311690; AF311691; AF311692; AF311693;
AF311694; AF311695; AF311696; AF311697; AF311698; AF315559; AF315560; AF315561; AF315562;
AF315563; AF315564; AF315565; AF315566; AF315567; AF315568; AF315569; AF315570; AF315571;
AF316817; AF316818; AF316819; AF316820; AF316821; AF348176; AF357929; AF357930; AF357931; AF357932; AF357933; AF357934; AF357935; AF357936; AF357937; AF357938; AF357939; AF357940;
AF357941; AF357942; AF357943; AF357944; AF357945; AF357946; AF357947; AF357948; AF357949;
AF357950; AF357951; AF357952; AF357953; AF357954; AF357955; AF357956; AF357957; AF357958;
AF357959; AF357960; AF357961 ; AF357962; AF357963; AF357964; AF357965; AF357966; AF357967;
AF357968; AF357969; AF362804; AF362805; AF362806; AF362807; AF362808; AF362809; AF362810; AF362811; AF362812; AF362813; AF362814; AF362815; AF362816; AF362817; AF362818; AF362819;
AF362820; AF363502; AF363503; AF363504; AF368436; AF368437; AF368438; AF368439; AF368440;
AF368441; AF368442; AF368443; AF368444; AF368445; AF368446; AF382318; AF382319; AF382320;
AF382321; AF382322; AF382323; AF382324; AF382325; AF382326; AF382327; AF382328; AF386604;
AF386605; AF386606; AF386607; AF386608; AF386609; AF386610; AF386611; AF386612; AF386613; AF386614; AF386615; AF386616; AF386617; AF386618; AF386619; AF386620; AF386621; AF386622;
AF386623; AF386624; AF386625; AF386626; AF386627; AF386628; AF386629; AF386630; AF386631;
AF386632; AF386633; AF386634; AF400752; AF400753; AF400754; AF405206; AF405207; AF405208;
AF405209; AF405210; AF405211; AF405212; AF442455; AF442456; AF442457; AF442458; AF442459;
AF442460; AF442461; AF442462; AF442463; AF442464; AF442465; AF442466; AF442467; AF442468; AF442469; AF442470; AF442471 ; AF442472; AF442473; AF442474; AF442475; AF442476; AF442477;
AF442478; AF442479; AF442480; AF442481; AF442482; AF442483; AF450246; AF501515; AF501516;
AF501517; AF501518; AF501519; AF501520; AF501521; AF501522; AF501523; AF501524; AF501525;
AF501526; AF501527; AF501528; AF501529; AF501530; AF501531; AF501532; AF501533; AF501534;
AF501535; AF525217; AF525218; AF525219; AF525686; AF525799; AF533712; AF533713; AF533714; AF533715; AF533716; AF533717; AF533718; AF533719; AF533720; AF533721; AF533722; AF533723;
AF533724; AF533725; AF533726; AF533727; AF533728; AF533729; AF534013; AF534014; AF534015;
AF534016; AF534017; AF534018; AF534019; AF534020; AF534021; AF534022; AF534023; AF534024;
AF534028; AF534029; AF534032; AF534033; AF534034; AF534035; AF534036; AF534037; AF534039;
AF534040; AF534041; AF534042; AF534055; AF534056; AF534057; AF534058; AF534059; AF534060; AJ223192; AJ223193; AJ223194; AJ223195; AJ223196; AJ223197; AJ252129; AJ252130; AJ252131;
AJ252132; AJ293926; AJ293927; AJ293928; AJ293929; AJ293930; AJ293931; AJ293932; AJ293933;
AJ311454; AJ311466; AJ311511; AJ344023; AJ427297; AJ427304; AJ506781; AJ697863; AJ697864;
AJ697865; AJ697866; AJ704814; AJ704815; AJ704816; AJ746251; AJ841293; AM087217; AM087224;
AX350190; AX350204; AY032978; AY035588; AY035589; AY035590; AY035591; AY035592; AY048077; AY048078; AY048079; AY048080; AY048081; AY137206; AY138513; AY138515;
AY138516; AY138517; AY138518; AY138519; AY180404; AY180405; AY180406; AY180407;
AY180408; AY180409; AY180410; AY180411; AY180412; AY180413; AY180414; AY180415;
AY180416; AY180417; AY180418; AY180419; AY180420; AYl 80421; AY180422; AY180423;
AY180424; AY180425; AY180426; AY180427; AY180428; AY180429; AY180430; AYl 80431;
AY180432; AY180433; AY262744; AY262745; AY271794; AY273167; AY273168; AY303713; AY303717; AY303723; AY303731; AY303736; AY303743; AY303745; AY363509; AY363510;
AY363511; AY363512; AY363513; AY363514; AY363515; AY363516; AY363517; AY363518;
AY363519; AY363520; AY363521; AY363522; AY363523; AY363524; AY363525; AY363526;
AY377129; AY377537; AY377538; AY377539; AY377540; AY377541; AY377542; AY377543;
AY377544; AY377545; AY377546; AY377547; AY377924; AY377927; AY377933; AY383755; AY389349; AY389350; AY389351; AY389352; AY389353; AY389354; AY389355; AY389356;
AY389357; AY389358; AY389359; AY389360; AY462237; AY479982; AY531031; AY531033;
AY531035; AY531037; AY531039; AY531040; AY531041; AY531042; AY531043; AY531044;
AY531045; AY531046; AY531047; AY531048; AY531049; AY531050; AY531051; AY531052;
AY531053; AY531054; AY531055; AY531056; AY531057; AY531058; AY531059; AY531060; AY531061; AY589647; AY589648; AY589649; AY589650; AY589651; AY589652; AY589653;
AY589654; AY589655; AY589656; AY589657; AY589658; AY589659; AY589660; AY589661;
AY596799; AY596800; AY596801; AY604809; AY604810; AY604811; AY604812; AY604813;
AY604814; AY604815; AY604816; AY604817; AY604818; AY604819; AY604820; AY604821;
AY604822; AY604823; AY604824; AY604825; AY604826; AY604827; AY604828; AY604829; AY604830; AY619969; AY619977; AY625729; AY625730; AY625731; AY633132; AY633148;
AY633172; AY633244; AY633252; AY633340; AY633372; AY633996; AY633997; AY633998;
AY633999; AY634000; AY634001; AY634002; AY634003; AY634004; AY634005; AY634006;
AY634007; AY634008; AY634009; AY634010; AY634011; AY634012; AY634013; AY634014;
AY634015; AY634016; AY634017; AY634018; AY634019; AY634020; AY634021; AY634022; AY634023; AY634024; AY634025; AY634026; AY634027; AY634028; AY634029; AY634030;
AY634031; AY634032; AY634033; AY634034; AY634035; AY634036; AY634037; AY634038;
AY634039; AY634040; AY634041; AY634042; AY634043; AY634044; AY634045; AY634046;
AY634047; AY634048; AY634049; AY660991; AY660992; AY660993; AY660994; AY660995;
AY660996; AY660997; AY660998; AY660999; AY661000; AY661001; AY661002; AY661003; AY661004; AY661005; AY661006; AY661007; AY661008; AY661009; AY661010; AY661011;
AY661012; AY661013; AY661014; AY661015; AY661016; AY661017; AY661018; AY661019;
AY661020; AY661021; AY661022; AY661023; AY661024; AY661025; AY661026; AY661027;
AY661028; AY661029; AY661030; AY661031; AY661032; AY661033; AY661034; AY661035;
AY661036; AY661037; AY661038; AY661039; AY661040; AY661041; AY661042; AY661043; AY661044; AY661045; AY661046; AY661047; AY661048; AY661049; AY661050; AY661051;
AY661052; AY661053; AY661054; AY661055; AY661056; AY661057; AY661058; AY661059;
AY661060; AY661061; AY661062; AY661063; AY661064; AY661065; AY661066; AY661067;
AY661068; AY661069; AY661070; AY661071; AY661072; AY661073; AY661074; AY661075;
AY661076; AY661077; AY661078; AY661079; AY661080; AY661081; AY661082; AY661083;
AY661084; AY661085; AY661086; AY661087; AY661088; AY661089; AY661090; AY661091; AY661092; AY661093; AY661094; AY661095; AY661096; AY661097; AY661098; AY661099;
AY661100; AY661101; AY661102; AY661103; AY661104; AY661105; AY661106; AY661107;
AY661108; AY661109; AY661110; AY661111; AY661112; AY661113; AY661114; AY661115;
AY661116; AY661117; AY661118; AY661119; AY661120; AY661121; AY661122; AY661123;
AY661124; AY661125; AY661126; AY661127; AY661128; AY661129; AY661130; AY661131; AY661132; AY661133; AY661134; AY661135; AY661136; AY661137; AY661138; AY661139;
AY661140; AY661141; AY661142; AY661143; AY661144; AY661145; AY661146; AY661147;
AY661148; AY661149; AY661150; AY661151; AY661152; AY661153; AY661154; AY661155;
AY661156; AY661157; AY661158; AY661159; AY661160; AY661161; AY661162; AY661163;
AY661164; AY661165; AY661166; AY661167; AY661168; AY661169; AY661170; AY661171; AY661172; AY661173; AY661174; AY661175; AY661176; AY661177; AY661178; AY661179;
AY661180; AY661181; AY661182; AY661183; AY661184; AY661185; AY661186; AY661187;
AY661188; AY661189; AY661190; AY661191; AY661192; AY661193; AY661194; AY661195;
AY661196; AY661197; AY661198; AY661199; AY661200; AY661201; AY661202; AY661203;
AY661204; AY661205; AY661206; AY661207; AY661208; AY661209; AY661210; AY661211; AY695084; AY695085; AY695086; AY695087; AY695088; AY695089; AY695090; AY701752;
AY702440; AY702441; AY702442; AY702443; AY702444; AY702445; AY702446; AY702447;
AY714347; AY738729; AY779253; AY779254; AY851473; AY851474; AY851475; AY851476;
AY851477; AY852273; AY852274; AY852275; AY852276; AY852277; AY854046; AY854047;
AY854048; AY854049; AY855341; AY862607; AY862608; AY862609; AY862610; AY862611; AY862612; AY884276; AY884277; AY884278; AY884279; AY884280; AY884281; AY884282;
AY884283; AY884284; AY919314; AY945263; AY945264; AY945265; AY945266; AY945267;
AY945268; AY945269; AY945270; AY945271; AY945272; AY945273; AY945274; AY945275;
AY945276; AY945277; AY945278; AY945279; AY945280; AY945281; AY945282; AY945283;
AY945284; AY945285; AY945286; AY945287; AY945288; AY947474; AY947476; AY961997; AY961998; AY961999; AY962000; AY962001; AY962002; AY962003; AY962004; AY962005;
AY962006; AY962007; AY962008; AY962009; AY962010; AY962011; AY962012; AY962013;
AY962014; AY962015; AY962016; AY962017; AY963782; AY963783; AY963784; AY963785;
AY963786; AY963788; AY963789; AY963790; AY963791; AY963792; AY963793; AY963794;
AY963795; AY963796; AY968017; AY968018; AY968019; AY968020; AY968021; AY968022; AY968023; AY968024; AY968025; AY968026; AY968027; AY968028; AY968029; AY968030;
AY968031; AY968032; AY968033; AY968034; AY968035; AY968036; AY968037; AY968038;
AY968039; AY968040; AY968041; AY972827; AY972828; AY972829; AY972830; AY972831;
AY972832; AY972833; AY972834; AY972835; AY972836; AY972837; AY972838; AY972839;
AY972840; AY972841; AY972842; AY972843; AY972844; AY972845; AY972846; AY972847;
AY972848; AY972849; AY972850; AY972851; CS406467; CYOOOOOl; CY000009; CY000017; CY000025; CY000033; CY000041; CY000049; CY000057; CY000065; CY000073; CY000081;
CY000089; CY000097; CY000105; CYOOOl 13; CY000121; CY000129; CY000137; CY000145;
CY000153; CY000161; CY000169; CY000177; CY000185; CY000193; CY000201; CY000209;
CY000217; CY000225; CY000233; CY000241; CY000249; CY000257; CY000265; CY000273;
CY000281; CY000289; CY000297; CY000305; CY000313; CY000321; CY000329; CY000337; CY000345; CY000353; CY000361; CY000369; CY000377; CY000385; CY000393; CY000401;
CY000409; CY000417; CY000425; CY000433; CY000441; CY000457; CY000465; CY000473;
CY000481; CY000489; CY000497; CY000505; CY000513; CY000521; CY000529; CY000537;
CY000545; CY000553; CY000561; CY000569; CY000584; CY000585; CY000593; CY000601;
CY000609; CY000617; CY000625; CY000633; CY000641; CY000649; CY000657; CY000665; CY000673; CY000681; CY000689; CY000697; CY000705; CY000713; CY000721; CY000729;
CY000737; CY000745; CY000753; CY000761; CY000769; CY000777; CY000785; CY000793;
CY000801; CY000809; CY000817; CY000825; CY000833; CY000841; CY000849; CY000857;
CY000865; CY000873; CYOOO881; CY000889; CY000901; CY000909; CY000917; CY000925;
CY000933; CY000941; CY000949; CY000957; CY000965; CY000973; CY000981; CY000989; CY000997; CY001005; CY001013; CY001021; CY001029; CY001037; CY001045; CY001053;
CY001061; CY001064; CY001072; CY001080; CYOO1O88; CY001096; CYOOl 104; CYOOl 112;
CYOOl 120; CYOOl 128; CYOOl 136; CYOOl 144; CYOOl 152; CYOOl 160; CYOOl 168; CYOOl 176;
CY001184; CY001197; CY001205; CY001213; CY001221; CY001229; CY001237; CY001245;
CY001253; CY001261; CY001269; CY001277; CY001285; CY001293; CY001301; CY001309; CY001317; CY001325; CY001333; CY001341; CY001349; CY001357; CY001365; CY001373;
CYOO1381; CY001397; CY001405; CY001413; CY001421; CY001429; CY001437; CY001445;
CY001453; CY001461; CY001469; CY001477; CY001485; CY001493; CY001504; CY001512;
CY001520; CY001528; CY001536; CY001544; CY001552; CY001560; CY001568; CY001576;
CY001584; CY001592; CY001600; CY001608; CY001616; CY001624; CY001632; CY001640; CY001648; CY001656; CY001664; CY001672; CY001688; CY001696; CY001704; CY001712;
CY001720; CY001728; CY001736; CY001744; CY001752; CY001760; CY001768; CY001776;
CY001784; CY001792; CY001800; CYOO18O8; CY001816; CY001824; CY001832; CY001840;
CY001848; CY001856; CY001864; CY001872; CYOO188O; CYOO1888; CY001896; CY001904;
CY001912; CY001920; CY001928; CY001936; CY001944; CY001960; CY001968; CY001976; CY001984; CY001992; CY002000; CY002008; CY002016; CY002024; CY002032; CY002040;
CY002048; CY002056; CY002064; CY002072; CY002080; CY002088; CY002096; CY002104;
CY002112; CY002120; CY002128; CY002136; CY002144; CY002160; CY002168; CY002176;
CY002184; CY002192; CY002200; CY002208; CY002216; CY002224; CY002232; CY002240;
CY002248; CY002256; CY002264; CY002272; CY002280; CY002288; CY002296; CY002304;
CY002312; CY002328; CY002336; CY002344; CY002368; CY002376; CY002384; CY002408; CY002416; CY002424; CY002432; CY002440; CY002448; CY002456; CY002464; CY002472;
CY002480; CY002488; CY002496; CY002504; CY002512; CY002520; CY002544; CY002552;
CY002560; CY002576; CY002584; CY002592; CY002600; CY002608; CY002712; CY002720;
CY002728; CY002736; CY002744; CY002752; CY002760; CY002768; CY002776; CY002784;
CY002816; CY002904; CY002905; CY002906; CY002914; CY002922; CY002930; CY002938; CY002946; CY002954; CY002962; CY003032; CY003040; CY003048; CY003056; CY003064;
CY003072; CY003080; CYOO3O88; CY003096; CY003104; CY003112; CY003120; CY003123;
CY003136; CY003144; CY003152; CY003160; CY003168; CY003176; CY003184; CY003192;
CY003200; CY003208; CY003216; CY003224; CY003232; CY003240; CY003248; CY003256;
CY003264; CY003272; CY003280; CY003336; CY003344; CY003352; CY003408; CY003416; CY003424; CY003432; CY003440; CY003448; CY003456; CY003488; CY003496; CY003504;
CY003512; CY003520; CY003528; CY003536; CY003544; CY003552; CY003560; CY003568;
CY003576; CY003584; CY003592; CY003600; CY003608; CY003616; CY003624; CY003632;
CY003640; CY003648; CY003656; CY003664; CY003680; CY003712; CY003720; CY003728;
CY003736; CY003744; CY003752; CY003777; CY003785; CY003793; CY003801; CY003809; CY003817; CY003825; CY004657; CY004662; CY004670; CY004692; CY004702; CY005915;
CY005916; CY005917; CY005935; CY005936; CY005937; CY005938; CY005939; CY005940;
CY005941; CY005942; CY005943; CY005977; CY006011; CY006012; CY006013; CY006014;
CY006015; CY006016; CY006026; CY006031; CY006035; CY006038; CY006043; CY006044;
CY006052; CY006060; CY006068; CY006076; CY006084; CY006092; CY006115; CY006123; CY006131; CY006139; CY006147; CY006155; CY006163; CY006179; CY006203; CY006211;
CY006219; CY006227; CY006235; CY006243; CY006251; CY006259; CY006267; CY006275;
CY006283; CY006291; CY006299; CY006307; CY006315; CY006323; CY006331; CY006339;
CY006347; CY006371; CY006379; CY006435; CY006443; CY006451; CY006459; CY006467;
CY006475; CY006483; CY006491; CY006499; CY006507; CY006515; CY006523; CY006531; CY006539; CY006547; CY006555; CY006563; CY006571; CY006579; CY006587; CY006595;
CY006603; CY006611; CY006619; CY006627; CY006635; CY006659; CY006683; CY006691;
CY006699; CY006707; CY006715; CY006723; CY006731; CY006739; CY006755; CY006763;
CY006771; CY006787; CY006795; CY006803; CY006811; CY006819; CY006827; CY006835;
CY006843; CY006851; CY006859; CY006883; CY006891; CY006899; CY006907; CY006923; CY006931; CY006939; CY006947; CY006955; CY006963; CY006971; CY006979; CY006987;
CY006995; CY007003; CY007011; CY007019; CY007027; CY007035; CY007043; CY007051;
CY007059; CY007067; CY007075; CY007083; CY007091; CY007099; CY007107; CY007115;
CY007123; CY007131; CY007139; CY007147; CY007155; CY007163; CY007171; CY007179;
CY007187; CY007195; CY007203; CY007211; CY007219; CY007227; CY007235; CY007243;
CY007251; CY007259; CY007267; CY007275; CY007283; CY007291; CY007299; CY007307; CY007315; CY007323; CY007331; CY007339; CY007347; CY007355; CY007363; CY007371;
CY007379; CY007387; CY007395; CY007403; CY007411; CY007419; CY007427; CY007435;
CY007443; CY007451; CY007459; CY007475; CY007483; CY007491; CY007499; CY007507;
CY007515; CY007523; CY007531; CY007539; CY007547; CY007555; CY007563; CY007571;
CY007579; CY007587; CY007595; CY007603; CY007611; CY007619; CY007627; CY007635; CY007643; CY007651; CY007659; CY007667; CY007675; CY007683; CY007691; CY007699;
CY007707; CY007715; CY007723; CY007731; CY007739; CY007747; CY007755; CY007763;
CY007771; CY007779; CY007787; CY007795; CY007803; CY007811; CY007819; CY007827;
CY007835; CY007843; CY007851; CY007859; CY007867; CY007875; CY007883; CY007891;
CY007899; CY007907; CY007915; CY007923; CY007931; CY007939; CY007947; CY007955; CY007963; CY007971; CY007979; CY007987; CY007995; CY008003; CY008011; CY008019;
CY008027; CY008035; CY008043; CY008051; CY008059; CY008067; CY008075; CYOO8O83;
CY008091; CY008099; CY008107; CY008115; CY008123; CY008131; CY008139; CY008156;
CY008164; CY008172; CYOO818O; CY008196; CY008204; CY008212; CY008220; CY008228;
CY008236; CY008244; CY008252; CY008260; CY008268; CY008276; CY008284; CY008292; CY008300; CYOO83O8; CY008316; CY008324; CY008332; CY008340; CY008348; CY008356;
CY008364; CY008372; CYOO838O; CYOO8388; CY008396; CY008404; CY008412; CY008420;
CY008428; CY008436; CY008444; CY008452; CY008460; CY008468; CY008476; CY008484;
CY008492; CY008500; CYOO85O8; CY008516; CY008532; CY008540; CY008548; CY008556;
CY008564; CY008572; CYOO858O; CYOO8588; CY008596; CY008604; CY008612; CY008620; CY008628; CY008636; CY008644; CY008652; CY008660; CY008668; CY008676; CY008684;
CY008692; CY008700; CY008708; CY008716; CY008724; CY008732; CY008740; CY008748;
CY008756; CY008764; CY008772; CY008780; CY008788; CY008796; CY008804; CY008812;
CY008820; CY008828; CY008836; CY008844; CY008852; CY008860; CY008868; CY008876;
CY008884; CY008892; CY008900; CY008908; CY008916; CY008924; CY008932; CY008940; CY008948; CY008956; CY008964; CY008972; CY008980; CY009004; CY009012; CY009020;
CY009028; CY009036; CY009044; CY009052; CY009060; CY009068; CY009076; CY009084;
CY009092; CY009100; CY009108; CY009116; CY009124; CY009132; CY009140; CY009148;
CY009156; CY009164; CY009244; CY009252; CY009260; CY009268; CY009300; CY009308;
CY009348; CY009356; CY009372; CY009380; CY009388; CY009396; CY009404; CY009412; CY009420; CY009428; CY009436; CY009460; CY009468; CY009476; CY009484; CY009492;
CY009500; CY009508; CY009516; CY009524; CY009556; CY009564; CY009572; CY009580;
CY009588; CY009636; CY009644; CY009652; CY009660; CY009668; CY009676; CY009684;
CY009692; CY009700; CY009708; CY009716; CY009724; CY009732; CY009740; CY009748;
CY009852; CY009900; CY009908; CY009924; CY009932; CY009948; CY009988; CY009996;
CY010004; CY010012; CY010020; CY010028; CY010036; CY010044; CY010052; CY010060; CY010068; CY010084; CY010516; CY010548; CY010564; CYO1O588; CY010596; CY010604;
CY010612; CY010620; CY010628; CY010636; CY010644; CY010652; CY010660; CY010668;
CY010676; CY010684; CY010692; CY010700; CY010708; CY010716; CY010724; CY010732;
CY010748; CY010756; CY010796; CY010812; CY010988; CYOl 1020; CYOl 1028; CYOl 1048;
CYOl 1064; CYOl 1120; CYOl 1128; CYOl 1136; CYOl 1256; CYOl 1264; CYOl 1288; CYOl 1320; CYOl 1328; CYOl 1336; CYOl 1344; CYOl 1352; CYOl 1360; CYOl 1368; CYOl 1376; CYOl 1384;
CYOl 1400; CYOl 1416; CYOl 1424; CYOl 1432; CYOl 1440; CYOl 1448; CYOl 1456; CYOl 1464;
CYOl 1472; CYOl 1480; CYOl 1488; CYOl 1496; CYOl 1504; CYOl 1512; CYOl 1520; CYOl 1528;
CYOl 1536; CYOl 1544; CYOl 1552; CYOl 1560; CYOl 1568; CYOl 1576; CYOl 1592; CYOl 1616;
CYOl 1624; CYOl 1632; CYOl 1640; CYOl 1648; CYOl 1656; CYOl 1664; CYOl 1672; CYOl 1680; CYOl 1688; CYOl 1696; CYOl 1704; CYOl 1712; CYOl 1720; CYOl 1728; CYOl 1736; CYOl 1744;
CYOl 1752; CYOl 1760; CYOl 1768; CYOl 1808; CYOl 1816; CYOl 1824; CYOl 1832; CYOl 1840;
CYOl 1848; CYOl 1856; CYOl 1864; CYOl 1872; CYOl 1880; CYOl 1888; CYOl 1896; CYOl 1904;
CYOl 1912; CYOl 1920; CYOl 1928; CYOl 1936; CYOl 1944; CYOl 1960; CYOl 1968; CYOl 1976;
CYOl 1984; CYOl 1992; CY012000; CY012008; CY012016; CY012024; CY012032; CY012040; CY012048; CY012056; CY012064; CY012072; CY012080; CY012088; CY012096; CY012104;
CY012112; CY012120; CY012128; CY012136; CY012144; CY012152; CY012160; CY012168;
CY012176; CY012184; CY012200; CY012208; CY012216; CY012224; CY012232; CY012240;
CY012248; CY012256; CY012264; CY012272; CY012280; CY012288; CY012312; CY012320;
CY012328; CY012336; CY012344; CY012352; CY012360; CY012368; CY012376; CY012384; CY012392; CY012400; CY012408; CY012416; CY012424; CY012432; CY012448; CY012456;
CY012464; CY012472; CY012480; CY012488; CY012496; CY012504; CY012512; CY012520;
CY012528; CY012536; CY012544; CY012552; CY012560; CY012568; CY012576; CY012584;
CY012592; CY012616; CY012624; CY012632; CY012640; CY012648; CY012656; CY012664;
CY012672; CY012680; CY012688; CY012696; CY012704; CY012712; CY012720; CY012728; CY012736; CY012744; CY012752; CY012760; CY012768; CY012776; CY012784; CY012792;
CY012848; CY012896; CY012904; CY012912; CY012920; CY012928; CY012936; CY012944;
CY012952; CY012960; CY012968; CY012976; CY012984; CY012992; CY013000; CY013008;
CY013016; CY013024; CY013048; CY013056; CY013064; CY013072; CY013080; CYO13O88;
CY013096; CY013104; CY013112; CY013120; CY013128; CY013136; CY013144; CY013152; CY013160; CY013168; CY013176; CY013184; CY013192; CY013200; CY013208; CY013216;
CY013224; CY013232; CY013240; CY013263; CY013311; CY013319; CY013327; CY013335;
CY013343; CY013351; CY013359; CY013367; CY013375; CY013383; CY013389; CY013397;
CY013405; CY013413; CY013421; CY013429; CY013437; CY013445; CY013453; CY013461;
CY013469; CY013477; CY013485; CY013493; CY013501; CY013509; CY013517; CY013525;
CY013533; CY013541; CY013549; CY013605; CY013613; CY013621; CY013629; CY013637; CY013645; CY013653; CY013661; CY013669; CY013677; CY013685; CY013693; CY013701;
CY013709; CY013717; CY013725; CY013733; CY013741; CY013749; CY013757; CY013765;
CY013773; CY013781; CY013789; CY013797; CY013805; CY013887; CY013895; CY013903;
CY013911; CY013919; CY013927; CY013935; CY013943; CY013951; CY013959; CY013967;
CY013975; CY013983; CY013991; CY013999; CY014015; CY014023; CY014031; CY014039; CY014047; CY014055; CY014063; CY014071; CY014079; CY014087; CY014095; CY014103;
CY014111; CY014119; CY014127; CY014135; CY014143; CY014151; CY014159; CY014548;
CY014571; CY014621; CY014633; CY014702; CY014865; CY014961; CY015492; CY015500;
CY015508; CY015516; CY015540; CY015548; CY015556; CY015564; CY015572; CY015588;
CY015596; CY015604; CY015612; CY015620; CY015628; CY015636; CY015644; CY015652; CY015660; CY015668; CY015676; CY015684; CY015692; CY015700; CY015708; CY015716;
CY015724; CY015732; CY015740; CY015748; CY015756; CY015764; CY015772; CY015780;
CY015788; CY015796; CY015804; CY015812; CY015820; CY015828; CY015836; CY015844;
CY015852; CY015860; CY015868; CY015876; CY015884; CY015892; CY015900; CY015908;
CY015916; CY015924; CY015932; CY015940; CY015948; CY015956; CY015964; CY015972; CY015980; CY015988; CY015996; CY016004; CY016012; CY016020; CY016028; CY016036;
CY016044; CY016060; CY016068; CY016076; CY016084; CY016092; CY016100; CY016108;
CY016116; CY016140; CY016180; CY016204; CY016212; CY016268; CY016395; CY016403;
CY016411; CY016427; CY016443; CY016451; CY016467; CY016475; CY016483; CY016491;
CY016499; CY016507; CY016515; CY016523; CY016531; CY016539; CY016547; CY016555; CY016571; CY016579; CY016587; CY016595; CY016603; CY016627; CY016635; CY016651;
CY016659; CY016707; CY016715; CY016739; CY016747; CY016755; CY016763; CY016771;
CY016979; CY016987; CY016995; CY017083; CY017091; CY017099; CY017107; CY017131;
CY017163; CY017171; CY017259; CY017267; CY017283; CY017291; CY017299; CY017307;
CY017323; CY017331; CY017339; CY017347; CY017355; CY017387; CY017395; CY017411; CY017443; CY017451; CY017459; CY017467; CY017475; CY017483; CY017491; CY017499;
CY017507; CY017515; CY017523; CY017531; CY017539; CY017547; CY017555; CY017563;
CY017571; CY017579; CY017587; CY017595; CY017603; CY017611; CY017619; CY017627;
CY017709; CY017757; CY017773; CY017797; CY017805; CY017821; CY017837; CY017861;
CY017885; CY017893; CY017901; CY017909; CY017917; CY017925; CY017933; CY017941; CY017949; CY017957; CY017965; CY017973; CY017981; CY017989; CY017999; CY018869;
CY018925; CY018941; CY018957; CY018965; CY018973; CY018981; CY018989; CY018997;
CY019005; CY019013; CY019021; CY019029; CY019141; CY019149; CY019157; CY019165;
CY019173; CY019181; CY019189; CY019197; CY019213; CY019245; CY019253; CY019261;
CY019269; CY019277; CY019285; CY019293; CY019301; CY019309; CY019317; CY019325;
CY019333; CY019747; CY019811; CY019819; CY019827; CY019835; CY019843; CY019851; CY019859; CY019891; CY019899; CY019907; CY019915; CY019931; CY019939; CY019981;
CY019989; CY020005; CY020013; CY020021; CY020029; CY020037; CY020045; CY020053;
CY020061; CY020069; CY020077; CY020085; CY020093; CY020101; CY020109; CY020117;
CY020125; CY020133; CY020197; CY020205; CY020213; CY020221; CY020301; CY020309;
CY020325; CY020333; CY020341; CY020357; CY020365; CY020493; CY020501; CY020525; CY020533; CY020717; CY020741; CY020757; CY020877; CY020893; CY020933; CY020997;
CY021061; CY021077; CY021085; CY021093; CY021101; CY021109; CY021117; CY021157;
CY021229; CY021261; CY021269; CY021277; CY021285; CY021309; CY021317; CY021341;
CY021429; CY021453; CY021461; CY021597; CY021741; CY021765; CY021773; CY021781;
CY021829; CY021837; CY021845; D00929; D00930; D00931; D00932; D10161; D10162; D13581; D13582; D13583; D13584; D21171; D21172; D21173; D21174; D21175; D21176; D21177; D21178;
D21179; D21180; D21181; D21182; D21183; D30662; D30663; D30664; D30665; D30668; D30669;
D30677; D30678; D30679; D30680; D30681; D30682; D30683; D30684; D30685; D30686; D43786;
D43787; D43788; D43789; D43790; D43791; D43792; D49959; D49960; D49961; D49962; D49963;
D49964; D49965; D49966; D49967; D86469; DQ006284; DQ006285; DQ007622; DQ021910; DQ021911; DQ059385; DQ066936; DQ086157; DQ086158; DQ086159; DQ086160; DQ086161;
DQ089634; DQ089635; DQ089636; DQ089637; DQ089638; DQ089639; DQl 14496; DQl 14497;
DQ114498; DQ114499; DQ114500; DQ114501; DQ114502; DQ114503; DQ114504; DQ114505;
DQ114506; DQ114507; DQ114508; DQ114509; DQ114510; DQ114511; DQ114512; DQ114513;
DQ114514; DQ114515; DQ114516; DQ114517; DQ114518; DQ114519; DQ114520; DQ114521; DQl 14522; DQl 14523; DQl 14524; DQl 14525; DQl 14526; DQl 14527; DQl 14528; DQl 14529;
DQ114530; DQ114531; DQ114532; DQ114533; DQ114534; DQ114535; DQ114536; DQ114537;
DQ124157; DQ124189; DQ124190; DQ124191; DQ124192; DQ124193; DQ124194; DQ124195;
DQ124196; DQ132433; DQ141307; DQ145537; DQ146419; DQ150425; DQ150433; DQ159065;
DQ159066; DQ159067; DQ167251; DQ167252; DQ167253; DQ167254; DQ167255; DQ167256; DQ167257; DQ167258; DQ167259; DQ167260; DQ167261; DQ167262; DQ167263; DQ167264;
DQ167265; DQ167266; DQ167267; DQ167268; DQ167269; DQ167270; DQ167271; DQ167272;
DQ167273; DQ167274; DQ167275; DQ167276; DQ167277; DQ167278; DQ167279; DQ167280;
DQ167281; DQ167282; DQ167283; DQ167284; DQ167285; DQ167286; DQ167287; DQ167288;
DQ167289; DQ167290; DQ167291; DQ167292; DQ167293; DQ167294; DQ167295; DQ167296; DQ167297; DQ167298; DQ167299; DQ167300; DQ167301; DQ167302; DQ167303; DQ167304;
DQ167305; DQ167306; DQ167307; DQ174263; DQ174264; DQ174265; DQ174266; DQ174267;
DQ174268; DQ179382; DQ179383; DQ179384; DQ179385; DQ179386; DQ179387; DQ179388;
DQ179389; DQ179390; DQ179391; DQ179392; DQ179393; DQ179394; DQ179395; DQ179396;
DQ179397; DQ179398; DQ179399; DQ179400; DQ179401; DQ179402; DQ179403; DQ179404;
DQ179405; DQ179406; DQ179407; DQ179408; DQ179409; DQ179410; DQ179411; DQ179412; DQ179413; DQ179414; DQ179415; DQ179416; DQ179417; DQ179418; DQ179419; DQ179420;
DQ179421; DQ179422; DQ179423; DQ179424; DQ179425; DQ179426; DQ179427; DQ179428;
DQ179429; DQ179430; DQ179431; DQ179432; DQ179433; DQ179434; DQ179435; DQ179436;
DQ179437; DQ179438; DQ179439; DQ179440; DQ179441; DQ179442; DQ179443; DQ179444;
DQ179445; DQ179446; DQ179447; DQ179448; DQ179449; DQ179450; DQ179451; DQ179452; DQ179453; DQ179454; DQ179455; DQ179456; DQ179457; DQ179458; DQ179459; DQ179460;
DQ179461; DQ179462; DQ179463; DQ179464; DQ179465; DQ179466; DQ179467; DQ179468;
DQ179469; DQ179470; DQ179471; DQ179472; DQ179473; DQ179474; DQ179475; DQ179476;
DQ179477; DQ179478; DQ179479; DQ179480; DQ179481; DQ179482; DQ179483; DQ179484;
DQ179485; DQ179486; DQ179487; DQ179488; DQ179489; DQ179490; DQ179491; DQ179492; DQ179493; DQ179494; DQ179495; DQ179496; DQ179497; DQ179498; DQ179499; DQ179500;
DQ179501; DQ179502; DQ179503; DQ179504; DQ179505; DQ179506; DQ179507; DQ179508;
DQ179509; DQ179510; DQ179511; DQ179512; DQ179513; DQ179514; DQ179515; DQ179516;
DQ179517; DQ179518; DQ179519; DQ179520; DQ179521; DQ179522; DQ179523; DQ179524;
DQ179525; DQ179526; DQ179527; DQ222913; DQ227423; DQ227424; DQ227425; DQ227426; DQ227427; DQ227428; DQ227429; DQ227430; DQ227431; DQ241761; DQ241762; DQ241763;
DQ249259; DQ249261; DQ249262; DQ256372; DQ256373; DQ256374; DQ256375; DQ265707;
DQ265708; DQ265709; DQ265710; DQ265711; DQ265712; DQ265713; DQ265714; DQ265715;
DQ265716; DQ265717; DQ265718; DQ335771; DQ336006; DQ336007; DQ336008; DQ336009;
DQ336010; DQ336011; DQ336012; DQ336013; DQ336014; DQ336015; DQ336016; DQ336017; DQ415319; DQ415320; DQ415321; DQ415322; DQ415323; DQ415324; DQ415325; DQ415326;
DQ447186; DQ469962; DQ469970; DQ469978; DQ469986; DQ469994; DQ470002; DQ487340;
DQ487341; DQ508825; DQ508833; DQ508849; DQ508865; DQ508929; DQ534420; DQ534421;
DQ534422; DQ534423; DQ534424; DQ534425; DQ534426; DQ534427; DQ534428; DQ534429;
DQ632594; DQ632595; DQ632596; DQ632597; DQ865945; DQ865946; DQ865947; DQ865948; DQ865949; DQ865950; DQ865951; DQ865952; DQ865953; DQ865954; DQ865955; DQ865956;
DQ865957; DQ865958; DQ865959; DQ865960; DQ865961; DQ865962; DQ865963; DQ865964;
DQ865965; DQ865966; DQ865967; DQ865968; DQ865969; DQ865970; DQ865971; DQ865972;
DQ865973; DQ865974; DQ883582; DQ883583; DQ883584; DQ883585; DQ883586; DQ883587;
DQ883588; DQ883589; DQ883590; DQ883591; DQ883592; DQ883593; DQ883594; DQ883595; DQ883596; DQ883597; DQ883598; DQ883599; DQ883600; DQ883601; DQ883602; DQ883603;
DQ883604; DQ883605; DQ883606; DQ883607; DQ883608; DQ883609; DQ883610; DQ883611;
DQ883612; DQ883613; DQ883614; DQ883615; DQ883616; DQ883617; DQ883618; DQ883619;
DQ883620; DQ883621; DQ883622; DQ883623; DQ883624; DQ883625; DQ883626; DQ883627;
DQ883628; DQ923506; DQ923507; DQ973305; DQ975252; DQ975253; DQ975254; DQ975255;
DQ975256; DQ975257; DQ975258; DQ975259; DQ975260; DQ975261; DQ975262; DQ975263; DQ975264; DQ975265; DQ975266; DQ975267; DQ981740; DQ981741; DQ981742; DQ983746;
DQ983747; DQ983748; DQ983749; DQ983750; DQ983751; DQ983752; DQ983753; DQ983754;
DQ983755; DQ983756; DQ983757; DQ983758; DQ983759; DQ983760; DQ983761; DQ983762;
DQ983763; DQ983764; DQ983765; DQ983766; DQ983767; EF041487; EFl 17330; EFl 18172;
EFl 18173; EFl 18174; EF151958; EF199897; EF199898; EF456782; EF456783; EF456784; EF456785; EF456786; EF456787; EF456788; EF456789; EF456790; EF456791; EF456792; EF456797; EF462544;
EF462549; EF462550; EF462551; EF462552; EF462553; EF462554; EF462555; EF462557; EF462558;
EF462559; EF462560; EF462561; EF462562; EF462566; EF462567; EF462568; EF462569; EF467799;
EF467800; EF467827; EF473329; EF473330; EF473331; EF473332; EF473333; EF473334; EF473335;
EF473336; EF473337; EF473338; EF473339; EF473340; EF473341; EF473342; EF473343; EF473344; EF473345; EF473346; EF473347; EF473348; EF473349; EF473350; EF473351; EF473352; EF473353;
EF473354; EF473355; EF473356; EF473357; EF473358; EF473359; EF473360; EF473362; EF473363;
EF473364; EF473365; EF473366; EF473367; EF473368; EF473369; EF473370; EF473371; EF473372;
EF473373; EF473375; EF473376; EF473377; EF473378; EF473379; EF473380; EF473381; EF473382;
EF473383; EF473384; EF473385; EF473386; EF473387; EF473388; EF473389; EF473390; EF473391; EF473392; EF473393; EF473394; EF473395; EF473396; EF473398; EF473399; EF473400; EF473401;
EF473402; EF473403; EF473404; EF473405; EF473406; EF473408; EF473409; EF473410; EF473411 ;
EF473412; EF473413; EF473414; EF473415; EF473416; EF473417; EF473418; EF473419; EF473420;
EF473421; EF473422; EF473423; EF473424; EF473425; EF473426; EF473427; EF473428; EF473429;
EF473430; EF473431; EF473432; EF473433; EF473434; EF473435; EF473436; EF473437; EF473438; EF473439; EF473440; EF473441; EF473442; EF473443; EF473444; EF473445; EF473446; EF473447;
EF473449; EF473450; EF473451; EF473452; EF473453; EF473454; EF473455; EF473456; EF473457;
EF473458; EF473459; EF473460; EF473461; EF473462; EF473463; EF473464; EF473465; EF473466;
EF473467; EF473468; EF473469; EF473470; EF473471; EF473472; EF473473; EF473474; EF473475;
EF473476; EF473477; EF473478; EF473479; EF473480; EF473481; EF473482; EF473483; EF473484; EF473485; EF473486; EF473487; EF473488; EF473489; EF473490; EF473491; EF473492; EF473493;
EF473494; EF473495; EF473496; EF473497; EF473498; EF473499; EF473500; EF473504; EF473505;
EF473506; EF473507; EF473508; EF473509; EF473510; EF473511; EF473512; EF473513; EF473514;
EF473515; EF473516; EF473517; EF473518; EF473519; EF473520; EF473521; EF473522; EF473523;
EF473524; EF473525; EF473526; EF473527; EF473528; EF473529; EF473530; EF473531; EF473532; EF473533; EF473534; EF473535; EF473536; EF473537; EF473538; EF473539; EF473540; EF473541;
EF473542; EF473543; EF473544; EF473545; EF473546; EF473547; EF473548; EF473549; EF473550;
EF473551; EF473552; EF473553; EF473555; EF473556; EF473557; EF473558; EF473559; EF473560;
EF473561; EF473562; EF473563; EF473564; EF473565; EF473566; EF473567; EF473568; EF473569;
EF473570; EF473571; EF473572; EF473573; EF473574; EF473575; EF473576; EF473577; EF473578;
EF473579; EF473581; EF473582; EF473583; EF473584; EF473585; EF473586; EF473588; EF473589; EF473590; EF473591; EF473592; EF473593; EF473594; EF473595; EF473596; EF473597; EF473598;
EF473599; EF473600; EF473601; EF473602; EF473603; EF473604; EF473605; EF473607; EF473608;
EF473609; EF473611; EF473612; EF473613; EF473614; EF473615; EF473616; EF473617; EF473618;
EF473619; EF473620; EF473621; EF473622; EF473623; EF473624; EF473625; EF473626; EF473627;
EF473628; EF473629; EF473630; EF473632; EF473633; EF473634; EF473635; EF473636; EF473638; EF473639; EF473640; EF473641; EF473642; EF473643; EF473644; EF473645; EF473646; EF473647;
EF473648; EF541428; EF541429; EF541430; EF541431; EF541432; EF541433; EF541434; EF541435;
EF541436; EF541437; EF541438; EF541439; EF541440; EF541441; EF541442; EF541443; J02090;
J02092;J02132;J02538; K03335; K03338;L18994; L18996;L18997; L18998; L19000;L19001; L19002;
L19003; L19004; L19412; L19413; L19414; L19415; L19416; L20101; L20102; L20103; L20104; L20105; L20114; L20115; L20118; L20119; L27597; L31949; L32024; L39913; L39914; L39915;
L39916; L39917; L39918; L75975; L75976; L75977; L75978; L75979; L75980; L75981; L75982;
L75983; L75984; L75985; L75986; L75987; L75988; L75989; L75990; L75991; L76035; L76036;
L76037; M16737; M16738; M16739; M16740; Ml6741; Ml6742;M16743; M19056;M19057;M21648;
M24718; M24719; M24720; M24721;M24722;M24723;M24724;M24725; M24726;M24727;M24728; M25044; M25434; M29257; M54895;M55059;M57630;M57631;M57632; M57644;M65018;M73771;
M73772; M73773; M73774; M73775; M73776; S64310; S77429; U07146; UO8858; U08859; U08905;
U26830; U48439; U48440; U48441; U48442; U48443; U48444; U48445; U48446; U48447; U49722;
U58195; U65552; U65553; U65554; U65555; U65556; U65557; U65558; U65559; U65560; U77830;
U77831; U77832; U77833; U77834; U77835; U77836; U77837; U77838; U77839; U77840; U97740; V01085; V01086; V01087; V01089; V01098; VOl103; X05907; X68437; X73489; X73490; X73491;
X75800; X85085; X85086; X85087; X85O88; X85089; X85090; X95637; X95638; Y14053; Y14055;
Y14056; Y14057; Y14058; Y14059; Y14060; Z46391; Z46392; Z46393; Z46394; Z46395; Z46396;
Z46397; Z46398; Z46399; Z46400; Z46401; Z46402; Z46403; Z46404; Z46405; Z46406; Z46407;
Z46408; Z46409; Z46410; Z46411; Z46412; Z46413; Z46414; Z46415; Z46416 andZ46417. [00157] Nucleic acid sequences encoding influenza virus subtype H4 haemagglutinins suitable for inclusion as acargo moietyin conjugates according to thepresentinventionhave thefollowing accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI)
Entrez nucleotide search and retrieval system:
[00158] AB288842; AB289331; CY005952; CY005953; CY005954; CY005955; CY005956; CY005957; CY005958; CY005959; CY005961; CY005962; CY005963; CY005964; CY005965;
CY005966; CY005967; CY005968; CY006017; CY006027; CY006030; CYOl 1036; CYOl 1056;
CY012808; CY012816; CY013248; CY014562; CY014579; CY014630; CY014723; CY014751;
CY014857; CY014922; CY014929; CY014937; CY015459; CY015467; CY016148; CY017701;
CY017741; CY020725; CY020733; CY020749; CY020765; CY020773; CY020789; CY020797;
CY020805; CY020981; CY021213; CY021221; CY021237; CY021325; CY021333; CY021349; D90302; DQ021848; DQ021849; DQ021850; DQ021851; DQ021852; DQ021853; DQ021854; DQ021855;
DQ021856; DQ021857; DQ021858; DQ021859; DQ021860; DQ021861; DQ021862; DQ021863;
DQ021864; DQ021865; DQ021866; DQ021867; DQ021868; DQ236166; DQ327834; DQ787806;
EF041495; J02102; M25283; M25284; M25285; M25286; M25287; M25288; M25289; M25290; M25291;
AB289333; AB292406; AB292408; AB292662; AB295609; AB295611; AF285883; AF285885; AF290436; AJ506780; AJ506782; AY180434; AY180435; AY180436; AY180437; AY180438;
AY180439; AY180440; AYl 80441; AY180442; AY180443; AY596802; AY596803; AY596804;
AY633124; AY633141; AY633156; AY633260; AY633268; AY633284; AY633348; AY633356;
CY004847; CY004911; CY004925; CY004933; CY004939; CY005672; CY005679; CY005944;
CY005945; CY005946; CY005947; CY005948; CY005950 and CY005951. [00159] Nucleic acid sequences encoding influenza virus subtype H5 haemagglutinins suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI)
Entrez nucleotide search and retrieval system:
[00160] BAD89305; BAD89315; BAD89325; BAD89335; BAD89345; BAE07201; BAE07155; BAE47131; BAE48315; BAE48316; BAE48317; BAE48318; BAE46949; BAE48684; BAE48685;
BAE48686; BAE48687; BAE48688; BAE48689; BAE48690; BAE48691; BAE48692; BAE48693;
BAE48694; BAE48695; BAE48696; BAE94699; BAF37962; BAE96567; BAE96961; BAF49662;
BAF49663; BAF49664; BAF49665; BAF49666; BAF49667; BAF49668; BAF49669; BAF49670;
BAF49671; BAF49672; BAF49673; BAF49674; BAF49675; BAF49676; BAF37387; BAF48359; AAC40508; AAC34263; AAC32078; AAC32088; AAC32098; AAC32099; AAC32100; AAC32101;
AAC32102; AAC14418; AAD13566; AAD13567; AAD13568; AAD13569; AAD13570; AAD13571;
AAD13572; AAD13573; AAD13574; AAD13575; AAF74329; AAF74330; AAF74331; AAD52043;
AAF02300; AAF02301; AAF02302; AAF02303; AAF02304; AAF02305; AAF02306; AAF02307;
AAF02308; AAF02309; AAF04719; AAF04720; AAD21153; AAD21154; AAD21155; AAD21156; AAD21157; AAD21158; AAD21159; AAD21160; AAD21161; AAD21162; AAD21163; AAD21164;
AAD51927; AAD37782; AAF89536; AAF89537; AAF89538; AAF89539; AAF89540; AAF89541;
AAF89542; AAF89543; AAF89544; AAF89545; AAF89546; AAG28424; AAG60347; AAG60348;
AAG60349; AAGOl 195; AAG01205; AAG01215; AAG01225; AAF99718; AAG38534; AAK38298;
AAK57506; AAL59142; AAL59143; AAL16033; AAL84323; AAL84324; AAM49555; AAM22457; AAM22458; AAO52859; AAO52860; AAO52861; AAO52862; AAO52863; AAO52864; AAO52865;
AAO52866; AAO52867; AAO52868; AAO52869; AAO52870; AAO52871; AAO52872; AAO52873;
AAO52874; AAO52875; AAO52876; AAO52877; AAO52878; AAO52879; AAO52880; AAO52881;
AAO52882; CAC28131; CAF21870; CAF21874; CAG14996; CAG14997; CAG29661; CAI29278;
CAI96162; CAI96163; CAI99404; CAJ32556; CAJ75440; CAJ75441; CAJ75442; CAJ75443; CAJ75444;
CAJ75445; CAJ75446; CAJ75447; CAJ75448; CAJ77761; CAJ84721; CAK18565; CAK18566; CAK18567; CAK18570; CAK18571; CAK18577; CAK18596; CAL37103; CAL51387; CAL51388;
CAL51389; CAL51390; CAL51391; CAL51392; CAL51393; CAL51394; CAL51395; CAL51396;
CAL48277; CAL48276; CAL48275; CAL48274; CAL48273; CAL48272; CAL48271; CAL48270;
CAL48269; CAL48268; CAL48267; CAL48279; CAL48278; CAL48266; CAL48265; CAL48280;
CAL59784; CAL59783; CAL59782; CAL59781; CAL59780; CAL59779; CAL59786; CAL59785; CAM33521; AAL31380; AAL31381; AAL31382; AAL31383; AAL31384; AAL31385; AAL31386;
AAL31387; AAL31388; AAL75839; AAL75843; AAL75847; AAO46797; AAO46798; AAO46799;
AAO46800; AAO46801; AAO46802; AAO46803; AAO46804; AAO46805; AAP71989; AAP71990;
AAP71991; AAP71992; AAP71993; AAP71994; AAP71995; AAP71996; AAP71997; AAP71998;
AAP71999; AAP72000; AAP72001; AAP72002; AAP72003; AAP72004; AAP72005; AAP72006; AAP72007; AAP72008; AAP72009; AAP72010; AAP72011; AAR888O8; AAR88809; AAR8881O;
AAR88811; AAR88812; AAR88813; AAR88814; AAR88815; AAR88816; AAR88817; AAR88818;
AAR88819; AAR88820; AAR88821; AAR88822; AAR88823; AAR88824; AAR88825; AAR88826;
AAR88827; AAR88828; AAR88829; AAR8883O; AAR88831; AAR88832; AAR88833; AAR88834;
AAR88835; AAR88836; AAR88837; AAR88838; AAR88839; AAR88840; AAR88841; AAS07023; AAR99628; AAR98819; AAT07996; AAS50166; AAS50167; AAS57873; AAS57874; AAS57875;
AAS57876; AAS45134; AAS84275; AAS84276; AAS84247; AAS84248; AAS84249; AAS84250;
AAS84251; AAS84252; AAS84253; AAS84254; AAS84255; AAS84256; AAS84257; AAS84258;
AAS84259; AAS84260; AAS84261; AAS84262; AAS84263; AAS84264; AAS84265; AAS84266;
AAS84267; AAS84268; AAS84269; AAS84270; AAS84271; AAS84272; AAS84273; AAS84274; AAS65615; AAS65618; AAS87596; AAS87577; AAS87580; AAT39065; AAT39066; AAT39067;
AAT39068; AAT39073; AAT39074; AAT39075; AAT39076; AAT39077; AAT39078; AAT39079;
AAT39080; AAS79356; AAS79359; AAS89004; AAT12022; AAT12023; AAT12024; AAT12025;
AAT12026; AAT12027; AAT12028; AAT12029; AAT12030; AAT12031; AAT12032; AAT12033;
AAT12034; AAT12035; AAT12036; AAT12037; AAT12038; AAT12039; AAT12040; AAT12041; AAT12042; AAS89267; AAS89268; AAS89269; AAS89270; AAS89271; AAS89272; AAS89273;
AAT37563; AAT90337; AAV34704; AAV32636; AAT65209; AAT70210; AAT70218; AAT72505;
AAV65826; AAT73260; AAT73261; AAT73262; AAT73263; AAT73264; AAT73265; AAT73266;
AAT73267; AAT73268; AAT73269; AAT73270; AAT73271; AAT73272; AAT73273; AAT73274;
AAT73275; AAT73276; AAT73277; AAT73278; AAT73279; AAT73280; AAT73281; AAT73282; AAT73283; AAT73284; AAT73285; AAT73286; AAT73287; AAT73288; AAT73289; AAT73290;
AAT73291; AAT73292; AAT73293; AAT73294; AAT73295; AAT73296; AAT73297; AAT73298;
AAT73299; AAT73300; AAT73301; AAT73302; AAT73303; AAT73304; AAT73305; AAT73306;
AAT73307; AAT73308; AAT73309; AAT73310; AAT73311; AAT73312; AAT73313; AAT76166;
AAV97601; AAV97602; AAV97603; AAV97604; AAT84153; AAT90832; AAV91220; AAV73972;
AAV73975; AAV73980; AAW59548; AAW59550; AAW59552; AAW59554; AAW59556; AAW59558; AAW59559; AAU08349; AAU08351; AAW59390; AAW59398; AAW59408; AAW19638; AAW19640;
AAW19642; AAW19644; AAW19646; AAV30828; AAV30836; AAV48546; AAV41002; AAV48778;
AAV48780; AAV74400; AAW80717; AAW80718; AAW80719; AAV91149; AAV97886; AAW30657;
AAX47288; AAW72226; AAX59694; AAW66002; AAX53504; AAX53505; AAX53506; AAX53507;
AAX53508; AAX53509; AAX53510; AAX83395; AAX83396; AAX83397; AAX83398; AAY57183; AAY57184; AAY57185; AAY57186; AAY57187; AAY57188; AAY57189; AAY57190; AAY57191;
AAY57192; AAY57193; AAY57194; AAY57195; AAY57196; AAY57197; AAY57198; ABB20262;
ABB87042; ABB87281; ABB87292; ABB87711; ABB88278; ABB88348; ABB88379; ABG88245;
ABI36041; AB 136012; ABI36023; AB 136034; ABI36040; AB 136042; ABI36043; AB 136044; ABI36045;
ABI36046; AB 136047; ABI36048; AB 136049; ABI36050; ABI36051; ABI36052; AB 136053; ABI36054; ABI36055; AB 136056; ABI36057; AB 136144; ABI36155; AB 136166; ABI36177; AB 136187; ABI36198;
ABI36275; AB 136286; ABI36295; AB 136307; ABI36318; AB 136329; ABI36340; AB 136351; ABI36362;
ABI36373; AB 136384; ABI36395; AB 136406; ABI36423; AB 136428; ABI36439; AB 136450; ABI36469;
ABI36480; ABI49396; ABI49407; ABI49415; ABI84424; ABI84465; ABI84495; ABI84497; ABI84598;
ABI84603; ABI84608; ABI84784; ABI84816; ABI84970; ABI85095; ABI85106; ABI85117; ABI85155; ABI95316; AB 195327; AB 195338; AB 195349; ABJ16565; ABJ16796; ABJ16807; ABJ16818; ABJ16928;
ABJ16917; ABJ16829; ABJ16939; ABJ51728; ABJ51717; ABJ51706; ABJ51695; ABJ51739; ABJ51684;
ABJ51673; ABJ16950; ABJ16840; ABJ16851; ABJ16862; ABJ16873; ABJ16884; ABJ16895; ABJ16906;
ABJ53526; ABJ53537; ABJ53548; ABJ53594; ABJ53583; ABJ53559; ABK40087; ABK40492;
ABK80003; ABL07008; ABL07019; ABL07030; ABL31744; ABL31755; ABL31766; ABL31780; ABM22048; ABM90434; ABM90445; ABM90456; ABM90467; ABM90478; ABM90489; ABM90500;
ABM90511; ABM90522; ABM90533; ABM90544; ABO37977; ABO38263; ABO44200; ABO44211;
ABO44222; ABO44233; ABO44244; ABO44255; ABO44266; ABO44277; ABO44288; ABO44299;
ABO44310; ABO52720; ABO52731; ABO52742; ABO52753; ABO77034; ABO77045; AAY21163;
AAY25499; AAY46328; AAY46329; AAY46330; AAY46331; AAY46332; AAY46333; AAY46334; AAY46335; AAY46336; AAY46337; AAY46338; AAY46339; AAY46340; AAY46341; AAY46342;
AAY46343; AAY46344; AAY46345; AAY46346; AAY46347; AAY46348; AAY46349; AAY46350;
AAY46351; AAY46352; AAY46353; AAY46354; AAY46355; AAY46356; AAY46357; AAY46358;
AAY46359; AAY46360; AAY46361; AAY46362; AAY46363; AAY46364; AAY46365; AAY46366;
AAY56367; AAY68363; AAY78953; AAZ29946; AAZ29947; AAZ29948; AAZ29949; AAZ29950; AAZ29951; AAZ29952; AAZ29953; AAZ29954; AAZ29955; AAZ29956; AAZ29957; AAZ29958;
AAZ29959; AAZ29960; AAZ29961; AAZ29962; AAZ29963; AAZ29964; AAZ29965; AAZ29966;
AAZ29967; AAZ29968; AAZ29969; AAZ29970; AAZ29971; AAZ29972; AAZ29973; AAZ29974;
AAZ29975; AAZ29976; AAZ29977; AAZ29978; AAZ29979; AAZ29980; AAZ29981; AAZ76389;
ABE68921; ABE68922; AAZ16275; ABE68923; ABE68924; ABE68925; ABE68926; AAZ16276;
AAZ16277; ABE68927; AAZ16278; AAZ16279; ABE68928; ABE68929; AAZ16280; ABE68930; ABE68931; ABE68932; AAZ16281; AAZ16282; AAZ72734; AAZ72735; AAZ72736; AAZ72737;
AAZ72738; AAZ72739; AAZ17522; AAZ17523; AAZ17524; AAZ23154; AAZ80486; AAZ78315;
ABA29447; AAZ82496; AAZ82497; ABA70758; ABB00917; ABB00918; ABB00919; ABB00920;
ABA39516; ABA39517; ABA39518; ABA39519; ABA39520; ABA87102; ABA87103; ABA54915;
ABA55714; ABA55715; ABA55716; ABA55717; ABB00582; ABB43058; ABB43059; ABB22773; ABB22774; ABB22775; ABB43119; ABB43127; ABB83598; ABB58817; ABB58818; ABB58819;
ABB58820; ABB58821; ABB80546; ABB86287; ABC47656; ABC59833; ABC66517; ABC66518;
ABC66519; ABC66520; ABC66521; ABC66522; ABC66523; ABC66524; ABC66525; ABC66526;
ABC66527; ABC66528; ABC66529; ABC66530; ABC66531; ABC66532; ABC66533; ABC66534;
ABC66535; ABC66536; ABC66537; ABC66538; ABC66539; ABC66540; ABC66541; ABC66542; ABC66543; ABC66544; ABC66545; ABC66546; ABC66547; ABC66548; ABC66549; ABC66550;
ABC66551; ABC66552; ABC66553; ABC66554; ABC66555; ABC66556; ABC66557; ABC66558;
ABC66559; ABC66560; ABC66561; ABC66562; ABC66563; ABC66564; ABC66565; ABC66566;
ABC66567; ABC66568; ABC66569; ABC66570; ABC66571; ABC66572; ABC66573; ABC66574;
ABC66575; ABC66576; ABC66577; ABC66578; ABC66579; ABC66580; ABC66581; ABC66582; ABC48787; ABC69216; ABC69224; ABC69232; ABC70167; ABC69148; ABC69149; ABC69150;
ABC70712; ABC72082; ABC87315; ABC72655; ABD32123; ABD32128; ABC88573; ABC88583;
ABD14806; ABD14807; ABD14808; ABD14809; ABD14810; ABD28180; ABD28181; ABD28182;
ABD16284; ABD46889; ABD49489; ABD60336; ABD60345; ABD46740; ABD73284; ABD52284;
ABD65415; ABD66291; ABD66292; ABD66293; ABD73804; ABD85144; ABD83818; ABD92945; ABD92953; ABD85374; ABD95991; ABE26829; ABE01046; ABE97547; ABE97548; ABE97549;
ABE97550; ABE97551; ABE97552; ABE97553; ABE97554; ABE97555; ABE97556; ABE97557;
ABE97558; ABE97559; ABE97560; ABE97561; ABE97562; ABE97563; ABE97564; ABE97565;
ABE97566; ABE97567; ABE97568; ABE97569; ABE97570; ABE97571; ABE97572; ABE97573;
ABE97574; ABE97575; ABE97576; ABE97577; ABE97578; ABE97579; ABE97580; ABE97581; ABE97582; ABE97583; ABE97584; ABE97585; ABE97586; ABE97587; ABE97588; ABE97589;
ABE97590; ABE97591; ABE97592; ABE97593; ABE97594; ABE97595; ABE97596; ABE97597;
ABE97598; ABE97599; ABE97600; ABE97601; ABE97602; ABE97603; ABE97604; ABE97605;
ABE97606; ABE97607; ABE97608; ABE97609; ABE97610; ABE97611; ABE97612; ABE97613;
ABE97614; ABE97615; ABE97616; ABE97617; ABE97618; ABE97619; ABE97620; ABE97621; ABE97622; ABE97623; ABE97624; ABE97625; ABE97626; ABE97627; ABE97628; ABE97629;
ABE97630; ABE97631; ABE97632; ABE97633; ABE97634; ABF56528; ABF58847; ABF56648;
ABG23657; ABF61761; ABG20463; ABG20464; ABG20465; ABG20466; ABG20467; ABG38185;
ABG38189; ABF72802; ABF93440; ABF93441; ABG49439; ABF84066; ABG45944; ABG75543;
ABG20468; ABG20472; ABG20476; ABG20478; ABG35546; ABG65732; ABI16504; ABG65733;
ABG67711; ABG67712; ABG67713; ABG67714; ABG57086; ABG57087; ABG57094; ABG57095; ABG78549; ABG78567; ABI34140; ABI34142; ABG67978; ABG75831; ABG75616; ABI23979;
ABG81037; ABG81O38; ABG81039; ABG81040; ABG81041; ABI18096; ABH85395; ABH09484;
ABH09485; ABH09486; ABH09487; ABH09488; ABH09489; ABH09490; ABJ98523; ABJ98525;
ABJ98527; ABJ98529; ABJ98531; ABI34124; ABK34764; ABJ88847; ABJ96647; ABJ96648;
ABJ96649; ABJ96650; ABJ96651; ABJ96652; ABJ96653; ABJ96654; ABJ96655; ABJ96656; ABJ96657; ABJ96658; ABJ96659; ABJ96660; ABJ96661; ABJ96662; ABJ96663; ABJ96664; ABJ96665; ABJ96666;
ABJ96667; ABJ96668; ABJ96669; ABJ96670; ABJ96671; ABJ96672; ABJ96673; ABJ96674; ABJ96675;
ABJ96676; ABJ96677; ABJ96678; ABJ96679; ABJ96680; ABJ96681; ABJ96682; ABJ96683; ABJ96684;
ABJ96685; ABJ96686; ABJ96687; ABJ96688; ABJ96689; ABJ96690; ABJ96691; ABJ96692; ABJ96693;
ABJ96694; ABJ96695; ABJ96696; ABJ96697; ABJ96698; ABJ96699; ABJ96700; ABJ96701; ABJ96702; ABJ96703; ABJ96704; ABJ96705; ABJ96706; ABJ96707; ABJ96708; ABJ96709; ABJ96710; ABJ96711;
ABJ96712; ABJ96713; ABJ96714; ABJ96715; ABJ96716; ABJ96717; ABJ96718; ABJ96719; ABJ96720;
ABJ96721; ABJ96722; ABJ96723; ABJ96724; ABJ96725; ABJ96726; ABJ96727; ABJ96728; ABJ96729;
ABJ96730; ABJ96731; ABJ96732; ABJ96733; ABJ96734; ABJ96735; ABJ96736; ABJ96737; ABJ96738;
ABJ96739; ABJ96740; ABJ96741 ; ABJ96742; ABJ96743; ABJ96744; ABJ96745; ABJ96746; ABJ96747; ABJ96748; ABJ96749; ABJ96750; ABJ96751; ABJ96752; ABJ96753; ABJ96754; ABJ96755; ABJ96756;
ABJ96757; ABJ96758; ABJ96759; ABJ96760; ABJ96761; ABJ96762; ABJ96763; ABJ96764; ABJ96765;
ABJ96766; ABJ96767; ABJ96768; ABJ96769; ABJ96770; ABJ96771; ABJ96772; ABJ96773; ABJ96774;
ABJ96775; ABJ96776; ABJ96777; ABJ96778; ABJ96779; ABJ96780; ABJ96781; ABJ96782; ABJ96783;
ABJ96784; ABJ96785; ABJ96786; ABJ96787; ABJ96788; ABJ96789; ABJ96790; ABJ96791; ABJ96792; ABJ96793; ABJ96794; ABJ96795; ABJ96796; ABJ96797; ABJ96798; ABJ96799; ABJ96800; ABJ96801;
ABJ96802; ABJ96803; ABJ96804; ABJ96805; ABJ96806; ABJ96807; ABJ96808; ABJ96809; ABJ96810;
ABJ96811; ABJ96812; ABJ96813; ABJ96814; ABJ96815; ABJ96816; ABJ96817; ABJ96818; ABJ96819;
ABJ96820; ABJ96821; ABJ96822; ABJ96823; ABJ96824; ABJ96825; ABJ96826; ABJ96827; ABJ96828;
ABJ96829; ABJ96830; ABJ96831; ABJ96832; ABJ96833; ABJ96834; ABJ96835; ABJ96836; ABJ96837; ABJ96838; ABJ96839; ABJ96840; ABJ96841; ABJ96842; ABJ96843; ABJ96844; ABJ96845; ABJ96846;
ABJ96847; ABJ96848; ABJ96849; ABJ96850; ABJ96851; ABJ96852; ABJ96853; ABJ96854; ABJ96855;
ABJ96856; ABJ96857; ABJ96858; ABJ96859; ABJ96860; ABJ96861; ABJ96862; ABJ96863; ABJ96864;
ABJ96865; ABJ96866; ABJ96867; ABJ96868; ABJ96869; ABJ96870; ABJ96871; ABJ96872; ABJ96873;
ABJ96874; ABJ96875; ABJ96876; ABJ96877; ABJ96878; ABJ96879; ABJ96880; ABJ96881; ABJ96882; ABJ96883; ABJ96884; ABJ96885; ABJ96886; ABJ96887; ABJ96888; ABJ96889; ABJ96890; ABJ96891;
ABJ96892; ABJ96893; ABJ96894; ABJ96895; ABJ96896; ABJ96897; ABJ96898; ABJ96899; ABJ96900;
ABJ96901 ; ABJ96902; ABJ96903; ABJ96904; ABJ96905; ABJ96906; ABJ96907; ABJ96908; ABJ96909;
ABJ96910; ABJ96911; ABJ96912; ABJ96913; ABJ96914; ABJ96915; ABJ96916; ABJ96917; ABJ96918;
ABJ96919; ABJ96920; ABJ96921 ; ABJ96922; ABJ96923; ABJ96924; ABJ96925; ABJ96926; ABJ96927;
ABJ96928; ABJ96929; ABJ96930; ABJ96931; ABJ96932; ABJ96933; ABJ96934; ABJ96935; ABJ96936; ABJ96937; ABJ96938; ABJ96939; ABJ96940; ABJ96941; ABJ96942; ABJ96943; ABJ96944; ABJ96945;
ABJ96946; ABJ96947; ABJ96948; ABJ96949; ABJ96950; ABJ96951; ABJ96952; ABJ96953; ABJ96954;
ABJ96955; ABJ96956; ABJ96957; ABJ96958; ABJ96959; ABJ96960; ABJ96961; ABJ96962; ABJ96963;
ABJ96964; ABJ96965; ABJ96966; ABJ96967; ABJ96968; ABJ96969; ABJ96970; ABJ96971; ABJ96972;
ABJ96973; ABJ96974; ABJ96975; ABJ96976; ABJ96977; ABJ96978; ABJ96979; ABJ96980; ABJ96981; ABJ96982; ABJ96983; ABJ96984; ABJ96985; ABJ96986; ABJ96987; ABJ96988; ABJ96989; ABJ96990;
ABJ96991 ; ABJ96992; ABJ96993; ABJ96994; ABJ96995; ABJ96996; ABJ96997; ABJ96998; ABJ96999;
ABJ97000; ABJ97001; ABJ97002; ABJ97003; ABJ97004; ABJ97005; ABJ97006; ABJ97007; ABJ97008;
ABJ97009; ABJ97010; ABJ97011; ABJ97012; ABJ97013; ABJ97014; ABJ97015; ABJ97016; ABJ97017;
ABJ97018; ABJ97019; ABJ97020; ABJ97021; ABJ97022; ABJ97023; ABJ97024; ABJ97025; ABJ97026; ABJ97027; ABJ97028; ABJ97029; ABJ97030; ABJ97031; ABJ97032; ABJ97033; ABJ97034; ABJ97035;
ABJ97036; ABJ97037; ABJ97038; ABJ97039; ABJ97040; ABJ97041 ; ABJ97042; ABJ97043; ABJ97044;
ABJ97045; ABJ97046; ABJ97047; ABJ97048; ABJ97049; ABJ97050; ABK00133; AB 194741;
AB 194747; AB 194754; AB 194764; AB 196729; ABI96730; ABI96741; ABJ09476; AB 196767; ABJ09545;
ABI96701; ABJ16473; ABJ15720; ABI98911; ABJ09528; ABI98919; AB 197335; ABJ52562; ABJ80592; ABK00083; ABK00087; ABK00096; ABI98929; ABK00132; ABI97303; ABJ09511; ABJ09498;
ABJ09466; ABJ09518; ABJ09488; ABK00104; ABI98938; ABK13783; ABK13784; ABK13782;
ABJ53148; ABK32775; ABK32776; ABK32777; ABK32778; ABK32779; ABK32780; ABK32781;
ABK32782; ABK34511; ABK34512; ABK34513; ABJ90343; ABK79301; ABK79302; ABK79303;
ABK79304; ABL1OO88; ABL74499; ABL74500; ABL75919; ABL63754; ABL63755; ABL63756; ABL63757; ABL63758; ABL63759; ABL63760; ABL63761; ABL63762; ABL63763; ABL63764;
ABL63765; ABL63766; ABL63767; ABL63768; ABL63769; ABL63770; ABL63771; ABL63772;
ABM54179; ABM54180; ABO76638; ABO76639; ABO76640; ABO76641; ABO76642; ABO76643;
ABO76644; ABM92273; ABN54791; ABN54792; ABO14789; ABO14790; ABO30505; ABN70706;
ABN70707; ABN70708; ABN70709; ABN70710; ABN70711; ABO13912; ABO13920; ABO38179; ABO20946; ABO10162; ABO10163; ABO10181; ABO10183; ABO10184; ABO10185; ABO10186;
ABO10187; ABO20962; ABO64687; ABO64688; ABO64689; ABO64690; ABO64691; ABO64692;
ABO64693; ABO64694; ABO64695; ABO64696; ABO64697; ABO30353; ABO30354; ABO30355;
ABO30359; ABO30360; ABO30361; ABO30346; ABO30347; ABO31434; AAA43199; AAA43094;
AAL34297; AAL34298; AAL34299; AAA43159; AAA43160; AAA43082; AAA43083; AAA43205; AAB29507; AAB82064; AAA74909; AAA74910; AAC54378; AAC54390; AAC54391; AAC54392;
AAC54393; AAB49654; AAB49655; AAB19072; AAB19073; AAB19074; AAB19075; AAB19076;
AAB19077; AAB19078; AAB19079; AAB19080; AAB 19081; AAB19082; AAB19083; AAB19084;
AAB19085; AAB19086; AAB19087; AAB19088; AAB19089; AAC58999; AAB39639; AAC58990;
AAC58991; AAC58992; AAC58993; AAC58994; AAC58995; AAC58996; AAC58997; AAC58998;
CAA30680 and CAA30719. [00161] Nucleic acid sequences encoding influenza virus subtype H6 haemagglutinins suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI)
Entrez nucleotide search and retrieval system:
[00162] AB278600; AB286875; AJ410532; AJ410533; AJ410534; AJ410535; AJ410536; AJ410537; AJ410538; AJ410539; AJ410540; AJ410541; AJ410542; AJ410543; AJ410544; AJ410545; AJ410546;
AJ410547; AJ427308; AJ507203; AJ507204; AJ507205; AJ507206; AJ507207; AJ507208; AJ507209;
AJ697867; AJ697868; AJ697869; AJ697870; AJ697871; AY633188; AY633204; AY633220; AY633236;
AY633300; AY633308; AY633316; AY633324; AY633332; AY633380; AY684892; AY703832;
AY773907; AY862613; AY968676; CY004034; CY004035; CY004036; CY004037; CY004038; CY004039; CY004043; CY004054; CY004066; CY004072; CY004076; CY004080; CY004086;
CY004094; CY004114; CY004129; CY004137; CY004142; CY004146; CY004154; CY004162;
CY004170; CY004178; CY004186; CY004194; CY004202; CY004210; CY004218; CY004226;
CY004234; CY004242; CY004250; CY004258; CY004266; CY004274; CY004282; CY004515;
CY004523; CY005106; CY005597; CY005605; CY005691; CYOO5881; CY011112; CY012832; CY013255; CY013863; CY014561; CY014607; CY014616; CY014623; CY014656; CY014764;
CY014880; CY014888; CY014909; CY014945; CY014953; CY015127; CY015451; CY015476;
CY015484; CY016124; CY016132; CY016156; CY016164; CY016172; CY016619; CY017789;
CYO 18007; CYO 18893; CYO 18909; CYOl 8917; CY020781; CY020813; CY020821; CY020829;
CY020837; CY020845; CY020853; CY020869; CY020957; CY020973; CY020989; CY021197; CY021205; CY021477; CY021677; D90303; DQ021649; DQ021650; DQ021651; DQ021652; DQ021653;
DQ021654; DQ021655; DQ021656; DQ021657; DQ021658; DQ021659; DQ021660; DQ021661;
DQ021662; DQ021663; DQ021664; DQ021665; DQ021666; DQ021667; DQ021668; DQ021669;
DQ021670; DQ021671; DQ021672; DQ021673; DQ021675; DQ021676; DQ021677; DQ021678;
DQ021679; DQ021680; DQ021681; DQ021682; DQ021683; DQ021684; DQ285546; DQ376618; DQ376619; DQ376620; DQ376621; DQ376622; DQ376623; DQ376624; DQ376625; DQ376626;
DQ376627; DQ376628; DQ376629; DQ376630; DQ376631; DQ376632; DQ376633; DQ376634;
DQ376635; DQ376636; DQ376637; DQ376638; DQ376639; DQ376640; DQ376641; DQ376642;
DQ376643; DQ376644; DQ376645; DQ376646; DQ376647; DQ376648; DQ376649; DQ376650;
DQ376651; DQ376652; DQ376653; DQ408509; DQ408517; DQ408524; DQ822190; DQ822198; J02158; AB294213; AB294215; AB294219; AB295615; AB296072; AB298279; AF100181; AF250479;
AF310983; AF310984; AF310985; AF457663; AF457664; AF457665; AF457666; AF457667; AF457668;
AF457669; AF457670; AF457679; AF457688; AF457696; AF457704; AF457713; AF457715; AF474029;
AF474030; AF474031; AF474032; AF474033; AF474034; AF474035; AF474036; AF474037; AF474038;
AJ410519; AJ410520; AJ410521; AJ410522; AJ410523; AJ410524; AJ410525; AJ410526; AJ410527;
AJ410528; AJ410529; AJ410530 and AJ410531. [00163] Nucleic acid sequences encoding influenza virus subtype H7 haemagglutinins suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI)
Entrez nucleotide search and retrieval system:
[00164] AB262459; AF072385; AF202256; AF322021; AF322022; AF322023; AF322024; AF322025; AF322026; AF364133; AF364134; AF364135; AF364136; AF364137; AF364138; AF364139; AF364140;
AF364141; AF364142; AF364143; AF364144; AF364145; AF364146; AF364147; AF364148; AF364149;
AF364150; AF364151; AF364152; AF364153; AF364154; AF364155; AF364156; AF364157; AF364158;
AF364159; AF364160; AF364161; AF364162; AF364163; AF364164; AF364165; AF364166; AF364167;
AF364168; AF364169; AF364170; AF364171; AF364172; AF497551; AF497552; AF497553; AF497554; AF497555; AF497556; AF497557; AF497558; AF497559; AJ489520; AJ491720; AJ493212; AJ493213;
AJ493214; AJ493215; AJ493216; AJ493217; AJ493466; AJ493467; AJ493468; AJ493469; AJ493470;
AJ493471; AJ493472; AJ580353; AJ584647; AJ620350; AJ627491; AJ627493; AJ697872; AJ697873;
AJ704797; AJ704798; AJ704799; AJ704810; AJ704811; AJ704812; AJ704813; AM087214; AM087223;
AY240877; AY240878; AY240879; AY240880; AY240881; AY240882; AY240883; AY240884; AY240885; AY240886; AY240887; AY240888; AY240889; AY240890; AY240891; AY240892;
AY240893; AY240894; AY240895; AY240896; AY240897; AY240898; AY240899; AY240900;
AY240901; AY240902; AY240903; AY240904; AY240905; AY240906; AY240907; AY240908;
AY240909; AY240910; AY240911; AY240912; AY240913; AY240914; AY240915; AY240916;
AY240917; AY240918; AY240919; AY240920; AY240921; AY240922; AY240923; AY240924; AY240925; AY303630; AY303631; AY303632; AY303633; AY303634; AY303635; AY338455;
AY338456; AY338457; AY338458; AY338459; AY338460; AY338461; AY338462; AY383756;
AY559235; AY586408; AY586409; AY586410; AY586411; AY596307; AY611524; AY644402;
AY646078; AY648287; AY650270; AY672090; AY724257; AY724684; AY725855; AY730057;
AY731820; AY734541; AY736323; AY831668; AY831669; AY831670; AY943924; AY999977; AY999978; AY999979; AY999980; AY999981; AY999982; AY999983; AY999984; AY999985;
AY999986; AY999987; AY999988; AY999989; AY999990; AY999991; CY005928; CY005973;
CY005974; CY005975; CY005976; CY005978; CY005980; CY005981; CY005983; CY006029;
CY006037; CY014587; CY014612; CY014718; CY014721; CY014778; CY014786; CY014896;
CY014992; CY015006; CY015014; CY015027; CY015033; CY015065; CY016188; CY018901; CY020581; CY020589; CY020597; CY020605; CY020613; CY020685; CY020885; CY021357;
CY021365; CY021405; CY021413; CY021421; CY021485; CY021493; CY021501; CY021533;
CY021541; CY021549; CY021557; CY021621; CY021637; DQ003216; DQ017504; DQ017513;
DQ525411; DQ838510; DQ838511; DQ838512; DQ838513; DQ838514; DQ838515; DQ870888;
DQ870894; DQ873807; DQ907527; DQ907528; DQ991304; DQ991312; DQ991320; DQ991328;
DQ991336; DQ991343; EF467825; EF467826; J02164; K00429; L37794; L43913; L43914; L43915; M17735; M17736; M24457; M24458; M31689; M58657; U20458; U20459; U20461; U20462; U20463;
U20464; U20465; U20466; U20467; U20468; U20469; U20470; U20471; X61627; X62552; X62553;
X62554; X62555; X62556; X62557; X62558; X62559; X62560; Z12617; Z47199; AB262468; AB262469;
AB262470; AB262471; AB262472; AB262473; AB268557; AB269692; AB269693; AB269694;
AB269695; AB269696; AB269872; AB270592; AB270593; AB297923; AB297925; AB298277; AF028020; AF028021; AF071775; AF071776; AF072383; AF072384; AF072386; AF072387; AF072388;
AF072389; AF072390; AF072391 ; AF072392; AF072393; AF072394; AF072395; AF072396; AF072397;
AF072398; AF072399; AF072400; AF072401; AF072402; AF149295; AF202226; AF202227; AF202228;
AF202229; AF202230; AF202231 ; AF202232; AF202233; AF202234; AF202235; AF202236; AF202237;
AF202238; AF202239; AF202240; AF202241; AF202242; AF202243; AF202244; AF202245; AF202246; AF202247; AF202248; AF202249; AF202250; AF202251; AF202252; AF202253; AF202254 and
AF202255.
[00165] Nucleic acid sequences encoding influenza virus subtype H8 haemagglutinins suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI) Entrez nucleotide search and retrieval system:
[00166] AB289343; AF310987; AF310988; AF310989; CY005970; CY005971; CY005972;
CY014583; CY014659; CY015173; CY017749; D90304; EF061122 and J02089.
[00167] Nucleic acid sequences encoding influenza virus subtype H9 haemagglutinins suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI)
Entrez nucleotide search and retrieval system:
[00168] J02166; AF156385; AF156386; AF156387; AF156388; AF156389; AF156390; AF156373;
AF156374; AF156375; AF156376; AF156377; AF156378; AF156379; AF156380; AF156381; AF156382;
AF156383; AF156384; AF186266; AF186267; AF186268; AF186269; AF203008; AF203009; AF203010; AF203011; AF203012; AF203013; AF203014; AF203015; AF222606; AF222607; AF222608; AF222609;
AF222610; AF222611; AF222612; AF222613; AF218086; AF218087; AF218088; AF218089; AF218090;
AF218091; AF218092; AF218093; AF218094; AF218095; AF218096; AF218097; AF218098; AF218099;
AF218100; AF218101; AF218102; AF218103; AF218104; AF218105; AF218106; AF218107; AF218108;
AF218109; AF218110; AF218111; AF218112; AF218113; AF218114; AF218115; AF218116; AF218117; AF218118; AF218119; AF218120; AF384557; AY036880; AF222810; AF222811; AF400776;
AF400777; AY043014; AY043015; AY043017; AY043018; AY043019; AF461509; AF461510;
AF461511; AF461512; AF461513; AF461514; AF461515; AF461516; AF461517; AF461518; AF461519;
AF461520; AF461521; AF461522; AF461523; AF461524; AF461525; AF461526; AF461527; AF461528;
AF461529; AF461530; AF461531; AF461532; AY083840; AY083841; AF536689; AF536690;
AF536691; AF536692; AF536693; AF536694; AF536695; AF536696; AF536697; AF536698; AY180444; AY180445; AY180446; AY180447; AY180448; AY180449; AY180450; AYl 80451;
AY180452; AY180453; AY180454; AY180455; AY180456; AY180457; AY180458; AY180459;
AY206671; AY206672; AY206673; AY206674; AY206675; AY206676; AY206677; AY206678;
AY206679; AY206680; AY198313; AY198314; AY198315; AY198316; AY198317; AY198318;
AY198319; AY198320; AY198321; AY281745; AY264870; AY264871; AY264872; AY264875; AY264876; AY294658; AF523372; AF523373; AF523374; AF523375; AF523376; AF523377;
AF523378; AF523379; AF523380; AF523381; AF523382; AF523383; AF523384; AF523385; AF523386;
AF523387; AF523388; AF523389; AF523390; AY336597; AF508554; AF508555; AF508556;
AF508557; AF508558; AF508559; AF508560; AF508561; AF508562; AF508563; AF508564; AF508565;
AF508566; AF508567; AF508568; AF508569; AF508570; AF508571; AF508572; AF508573; AF508574; AY345925; AY345926; AY345927; AY345928; AY345929; AY345930; AY345931; AY345932;
AY345933; AY345934; AY345935; AY345936; AY345937; AY345938; AY345939; AY345940;
AY364228; AY330332; AY330333; AY330334; AY330335; AY330336; AY435039; AY435040;
AY513715; AY548499; AY548500; AY548501; AY548502; AY548503; AY548504; AY548505;
AY548506; AY548507; AY548508; AY548509; AY548510; AY548511; AY548512; AY548513; AY548514; AY548515; AY603067; AY549889; AY623810; AY633116; AY633164; AY633276;
AY633292; AY652980; AY594194; AY594195; AY594196; AY664660; AY664661; AY664662;
AY664663; AY664664; AY664665; AY664666; AY664667; AY664668; AY664669; AY664670;
AY664671; AY664672; AY664673; AY664674; AY664675; AY664676; AY664677; AY664678;
AY743216; AY768552; AY768553; AY768554; AY768555; AY768556; AY768557; AY768558; AY768559; AY790275; AY790283; AY790297; AY790305; AY790313; AY790314; AY790315;
AY790320; AY738451; AY738452; AY738453; AY738454; AY738455; AY738456; AY851460;
AY851461; AY862598; AY862599; AY862600; AY862601; AY862602; AY862603; AY862604;
AY862605; AY862606; AY937403; AY937404; AY949989; DQ003335; DQ064354; DQ064355;
DQ064356; DQ064357; DQ064358; DQ064359; DQ064360; DQ064361; DQ064362; DQ064363; DQ064364; DQ064365; DQ064366; DQ064367; DQ064368; DQ064369; DQ064370; DQ064371;
DQ064372; DQ064373; DQ064374; DQ064375; DQ064376; DQ064377; DQ064378; DQ064379;
DQ064380; DQ067444; DQ108905; DQ108906; DQ108907; DQ108908; DQ108909; DQ108910;
DQ108911; DQ108912; DQ108913; DQ108914; DQ108915; DQ108916; DQ108917; DQ108918;
DQ108919; DQ108920; DQ108921; DQ108922; DQ108923; DQ108924; DQ108925; DQ108926; DQ108927; DQ108928; DQ108929; DQ108930; DQ108931; DQ108932; DQ104448; DQ104449;
DQ104450; DQ104451; DQ104452; DQ104453; DQ104454; DQ104455; DQ104456; DQ104457;
DQ104458; DQ104459; DQ104460; DQ104461; DQ104462; DQ104463; DQ104464; DQ104465;
DQ104466; DQ104467; DQ104468; DQ104469; DQ104470; DQ104471; DQ104472; DQ104473;
DQ104474; DQ104475; DQ104476; DQ104477; DQ104478; DQ104479; DQ104480; DQ104481;
DQ104482; DQ104483; DQ104484; DQ104485; DQ225271; DQ227352; DQ223544; CY004420; CY004642; CY005632; CY005639; CY005746; DQ234277; DQ226106; DQ226107; DQ226108;
DQ226109; DQ226110; DQ226111; DQ226112; DQ226113; DQ226114; DQ226115; DQ226116;
CY005919; CY005929; CY005934; CY005984; CY005985; CY005986; CY005987; CY005988;
CY005989; CY005990; CY005991; CY005992; CY006025; CY006042; CY006018; CY006021;
CY006023; DQ299829; DQ299837; DQ299845; DQ299853; DQ299861; DQ390215; DQ464352; DQ473608; DQ473609; DQ473610; DQ473611; DQ473612; DQ473613; DQ473614; DQ465400;
DQ485208; DQ485216; DQ485224; DQ681203; DQ681207; DQ681216; DQ681221; DQ885991;
DQ787797; DQ787802; CY014613; CY014663; DQ997505; DQ997481; DQ997474; DQ997437;
DQ997460; DQ997187; DQ997465; DQ997490; DQ997451; DQ997419; DQ997448; EF070733;
EF063510; EF063511; EF063512; EF063513; EF063514; EF063515; EF063516; EF154907; EF154908; EF154909; EF154910; EF154911; EF154912; EF154913; EF154914; EF154915; EF154916; EF154917;
EF154918; EF154919; EF154920; EF154921; EF154922; EF154923; EF154924; EF154925; EF154926;
EF154927; EF154928; EF154929; EF154930; EF154931; EF154932; EF154933; EF154934; EF154935;
EF154936; EF154937; EF154938; EF154939; EF154940; EF154941; EF154942; EF154943; EF154944;
EF154945; EF154946; EF154947; EF154948; EF154949; EF154950; EF154951; EF154952; EF154953; EF154954; EF154955; EF154956; EF154957; EF154958; EF154959; EF154960; EF154961; EF154962;
EF154963; EF154964; EF154965; EF154966; EF154967; EF154968; EF154969; EF154970; EF154971 ;
EF154972; EF154973; EF154974; EF154975; EF154976; EF154977; EF154978; EF154979; D90305;
AB049159; AB049160; AB080224; AB080225; AB080226; AB080227; AB080228; AB125927;
AB125928; AB125929; AB125930; AB125931; AB262463; AB276111; AB256666; AB256674; AB256682; AB256690; AB256698; AB256706; AB256714; AB256722; AB256730; AB256738;
AB256746; AB295601; AJ404626; AJ404627; AJ291392; AJ536330; AJ536331; AJ536332; AJ781818;
AJ781819; AJ781820; AJ781821; AJ781822; AJ781823; AJ781824; AJ781825; AJ781826; AJ781827;
AM087218; AM087219; AM286688 and AM286689.
[00169] Nucleic acid sequences encoding influenza virus subtype HlO haemagglutinins suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI)
Entrez nucleotide search and retrieval system:
[00170] AB271117; AB274041; CY005996; CY005997; CY005998; CY005999; CY006000;
CY006001; CY014619; CY014644; CY014671; CY014739; CY017781; CY020901; CY020909; CY020925; DQ374399; J02110; M21646; M21647; AB289339; AB292412; AB292666; AB292781;
AB296078; AF311750; AM087215; AM087216; CY005921; CY005922; CY005930; CY005982;
CY005993; CY005994 and CY005995.
[00171] Nucleic acid sequences encoding influenza virus subtype HI l haemagglutinins suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI) Entrez nucleotide search and retrieval system:
[00172] AB277756; AB288845; DQ424861; DQ435281; DQ435282; DQ435283; DQ435284;
DQ435285; DQ482667; EF200063; J02100; J02106; J02107; J02108; J02161; AB292779; AB292783;
AB296076; AB298283; AF310986; AY684895; CY005923; CY005924; CY006002; CY006003;
CY006004; CY006005; CY014593; CY014595; CY014679; CY014687; CY014719; CY014806; CY017075; CY017765; CY017845; CY018015; CY020941; CY020949; CY020965; CY021133;
CY021141; CY021149; CY021165; CY021173; CY021181; CY021245; CY021253; CY021437;
CY021445; CY021469; CY021613; CY021645; CY021653; CY021661; CY021669; CY021685; D90306;
DQ080993; DQ327835; DQ424858; DQ424859 and DQ424860.
[00173] Nucleic acid sequences encoding influenza virus subtype H12 haemagglutinins suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI)
Entrez nucleotide search and retrieval system:
[00174] AB288334; AB288843; AF310990; AF310991; AF310992; AM286685; CY005920;
CY005925; CY006006; CY006007; CY006008; CY012840; CY014598; CY014636; CY016419; CY017733; CY017853; CY021293; CY021301; D90307; DQ787811 and J02104.
[00175] Nucleic acid sequences encoding influenza virus subtype Hl 3 haemagglutinins suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI)
Entrez nucleotide search and retrieval system: [00176] AB284988; AB285094; AB292664; AM087220; AM087221; AY684886; AY684887;
CY005914; CY005931; CY005932; CY005979; CY014603; CY014694; CY014720; D90308; K00383;
M26089; M26090 and M26091.
[00177] Nucleic acid sequences encoding influenza virus subtype H14 haemagglutinins suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI)
Entrez nucleotide search and retrieval system:
[00178] AB289335 and CY014604.
[00179] Nucleic acid sequences encoding influenza virus subtype Hl 5 haemagglutinins suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI)
Entrez nucleotide search and retrieval system:
[00180] CY006010; CY006033; CY006034; L43917; CY006032; AB295613; CY006009 andL43916.
[00181] Nucleic acid sequences encoding influenza virus subtype H16 haemagglutinins suitable for inclusion as a cargo moiety in conjugates according to the present invention have the following accession numbers and are available to the public via the National Center for Biotechnology Information (NCBI)
Entrez nucleotide search and retrieval system:
[00182] CY005933; CY014599; CY015160; AY684888; AY684889; AY684890 and AY684891.
[00183] Thus, a nucleic acid sequence encoding an influenza virus haemagglutinin is optionally included as a cargo moiety. [00184] In particular embodiments, influenza virus haemagglutinin protein or an antigenic portion thereof is included in a conjugate composition for administration to a subject to enhance an immune response to influenza virus.
[00185] In other embodiments, the virus conjugated to a sialoadhesin binding antibody may be used as a gene transfer vector in order to express a desired nucleic acid in a target cell. Such viruses are known in the art and include herpes viruses, adenoviruses and adeno-associated viruses, for example.
[00186] In further embodiments, a viral cargo moiety is a virus or portion thereof expressing no non- viral proteins. A cargo moiety virus is a porcine arterivirus in one embodiment.
Conjugation
[00187] A cargo moiety is conjugated to a sialoadhesin binding moiety by any of various methods. The conjugation method chosen will depend on the chemical identity of the cargo and the sialoadhesin binding moiety.
[00188] A conjugate according to embodiments of the present invention encompasses a sialoadhesin binding moiety and a cargo linked together by chemical bonding, covalent or non-covalent, as well as by recombinant techniques including production of a fusion protein, such as a conjugate produced using a nucleic acid expression construct encoding a sialoadhesin binding moiety and a cargo.
[00189] In particular embodiments, a cargo moiety and a sialoadhesin binding moiety are chemically linked via free functional groups on these moieties. Such functional groups illustratively include amino, carboxyl, hydroxyl, and sulfhydryl groups.
[00190] A linkage between a cargo moiety and a sialoadhesin binding moiety is illustratively an ester, an ether, a carbamate, a carbonate, a disulfide, a peptide, and an amide. The term "linkage" refers to a bond or group formed by chemical reaction between the two moieties such that the moieties are covalently coupled, directly or indirectly.
[00191] In one embodiment, a linkage between a sialoadhesin binding moiety and a cargo moiety is labile in an intracellular environment, such that the sialoadhesin binding moiety and cargo moiety may be separated following cell uptake. For instance, a linkage may be susceptible to hydrolysis, enzymatic
cleavage, or other form of cleavage, such that the cargo moiety provides a desired effect following such separation from the sialoadhesin binding moiety. An ester linkage is one example of a linkage susceptible to hydrolysis in a cell. A disulfide linkage is a further example of a linkage susceptible to cleavage following cell uptake. In other embodiments, a cargo moiety provides a desired effect while conjugated to the sialoadhesin binding moiety.
[00192] In one embodiment, more than one cargo moiety may be included in a conjugate composition. Further, more than one sialoadhesin binding moiety may be included in a conjugate composition. [00193] Where one or both of the sialoadhesin binding moiety and the cargo moiety include a peptide and/or protein, functional group of a cargo moiety and a sialoadhesin binding moiety used to conjugate these moieties can be at N- or C- terminus or at between the termini of one or both peptides or proteins. [00194] A protective group may be added to a sialoadhesin binding moiety and/or cargo moiety in a process to form a conjugate according to the present invention. Such groups, their generation and use are described in Protective Groups in Organic Synthesis by T.W. Greene and P.G.M. Wuts, John Wiley & Sons, 1999. [00195] Conjugation chemistries used in conjugation of a cargo moiety and a sialoadhesin binding moiety illustratively include coupling agents such as, but not limited to, glutaraldehyde, carbodiimide, succinimde esters, benzidine, periodate, isothionate and combinations of these.
[00196] A conjugate according to the present invention is optionally produced using recombinant techniques. For example, in particular embodiments, a conjugate is an expression product of a nucleic acid construct including an expression construct encoding a fusion protein, the fusion protein including a sialoadhesin binding moiety or portion thereof and a cargo moiety linked directly to the sialoadhesin binding moiety or portion thereof or through an intermediate linker.
[00197] In particular embodiments, an expression construct encoding a fusion protein encodes an anti- sialoadhesin antibody or a fragment of an anti-sialoadhesin antibody. Thus, in particular embodiments, an expression construct encodes a fusion protein including a nucleic acid which encodes a cargo moiety and an anti-sialoadhesin antibody or portion thereof. For example, an expression construct encoding a fusion protein according to the present invention encodes a cargo attached to a portion of an anti-sialoadhesin antibody including a variable region of an anti-sialoadhesin antibody such as, but not limited to, a heavy chain variable region and/or a light chain variable region, a single chain VL-VH region, and/or an H chain C region in particular embodiments.
[00198] In particular embodiments, an expression construct encoding a fusion protein encodes a cargo moiety and mAb 41D3 or a portion of mAb 41D3. In further particular embodiments, an expression construct encoding a fusion protein encodes an influenza virus haemagglutinin and mAb 41D3 or a portion of mAb 41D3. [00199] In particular embodiments, an expression construct encoding a fusion protein encodes a cargo
moiety and mAb 7D2 or a portion of mAb 7D2. In further particular embodiments, an expression construct encoding a fusion protein encodes an influenza virus haemagglutinin and mAb 7D2 or a portion of mAb 7D2.
[00200] In particular embodiments, an expression construct encoding a fusion protein encodes a cargo moiety and mAb MCA2316 or a portion of mAb MCA2316. In further particular embodiments, an expression construct encoding a fusion protein encodes an influenza virus haemagglutinin and mAb MCA2316 or a portion of mAb MCA2316.
[00201] Cloning and expression of nucleic acids encoding antibody regions and fusion proteins including an antibody region are known in the art as exemplified in J. D. Pound (Ed.) Immunochemical Protocols, Methods in Molecular Biology, Humana Press; 2nd ed., 1998, chapter 43; R. Kontermann and S. Dubel (Eds.), Antibody Engineering, Springer Lab Manuals, Springer, 2001; and B.K.C. Lo (Ed.), Antibody Engineering: Methods and Protocols, Methods in Molecular Biology, Humana Press, 2003. [00202] A cargo moiety and a sialoadhesin binding moiety may be linked directly to form a conjugate. Alternatively, a linker may be bound to both a cargo moiety and to a sialoadhesin binding moiety, such that these moieties are indirectly linked through the linker. A linker may be a homo bifunctional linker or a hetero-bifunctional linker, depending on the identity of the moieties to be conjugated. Further, a linker may be multifunctional so as to link more than one cargo moiety and/or more than one sialoadhesin binding moiety. [00203] In general, a linker has about 1-20 backbone carbon atoms. However, a linker may be larger or smaller.
[00204] Optionally, a linker is encoded by a nucleic acid in an expression construct. [00205] A linker may be a natural or synthetic polymer in some embodiments. For example, suitable polymers include agarose, carboxymethylcellulose, cellulose, dextran, and polyaminopolystyrene. A preferred polymer is polyacrylamide, PEO (polyethylene) or PEG (polyethylene glycol) spacer. [00206] In one embodiment, a sialoadhesin binding moiety including a sialic acid and/or sialylated structure may be conjugated to a cargo moiety directly or indirectly. For example, a sialic acid residue may be conjugated to a lipid-containing cargo moiety to form a glycolipid conjugate composition and/or to a protein or peptide cargo moiety by N-linkage or O-linkage to form a glycopeptide or glycoprotein conjugate according to the present invention. A sialic acid residue may also be conjugated to a linker. Pharmaceutical Compositions And Administration
[00207] A conjugate of the present invention can be administered to a subject alone or as part of a pharmaceutical composition. Inventive conjugate compositions are suitable for administration to patients by a variety of routes illustratively including, but not limited to, intravenous, oral, parenteral, intramuscular, subcutaneous and mucosal. [00208] An inventive pharmaceutical composition includes a conjugate according to the present
invention and a pharmaceutically acceptable carrier. The term "pharmaceutically acceptable" refers to a material which can be administered to a subject along with an inventive conjugate composition without causing significant undesirable biological effects and without interacting in a deleterious manner with any other component of the pharmaceutical composition. [00209] Pharmaceutical compositions suitable for administration illustratively include physiologically acceptable sterile aqueous or nonaqueous solutions, dispersions, suspensions or emulsions, and sterile powders for reconstitution into sterile injectable solutions or dispersions. Examples of suitable aqueous and nonaqueous carriers; diluents; solvents; or vehicles include water, ethanol, polyols such as, but not limited to, propylene glycol, polyethylene glycol, glycerol, and the like, suitable mixtures thereof; vegetable oils such as, but not limited to, olive oil; and injectable organic esters such as, but not limited to, ethyloleate. Proper fluidity can be maintained, for example, by the use of a coating such as, but not limited to, lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants. [00210] Compositions suitable for injection optionally include physiologically acceptable sterile aqueous or nonaqueous solutions, dispersions, suspensions or emulsions, and sterile powders for reconstitution into sterile injectable solutions or dispersions. Examples of suitable aqueous and nonaqueous carriers, diluents, solvents or vehicles include water, ethanol, polyols (propyleneglycol, polyethyleneglycol, glycerol, and the like), suitable mixtures thereof, vegetable oils (such as olive oil) and injectable organic esters such as, but not limited to, ethyl oleate. Proper fluidity can be maintained, for example, by the use of a coating such as, but not limited to, lecithin, by the maintenance of the required particle size in the case of dispersions and by the use of surfactants.
[00211] Pharmaceutical compositions according to the present invention may also contain adjuvants such as, but not limited to, preserving, wetting, emulsifying, and dispensing agents. Prevention of the action of microorganisms can be ensured by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, and the like. It may also be desirable to include isotonic agents, for example, sugars, sodium chloride, and the like. Prolonged absorption of an injectable pharmaceutical form can be brought about by the use of agents delaying absorption, for example, aluminum monostearate and gelatin. [00212] Further exemplary adjuvants include immunostimulating adjuvants such as, but not limited to, Freund's complete adjuvant; Freund's incomplete adjuvant; aluminum hydroxide such as commercially available as Alhydrogel, Accurate Chemical & Scientific Co, Westbury, New York; and Gerbu adjuvant, available from C-C Biotech, Poway, California.
[00213] Solid dosage forms for oral administration include capsules, tablets, pills, powders, and granules. In such solid dosage forms, an inventive conjugate is admixed with at least one inert customary excipient (or carrier) such as, but not limited to, sodium citrate or dicalcium phosphate or (a) fillers or extenders, as for example, starches, lactose, sucrose, glucose, mannitol, and silicic acid, (b) binders, as for
example, carboxymethylcellulose, alignates, gelatin, polyvinylpyrrolidone, sucrose, and acacia, (c) humectants, as for example, glycerol, (d) disintegrating agents, as for example, agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain complex silicates, and sodium carbonate, (e) solution retarders, as for example, paraffin, (f) absorption accelerators, as for example, quaternary ammonium compounds, (g) wetting agents, as for example, cetyl alcohol, and glycerol monostearate, (h) adsorbents, as for example, kaolin and bentonite, and (i) lubricants, as for example, talc, calcium stearate, magnesium stearate, solid polyethylene glycols, sodium lauryl sulfate, or mixtures thereof. In the case of capsules, tablets, and pills, the dosage forms may also comprise buffering agents. [00214] Solid compositions of a similar type may also be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethyleneglycols, and the like.
[00215] Solid dosage forms such as, but not limited to, tablets, dragees, capsules, pills, and granules can be prepared with coatings and shells, such as, but not limited to, enteric coatings and others well known in the art. They may contain opacifying agents, and can also be of such composition that they release the active compound or compounds in a certain part of the intestinal tract in a delayed manner. Microencapsulated formulations of an inventive conjugate are also contemplated. [00216] Liquid dosage forms for oral administration include pharmaceutically acceptable emulsions, solutions, suspensions, syrups, and elixirs. In addition to a conjugate according to the present invention, the liquid dosage forms may contain inert diluents commonly used in the art, such as, but not limited to, water or other solvents, solubilizing agents and emulsifiers, as for example, ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl alcohol, benzyl benzoate, propyleneglycol, 1,3-butyleneglycol, dimethylformamide, oils, in particular, cottonseed oil, groundnut oil, corn germ oil, olive oil, castor oil and sesame oil, glycerol, tetrahydrofurfuryl alcohol, polyethyleneglycols and fatty acid esters of sorbitan or mixtures of these substances, and the like. [00217] Besides such inert diluents, a pharmaceutical composition according to the present invention can also include adjuvants, such as, but not limited to, wetting agents, emulsifying and suspending agents, sweetening, flavoring, and perfuming agents.
[00218] Suspensions, in addition to an inventive conjugate, may contain suspending agents, as for example, ethoxylated isostearyl alcohols, polyoxyethylene sorbitol and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, or mixtures of these substances, and the like.
[00219] Further specific details of pharmaceutical formulation can be found in Pharmaceutical Dosage Forms: Tablets, eds. H. A. Lieberman et al., New York: Marcel Dekker, Inc., 1989; L.V. Allen, Jr. et al., Ansel's Pharmaceutical Dosage Forms and Drug Delivery Systems, 8th Ed., Philadelphia, PA, Lippincott, Williams & Wilkins, 2004; and Remington, The Science and Practice of Pharmacy, 21 st ed., Lippincott, Williams & Wilkins, Philadelphia, PA, 2006.
[00220] An inventive conjugate is optionally delivered in conjunction with a non-conjugated therapeutic and/or diagnostic agent in one embodiment. A therapeutic and/or diagnostic agent suitable in this regard illustratively includes an analgesic, an antibiotic, an antibody, an antigen, an anti-inflammatory, an anti-tumoral agent, an antiviral, a gamma or beta radiation emitting species, an enzyme, and a hormone. In addition, two or more conjugate compositions may be administered to a subject.
[00221] The dosage of an inventive pharmaceutical composition will vary based on factors such as, but not limited to, the route of administration; the age, health, and weight of the subject to whom the composition is to be administered; the nature and extent of the subject's symptoms, if any, and the effect desired. Usually a daily dosage of an inventive conjugate is in the range of about 0.001 to 100 milligrams per kilogram of a subject' s body weight. A daily dose may be administered as two or more divided doses to obtain the desired effect. An inventive pharmaceutical composition may also be formulated for sustained release to obtain desired results.
[00222] For example, a parenteral composition suitable for administration by injection includes 1 % by weight of an inventive conjugate in buffered saline. Methods
[00223] A method of delivering a cargo moiety to a cell is provided which includes contacting a cell expressing sialoadhesin with a conjugate according to the present invention. The sialoadhesin binding moiety present in the conjugate binds to the sialoadhesin expressed by the cell and the conjugate is internalized in the cell. The cell may be in vivo, ex vivo or in vitro. [00224] Sialoadhesin is expressed primarily by macrophages. Thus, in one embodiment of an inventive method, a drug delivery system targeting macrophages is provided. Thus, in such an embodiment, a cell contacted with a conjugated sialoadhesin binding moiety and cargo moiety is a macrophage. [00225] A cell contacted with a conjugate composition in a method according to the present invention expresses sialoadhesin naturally or may be induced to do so. In such a method, cells other than macrophages may be targeted.
[00226] For example, a cell may be transfected with an expression construct encoding sialoadhesin such that sialoadhesin is expressed in the cell. An expression construct includes a nucleic acid encoding full-length sialoadhesin, or a portion thereof, operably linked to a regulatory element. Full-length nucleic acids encoding sialoadhesin have been isolated from various species and exemplary nucleic acid sequences and encoded sialoadhesin proteins are described herein. A regulatory element operably linked to the nucleic acid encoding sialoadhesin illustratively includes a promoter, an enhancer, an origin of replication, a polyadenylation signal, and a transcription termination sequence. Expression constructs and methods for their generation are known in the art, as described, for example, in Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, 2001; and Ausubel, F. et al., (Eds.), Short Protocols in Molecular Biology, Wiley, 2002.
[00227] In particular embodiments, an expression construct encoding a sialoadhesin protein encodes a sialoadhesin protein identified herein as SEQ ID No. 5, SEQ ID No. 7, SEQ ID No. 9, or a biologically active homologue thereof. In particular embodiments, an expression construct encoding a sialoadhesin protein includes a nucleotide sequence identified herein as SEQ ID No. 6, SEQ ID No. 6, or SEQ ID No. 10.
[00228] Biological activity of a putative sialoadhesin homologue is readily determined by one of skill in the art, for instance using any of the functional assays described herein or other functional assays known in the art.
[00229] An expression construct encoding sialoadhesin is generated according to methods known in the art. For example, a pcDNA3.1/Sn plasmid containing the porcine sialoadhesin cDNA cloned into the pcDNA3.1 vector (Invitrogen) described in Vanderheijden, N. et al., 2003, J. Virol. 77:8207-15 is a sialoadhesin expression construct.
[00230] A cell transfected with an expression construct to induce or enhance sialoadhesin expression in the cell may be transiently transfected in particular embodiments. Alternatively, a stable cell line expressing sialoadhesin is produced.
[00231] Any of various cells may be used to produce a cell line stably expressing sialoadhesin.
Particular examples include, but are not limited to THP-I cells, PK-15 cells, 3D4/31 cells, and HEK293T cells.
[00232] Methods of producing a stable cell line expressing a desired protein are known in the art, as exemplified in standard molecular biology references such as S. Ozturk and W.-S. Hu (Eds.), Cell Culture
Technology for Pharmaceutical and Cell-Based Therapies, Biotechnology and Bioprocessing Series, CRC
Press, 2005.
[00233] Briefly described, cells are transfected with an expression construct encoding sialoadhesin. For example, cells are transfected with an expression construct including SEQ ID No. 6, SEQ ID No. 6, or SEQ ID No. 10 or another sequence encoding SEQ ID No. 5, SEQ ID No. 7, or SEQ ID No. 9 or a homologue thereof. A transfected expression construct further encodes resistance to a selection agent, including, but not limited to, resistance to neomycin (G418). Expression constructs conferring resistance to a selection agent are known in the art and are commercially available or may be constructed using standard molecular biology techniques. [00234] Cells are transfected according to standard transfection methods illustratively including, but not limited to, calcium phosphate techniques and lipofectin techniques such as described in Sambrook et al.,
Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, 2001 ; and Ausubel, F. et al., (Eds.), Short Protocols in Molecular Biology, Wiley, 2002.
[00235] Following transfection, cells are incubated, on cell culture plates or in cell culture wells for instance, in medium containing a selection agent, such as 0.5 g/L neomycin. Cells not transfected or not
expressing the resistance marker die following incubation with the selection agent, generally after several days. Dead cells are removed from the vicinity of living transfected cells in order to select for particular clones. Transfected cells are typically disposed individually, in wells or in cloning cylinders for example, in order to select one or more stably transfected cell lines. Once individual colonies have grown, they can be assayed for sialoadhesin expression, such as by ELISA. Stably transfected cells are further assayed for binding of a sialoadhesin binding moiety and/or conjugate and uptake of the binding moiety and/or conjugate into the cell.
[00236] Stably transfected cells may be used in methods of the present invention. For example, a stable cell line expressing sialoadhesin is used in a method of the present invention for transfection of a cell by delivery of a conjugate including a sialoadhesin binding moiety and a nucleic acid.
[00237] In further embodiments of methods according to the present invention a cell is treated with an agent effective to induce or enhance expression of sialoadhesin in the cell. In particular embodiments of methods according to the present invention a cell is treated with a cytokine effective to induce or enhance expression of sialoadhesin in the cell. For example, a cell treated with a cytokine effective to induce or enhance expression of sialoadhesin is a monocyte, a monocyte cell line, a macrophage and a macrophage cell line.
[00238] In particular embodiments, a human cell and /or a human-derived cell line is treated with a cytokine effective to induce or enhance expression of sialoadhesin. An example of a human-derived cell line is human monocyte cell line THP-I . A suitable cytokine effective to induce or enhance expression of sialoadhesin is interferon-alpha (INF-alpha).
[00239] Human monocytes are treated with INF-alpha to induce or enhance expression of sialoadhesin in a particular embodiment. The monocytes may be isolated, for instance from blood, and treated in vitro with INF-alpha. Sialoadhesin expression may be assessed by assays illustratively including, but not limited to, immunoassay. [00240] In further embodiments, an effective amount of INF-alpha is administered to a subject such that sialoadhesin expression is induced or enhanced in cells in vivo. An effective amount is illustratively between 10 to 500 units IFN-alpha per ml of blood of the subject.
[00241] Methods are provided for transfection of a cell using a conjugate according to the present invention including a cargo nucleic acid, particularly a cargo expression construct. Cells expressing sialoadhesin are contacted with a conjugate including a sialoadhesin binding moiety and a cargo expression construct in a particular embodiment in order to express an encoded protein or peptide in the cells. Transfection using a sialoadhesin binding moiety and a cargo expression construct is used in sialoadhesin expressing cells in vitro or in vivo. Transfection using a conjugate provided by the present invention is useful to increase the level of a desired protein or peptide in a cell, for instance, to produce recombinantly expressed protein, for instance, to study function of the protein.
[00242] A method according to the present invention which includes contacting a cell expressing sialoadhesin with a conjugate composition may be used to stimulate an immune response in a subject, for instance to vaccinate the subject.
[00243] Vaccination is one of the earliest used and most powerful tools for stimulating an organism to defend against infection. Broadly described, vaccination is a method of administering an antigen to an organism in order to stimulate the organism's immune system to provide a cellular and/or molecular defensive response.
[00244] While vaccination by non-cell targeted administration of an antigen to an organism can be effective, in some cases large amounts of antigen must be administered in order to achieve a desired response. Further, a non-cell targeted administration may require a longer time and/or more booster administrations of the antigen to achieve an effective immune response. Thus, compositions and methods for stimulating an immune response in a subject are needed. Such a method is provided according to the present invention and includes administering to a subject an effective amount of a conjugate composition according to the present invention which includes a sialoadhesin binding moiety conjugated to an antigen. An immune response may be stimulated in order to inhibit infection by a pathogen, or to stimulate an antitumoral response for instance.
[00245] An immune response may be measured, for instance, by assay of the subject's serum for antibodies to an antigen administered as part of an inventive conjugate. Applicable immunoassays include ELISA performed on a sample before and at one or more times following administration of the conjugate, for example.
[00246] In one embodiment, administration of a composition effective to target an antigen to an antigen presenting cell, particularly a macrophage, is included in a method provided according to the present invention.
[00247] In a specific example, vaccination of swine against Porcine Reproductive and Respiratory Syndrome (PRRS) virus is an embodiment of a method according to the present invention. PRRS virus is an infectious disease of swine which can cause severe respiratory disorders, as well as abortion. The viral agent has been identified, as described in Weensvoort, G., et al., 1991, Veterinary Review. 13: 121-130. However, there is currently no effective treatment for this disease which can frequently only be controlled by destruction of the herd, resulting in considerable cost to swine producers. [00248] A vaccine and method for vaccination of a pig against PRRS virus is provided. A conjugate composition including a sialoadhesin binding moiety which binds to porcine sialoadhesin is conjugated to a PRRS virus, a PRRS protein, or an antigenic portion of a PRRS virus or protein. The conjugate composition is administered to a pig in an amount effective to stimulate an immune response. The route of administration may be any convenient route, illustratively including, but not limited to, intravenous, intramuscular, intraperitoneal, subcutaneous, oral, mucosal, and any combination thereof.
[00249] In a further example, vaccination of a subject against an influenza virus is an embodiment of a method according to the present invention. Influenza virus is an infectious disease of numerous species which can cause severe respiratory symptoms and death.
[00250] A vaccine and method for vaccination of a subject against influenza virus is provided. A conjugate composition including a sialoadhesin binding moiety which binds to sialoadhesin is conjugated to an influenza virus, an influenza virus protein or an antigenic portion of an influenza virus or protein. In particular embodiments, compositions and methods for vaccination of a subject against a type A influenza virus are provided. The conjugate composition is administered to a subject in an amount effective to stimulate an immune response against influenza virus. The route of administration may be any convenient route, illustratively including, but not limited to, intravenous, intramuscular, intraperitoneal, subcutaneous, oral, mucosal, and any combination thereof.
[00251] In specific embodiments, compositions and methods for vaccination of a porcine subject against an influenza virus are provided. Inventive methods and compositions for vaccination against influenza virus are not limited to porcine subjects and may be used in other subjects susceptible to influenza virus infection, illustratively including, but not limited to, humans and birds.
[00252] A conjugate composition for vaccination of a subject against an influenza virus includes a sialoadhesin binding moiety and an influenza virus hemagglutinin protein or antigenic portion thereof in particular embodiments. In a specific example, a conjugate composition for vaccination of a subject against an influenza virus includes the protein encoded by SEQ ID No. 3 or a homologue thereof. In a further specific example, a conjugate composition for vaccination of a subject against an influenza virus includes the protein identified as SEQ ID No. 4 or a homologue thereof.
[00253] Traditionally, achieving desired antibody titers can be difficult with some antigens, such as inactivated or subunit vaccines, requiring multiple administrations of the antigen. Targeted delivery of an antigen to sialoadhesin expressing macrophages using an inventive composition including antigen coupled to a sialoadhesin-specific mAb allows increased titers of antigen-specific antibodies. Targeted delivery elicits an immune response which is more efficient in comparison to administration of an unconjugated antigen, since antibodies appear earlier after administration and higher titers are reached. [00254] Thus, in one embodiment, a method for stimulating the immune system of a subject includes a single administration of a conjugate composition having an antigen cargo moiety according to the invention. Additional administrations of such a conjugate may be performed in alternative embodiment of the present invention.
[00255] The term "subject" refers to a vertebrate to which an inventive conjugate is to be administered. A subject is preferably a mammal, and more preferably a human in particular embodiments. In further embodiments, a preferred subject is porcine. However, the term subject is not limited to either human or porcine subjects and methods and compositions of the present invention may be used in conjunction with
any of various animals illustratively including cows, horses, chickens and other poultry, goats, rodents, cats, dogs and birds.
[00256] An effective amount is an amount sufficient to achieve an intended beneficial or desired result. In general, an effective amount is in the range of about 0.001 to 100 milligrams per kilogram of a subject's body weight.
[00257] In a further embodiment of a method according to the present invention, a cell expressing sialoadhesin is targeted in order to eliminate or inhibit the cell. For example, elimination or inhibition of sialoadhesin expressing macrophages is desirable in certain disease states, such as, but not limited to, rheumatoid arthritis. Rheumatoid arthritis is characterized by presence of activated synovial macrophages which induce development of synovitis and joint destruction.
[00258] Another embodiment of a method according to the present invention relates to delivery of a therapeutic agent to inhibit pathogenic infection. Thus, one embodiment of an inventive method includes targeted delivery to macrophages of a conjugate composition according to the present invention including an antimicrobial drug cargo moiety. Such targeted delivery allows the use of antimicrobial drugs that have undesirable side effects when a non-targeted delivery system is used, such as systemic administration of free antimicrobial drug.
[00259] Embodiments of inventive compositions and methods are illustrated in the following examples. These examples are provided for illustrative purposes and are not considered limitations on the scope of inventive compositions and methods.
EXAMPLES Example 1
[00260] An assay for assessment of binding of a sialoadhesin binding moiety to sialoadhesin is described in this example along with an assay for assessing uptake of the bound sialoadhesin binding moiety into a cell.
[00261] In this example, primary porcine alveolar macrophages, cells which express sialoadhesin, are used to assess binding and/or uptake of a sialoadhesin binding moiety.
[00262] Porcine alveolar macrophages are isolated from 4- to 6-week old conventional Belgian Landrace pigs from a PRRSV negative herd as described in Wensvoort, G., C. et al., 1991, Vet Q 13:121- 30. Briefly, the main bronchus of each lung half was clamped and a needle was inserted distally. Cold PBS (3 x 20 ml) was injected, followed by massage of the lung tissue and aspiration. About 75% of the BAL fluid could be aspirated and was kept on ice. BAL cells were separated from fluids by centrifugation and cells were used in the experiments. Staining with mAb 41D3 showed that this procedure routinely resulted in a purity of more than 95% of sialoadhesin expressing macrophages. [00263] The cells are cultivated in Earle' s MEM, supplemented with 10% fetal bovine serum (FBS), 2
mM L-glutamine (BDH Chemicals Ltd.), 1% non-essential amino acids (Gibco BRL), 1 mM sodium pyruvate and antibiotics in a humidified 5% CO2 atmosphere at 37°C. Macrophages are preferably cultivated for 24 hours before use.
[00264] Control cells, such as non-sialoadhesin-expressing cells, may be used to assess specificity of binding and uptake. Such cells include, for example, HEK293T cells, a human embryonic kidney cell line transfected with SV40 large T-Ag (SV40TtsA1609) described in DuBridge, R. B. et al, 1987, MoI Cell Biol 7:379-8. HEK293T cells are maintained in DMEM supplemented with 10% FBS, 2 mM L-glutamine and a mixture of antibiotics. [00265] Antibodies used in this example include Mab 41D3 directed against sialoadhesin. Control antibodies include isotype matched (IgGl) mAb 13D12, directed against PRV glycoprotein gD described further in Nauwynck, H. J., and M. B. Pensaert, 1995, Arch Virol 140:1137-46; and mAb 74-22-15, reactive with S WC3, a membrane/surface protein used as a marker of porcine monocytes, macrophages and neutrophils described in Pescovitz, M. D. et al., 1984, J Immunol 133:368-75. [00266] Antibodies are purified using protein G sepharose column chromatography (Amersham Biosciences), dialyzed to PBS and stored at 4°C or -70 0 C prior to use.
[00267] In an assay to assess characteristics of a sialoadhesin binding moiety, cells are incubated with a sialoadhesin binding moiety under various conditions and at various concentrations. In this example, primary macrophages are incubated with purified antibodies at a concentration of 25 micrograms/milliliter for 1 hour at 4°C to allow only attachment, but no internalization. Cells are then washed to remove unbound antibody and shifted to 37°C to start endocytosis. After different times, cells are fixed with 3% paraformaldehyde (PF), permeabilized with 0.1 % Triton X-100, and stained with FITC -labelled goat-anti- mouse IgG to visualize antibodies bound to and internalized in the cells. As a control, cells are fixed after the 4°C incubation (time 0). The number of vesicles internalized in the macrophages and control cells incubated under various conditions may be counted using an appropriate technique, such as confocal microscopy.
[00268] Confocal analysis is performed using a scanning spectral confocal system, such as a Leica TCS SP2 laser linked to a Leica DM IRBE inverted microscope, from Leica Microsystems GmbH. Image acquisition is performed using a Leica TCS SP2 confocal software package and overlay images are produced with Adobe Photoshop CS. [00269] In a particular example, macrophages are incubated for 60 min at 4 0 C with the sialoadhesin - specific mAb 41D3 to allow antibody binding, but no internalization. Cells are then washed to remove unbound antibody, and shifted to 37 0 C to allow internalization. Cells are fixed and stained at different times for analysis of binding and uptake into cells. [00270] Figure 1 shows that incubation of primary porcine macrophages with mAb 41D3 induces sialoadhesin and antibody internalization. Figure 1 is a graph illustrating specific binding and
internalization of a sialoadhesin binding moiety at different times after incubation of macrophages at 37 0 C with mAb 41D3. Kinetics of uptake are demonstrated by the percentage of cells with internalized sialoadhesin at different times after incubation of macrophages at 37°C with mAb 41D3. Data in Figure 1 represent the means ± standard deviations of 3 independent experiments. At time 0, a clear membrane staining is observed, and none of the macrophages contain sialoadhesin positive vesicles in the cytoplasm, as indicated by the point at the origin of the graph.
[00271] With increasing time at 37°C, the number of cells which internalized sialoadhesin and antibody increases to a maximum of 90 % at 90 min after the 37°C shift (Figure 1), and then declines to 61% at 120 min and 50% at 180 min. At early time points, endocytic vesicles are mainly present in the vicinity of the plasma membrane, while with increasing time, endocytosed sialoadhesin is mainly localized to the perinuclear region. As a control, primary porcine macrophages are incubated with a non-sialoadhesin binding antibody, isotype matched mAb 13D12, or mAb 74-22-15. Cells incubated with mAb 13D12 show no staining (data not shown), while mAb 74-22-15 incubated cells show exclusive plasma membrane staining at all timepoints examined. Further, when mAb 41D3 is added to macrophages directly at 37 0 C, this results in similar internalization kinetics. Example 2
[00272] Various cells may be used in an assay to assess uptake and/or internalization of a sialoadhesin binding moiety. A cell line expressing sialoadhesin may be used for assay of binding and/or uptake of a sialoadhesin binding moiety. [00273] A porcine cell line, PK- 15 , may be used in an assay to assess uptake and/or internalization of a sialoadhesin binding moiety. PK-15cells are maintained as described by Vanderheijden, N. et al., 2003, J. Virol. 77:8207-15. About 25% of PK- 15 cells usually express sialoadhesin. PK- 15 cells are optionally transfected with a sialoadhesin expression construct to enhance expression of sialoadhesin in the cells for use in an assay to assess uptake and/or internalization of a sialoadhesin binding moiety. [00274] The porcine alveolar macrophage cell line 3D4/31 (37) is maintained in RPMI/MEM (50/50) supplemented with 10% FBS, 2 mM L-glutamine, 1% non-essential amino acids (Gibco) and a mixture of antibiotics. About 5% of 3D4/31 cells usually express sialoadhesin. 3D4/31 are optionally transfected with a sialoadhesin expression construct to enhance expression of sialoadhesin in the cells for use in an assay to assess uptake and/or internalization of a sialoadhesin binding moiety. [00275] HEK293T cells are transfected using calcium phosphate (Cellphect transfection kit, Amersham Biosciences), and PK- 15 and 3D4 cells are transfected using Lipofectamine Plus (Invitrogen), following the manufacturers instructions. Cells are used for experiments 24 hours after transfection. Example 3 [00276] A primary cell or cell line characterized by little or no expression of sialoadhesin may be treated to express sialoadhesin and/or to enhance sialoadhesin expression. In particular embodiments, a cell is transfected with a sialoadhesin expression construct in order to provide a cell used in an assay for
assessment of binding and/or uptake of a sialoadhesin binding moiety. An expression construct including a nucleotide sequence encoding pig, mouse or human sialoadhesin detailed herein is optionally used. A pcDNA3.1/Sn plasmid containing the porcine sialoadhesin cDNA cloned into the pcDNA3.1 vector (Invitrogen) is described in Vanderheijden, N. et al, 2003, J. Virol. 77:8207-15. Example 4
[00277] In further particular embodiments, a cell is treated with a stimulator of sialoadhesin expression in order to provide a cell used in an assay for assessment of binding and/or uptake of a sialoadhesin binding moiety. Stimulators of sialoadhesin expression include interferon-alpha. In this example, human peripheral blood mononuclear cells (PBMC) are isolated from heparinized blood from a healthy donor via centrifugation on Ficoll-paque according to the manufacturer's instructions (Amersham Biosciences). Monocytes are semi-purified by plastic adhesion and several washing steps to remove non-adherent lymphocytes. Flow cytometric analysis with a mouse-anti-human CD14 antibody shows that this procedure routinely results in a purity of the monocytes of > 90%. Cells are cultivated for 3 days in RPMI medium with 10% FBS (RPMI-FBS) or RPMI-FBS with interferon-gamma, 500 U/ml and Tumor Necrosis Factor- alpha (TNF-alpha), 10 ng/ml, as described in Hartnell, A., et al., Blood, 2001.97(1): p.288-96, or in RPMI- FBS supplemented with interferon-alpha (100 U/ml).
[00278] Cells are lifted from a plastic substrate to which they have adhered by incubation with ice-cold PBS for 30min at 4°C. Cells are first incubated at 4°C with a mouse anti-human-sialoadhesin specific antibody, 7D2, or a isotype-matched irrelevant control antibody, 13D12. Next, cells are fixed with paraformaldehyde (3% in PBS) or incubated at 37°C for lhr for the internalization of the bound antibodies followed by paraformaldehyde fixation. Cells are washed 3 times and subsequently incubated with FITC- labeled goat-anti-mouse Ab (Molecular Probes). Some of the cells are double stained with APC-labeled mouse-anti-human CD14 (BD Pharmingen). Finally, the cells are washed 2 times, resuspended in PBS and analyzed with a Becton-Dickinson (San Jose, California) FACScalibur. Ten thousand cells are analyzed for each sample, and four parameters are stored for further analysis: forward light scatter, sideward light scatter, green and red fluorescence, and results of this analysis are shown in Figure 5. [00279] Flow cytometric analysis of sialoadhesin expression yields data representative of three experiments. The control sample (shown at I in Figure 5) is treated as the others during staining but without antibodies. Untreated and cytokine treated cells are stained with a control antibody 13Dl 2 and with a human sialoadhesin-specific antibody 7D2, shown at II in Figure 5. After the binding of 7D2, one sample was incubated for lhr at 37 0 C to enable the receptor, sialoadhesin, to internalize the antibodies, shown at III in Figure 5. IFN-alpha treatment clearly induces Sn expression and the induced Sn is able to internalize monoclonal antibody 7D2. Internalization of monoclonal antibody 7D2 is demonstrated by the reduction in the median fluorescence intensity upon surface staining of interferon-alpha treated cells incubated at 37°C with FITC labeled goat-anti-mouse IgG (Molecular Probes, Invitrogen), as shown in Figure 5.
[00280] In 2 of the 3 experiments using human monocytes, low levels of sialoadhesin is present on the
untreated cells, in the third experiment it is absent. Treatment of the cells with TNF-alpha and IFN-gamma induces Sn expression, however treatment with IFN-alpha leads to a significantly higher expression of sialoadhesin. Similar results are obtained using monocytes isolated from peripheral blood from pigs and treated with IFN-alpha to induce Sn expression. [00281] Sialoadhesin induced by IFN-alpha treatment is biologically active as shown by sialic acid binding capacity of IFN-alpha treated monocytes. Red blood cells contain sialic acids on their surface which allows them to bind to monocytes if these have functional expression of sialoadhesin. Monocytes are grown in 96-well plates for 3 days as described above. Next, they are incubated for 30min at 37 0 C with normal medium or medium supplemented with neuraminidase (Roche) 30U/ml to remove sialic acids present on the surface. After removal of the neuraminidase, monocytes are incubated for lhr at room temperature with a 0.1 % solution of human erythrocytes. Excess erythrocytes are washed away and binding of red blood cells to sialoadhesin is visualized via light microscopy. When sialic acids present on the surface of the monocytes are not removed, red blood cells are unable to bind to the monocytes under any conditions tested. However when sialic acids are removed from monocytes, red blood cells are able to bind in some conditions. Little binding is observed in cells grown in normal medium. Cells treated with TNF- alpha and IFN-gamma do not bind RBC. However, in the IFN-alpha treated cells clear formation of rosettes, that is, red blood cells bound to monocytes are observed. These data confirm the results obtained in the flowcytometric analysis showing that biologically active sialoadhesin is induced in monocytes by IFN-alpha treatment. [00282] The ability of cytokine-induced sialoadhesin expression on human monocytes to internalize a sialoadhesin binding moiety is also shown in this example. Human monocytes are isolated as described above and treated with IFN-alpha for 3 days to induce human sialoadhesin. Cells are then incubated with human sialoadhesin-specific mAb 7D2 for 60 min at 37 0 C to allow binding and internalization. As a control, the cells are incubated with mAb 7D2 at 4°C. At 4°C, cells are no longer capable of mediating internalization, thus this control should only binding of the sialoadhesin binding moiety mAb 7D2. After 60 min, the cells are fixed with 3% paraformaldehyde in PBS and permeabilized by incubation with 0.1 % Triton X-100 in PBS for 2 min. MAb 7D2 is visualized by incubation with FITC-labelled goat-anti-mouse (Invitrogen). Cortical actin is also visualized, using TexasRed labelled Phalloidin, to allow discrimination of surface bound and internalized sialoadhesin. Surface expression of sialoadhesin and binding of sialoadhesin binding moiety mAb 7D2 is observed at time 0. Following incubation for 60 minutes at 37°C, internalized sialoadhesin and sialoadhesin binding moiety mAb 7D2 is observed in the IFN-alpha treated human monocytes.
[00283] Thus, an in vitro system for evaluation of human sialoadhesin binding moieties and conjugates of human sialoadhesin binding moieties is provided which is analogous to the in vitro and in vivo pig system for evaluation of sialoadhesin binding moieties and conjugates of sialoadhesin binding moieties. Example 5
[00284] The effect of interferon-alpha on sialoadhesin expression in human THP-I cells, a monocytic continuous cell line, is tested to determine if sialoadhesin is internalized in these cells upon stimulation with an antibody as a sialoadhesin binding moiety. THP-I cells are deposited with the American Type Culture Collection (ATCC) and are identified by ATCC Number TIB-202. THP-I cells are cultivated for 3 days in RPMI medium with 10% FBS (RPMI-FBS) or RPMI-FBS with interferon-gamma (500 U/ml) and TNF-alpha (10 ng/ml) or in RPMI-FBS supplemented with interferon-alpha (100 U/ml). [00285] THP-I cells are incubated at 4°C with a human-sialoadhesin specific antibody, 7D2, or an isotype-matched irrelevant control antibody, 13D12. Next, cells are fixed with paraformaldehyde (3% in PBS) or incubated at 37°C for 1 hour to allow antibody induced internalization of sialoadhesin and the bound antibody followed by paraformaldehyde fixation and permeabilization of the cells with 0.1% Triton X-100. Cells are washed 3 times and subsequently incubated with FITC-labeled goat-anti-mouse Ab (Molecular Probes). Some of the cells are double stained with APC-labeled mouse-anti-human CD14 (BD Pharmingen). The cells are washed 2 times, resuspended in PBS and analyzed with a Becton-Dickinson (San Jose, California) FACScalibur. Ten thousand cells are analyzed for each sample, and four parameters were stored for further analysis: forward light scatter, sideward light scatter, green and red fluorescence (Fig. 10). These data show that IFN-alpha treatment induces human sialoadhesin on THP-I cells, and that upon stimulation with mAb 7D2 at 37 0 C, a decrease in cell surface sialoadhesin fluorescence is observed, indicative of internalization of the antibody bound to sialoadhesin. [00286] Figure 10 shows flow cytometric analysis of sialoadhesin expression and antibody induced sialoadhesin internalization. Histograms are representative for three experiments. The control sample (I) is treated as the others during staining but without antibodies. Untreated and cytokine treated cells are stained with a control antibody 13D 12 and with a human sialoadhesin-specific antibody 7D2 (II). After the binding of 7D2, one sample was incubated for lhr at 37 0 C to enable the receptor to internalize the antibodies (III). IFN-alpha treatment clearly induces sialoadhesin expression and the induced sialoadhesin is able to internalize monoclonal antibody 7D2 as shown by the decreased median which lowers from 364 to 258 upon incubation at 37 0 C.
[00287] Confocal microscopy is used in this example to visualize internalization of sialoadhesin and bound sialoadhesin binding moiety mAb 7D2. THP-I cells are incubated with human sialoadhesin - specific mAb 7D2 for 60 min at 37 0 C to allow internalization. As a control, a time 0 was analyzed by incubating the cells with mAb 7D2 at 4°C. At 4°C, cells are no longer capable of mediating internalization, thus this control should only show binding to sialoadhesin at the cell surface without internalization. After 60 min, the cells are fixed with 3% paraformaldehyde in PBS and permeabilized by incubation with 0.1 % Triton X-100 in PBS for 2 min. Internalized antibodies are visualized by incubation and staining with FITC-labelled goat-anti-mouse (Invitrogen). Surface labeling of these cells is observed at time 0, while at time 60, sialoadhesin and bound antibody is observed internalized in the THP-I cells.
[00288] Thus, an in vitro system is provided including the human monocytic THP- 1 cell line, allowing
further analysis of antibody-induced human sialoadhesin internalization without the need of isolating primary blood monocytes or macrophages. Example 6
[00289] Chemical cross-linking of a sialoadhesin binding moiety and a cargo moiety is described. In this example, human serum albumin (HSA) is a cargo moiety which is an antigen to be conjugated to mAb 41D3, a sialoadhesin binding moiety, to form an inventive conjugate composition. In addition, as a control, human serum albumin (HSA) is conjugated to a non-sialoadhesin binding antibody, mAb 13D12. [00290] For chemical cross-linking of HSA and the mAb in this example, a two step cross-linking protocol is used. The amine reactive cross-linker LC-SMCC (Pierce) is coupled to the purified mAb 41D3 by incubating 600 micrograms of LC-SMCC with 20 milligrams of mAb in 8 milliliters phosphate buffered saline (PBS) for 30 minutes at room temperature. The amine-reactive cross-linker SPDP (Pierce) is coupled to the purified HSA by incubating 2 milligrams SPDP with 40 milligrams HSA in 8 milliliters PBS, for 30 minutes at 37°C. The SPDP-HSA is then activated by addition of 125 micrograms DTT, which results in the formation of a thiol activated protein. Both the mAb-LC-SMCC and the thiol activated HSA are then dialyzed to PBS at 4°C using a membrane with a 10-14 kDa cutoff to remove residual unreacted LC-SMMC, SPDP and DTT. The mAb-LC-SMCC and the thiol activated HSA are then mixed together and incubated at 37°C for 30 minutes to allow the thiol group on HSA to react with the maleimide end of the LC-SMCC on the mAb, resulting in the formation of a covalent thio-ether bond. After the coupling reaction, the mixture is dialyzed again towards PBS using a membrane with a 100 kDa cut off, to remove any unreacted HSA from the mixture.
[00291] A similar reaction is performed to generate a control conjugate including human serum albumin (HSA) conjugated to a non-sialoadhesin binding antibody, mAb 13D12.
[00292] Samples taken in between different steps of the cross-linking protocol may be analyzed to confirm formation of a conjugate. For example, such samples may be separated by SDS-PAGE on a 7% gel and proteins stained with a reagent such as Coomassie blue in order to visualize the reactants and reaction products. Example 7
[00293] Internalization of a conjugate composition including a sialoadhesin binding moiety and a cargo moiety is demonstrated in primary macrophages. In this example, the HSA-mAb 41D3 conjugate and HSA-mAb 13D12 conjugate are incubated for 1 hour at 37°C with sialoadhesin expressing primary porcine macrophages. Cells in separate culture dishes are incubated for 1 hour at 37°C with mAb 41D3, mAb 13D12 or with HSA alone. Cells are then washed, fixed by incubating with 3% paraformaldehyde for 10 minutes and permeabilized by incubating with 0.1% Triton X-100 for 2 minutes. [00294] HSA is detected in these preparations by incubating the cells with a HS A-specific biotinylated polyclonal pig serum, followed by incubation with FITC-labeled streptavidin FITC (Molecular Probes). The monoclonal antibodies are detected with TxRed-labeled goat-anti-mouse Ig (Molecular Probes). The
cells are then analyzed using an appropriate technique, such as confocal microscopy. [00295] Confocal analysis is performed using a scanning spectral confocal system, such as a Leica TCS SP2 laser linked to a Leica DM IRBE inverted microscope, from Leica Microsystems GmbH. Image acquisition is performed using a Leica TCS SP2 confocal software package and overlay images are produced with Adobe Photoshop CS.
[00296] Analysis demonstrates mAb 41D3 internalization both when it is coupled to HSA or not, indicating that the coupling reaction had no effect on the ability of mAb 41D3 to bind to sialoadhesin and to induce internalization. Internalization of free HSA is either absent, or at very low levels when it is added to macrophages not coupled to mAb 41D3, but a clear internalization of HSA is observed when it is coupled to mAb 41D3. Further, internalized HSA co-localizes with mAb 41D3 in confocal images of cells treated with the HSA-mAb 41D3 conjugate. Coupling HSA to mAb 41D3 results thus in co-internalization of HSA with mAb 41D3 via the sialoadhesin receptor.
[00297] Thus, contact of an inventive conjugate including HSA coupled to the sialoadhesin-specific mAb 41D3 with primary, sialoadhesin expressing macrophages, results in sialoadhesin-dependent uptake of HSA into macrophages, while addition of non-coupled HSA to macrophages did not result in efficient HSA uptake. Example 8
[00298] Immunization is performed using conjugate compositions according to the present invention in this example. Six week old conventional pigs are purchased from a porcine arterivirus negative farm and housed in isolation units with HEPA filtered air following the recommendations of the ethical committee of the Faculty of Veterinary Medicine, Ghent University. Six pigs are immunized with one milligram of an inventive conjugate having HSA coupled to the sialoadhesin-specific mAb 41D3. Three pigs are immunized with one milligram of a control conjugate having HSA coupled to the control mAb 13D12. Each immunization includes administration of the conjugate in 3 milliliters PBS, of which 1.5 milliliters is administered intravenously and 1.5 milliliters is administered intramuscularly. As a control, six pigs are immunized with one milligram unconjugated HSA.
[00299] Blood samples are collected before immunization and at days 10, 17, 24, 32 and 38 after immunization. Three months later, blood is sampled again and the pigs are boostered with one milligram HSA by intramuscular injection. [00300] Serum obtained from immunized pigs is analyzed for the presence of HSA-specific IgM and IgG antibodies by ELISA. The HSA-specific IgM, and IgG antibody titers are determined with an indirect ELISA as described in Van der Stede, Y., E. et al, 2001, Vaccine 19:1870-8; and Verdonck, F. et al, 2005, J Control Release 104:243-58. Briefly, the wells of a 96-well Polysorb Immuno microtiter plate (NUNC) are coated with HSA at a concentration of 30 micrograms/milliliter in PBS for 2 hours at 37 0 C. The plates are then washed and the remaining binding sites are blocked overnight at 4 0 C with PBS supplemented with 0.2% Tween®80. Two-fold serial dilutions of the serum samples (starting from 1/10) in
ELISA dilution buffer (PBS+0.05% Tween®20) are added to the plate, followed by the swine-specific IgM, or IgG MAb, such as described in Van Zaane, D., and M. M. Hulst, 1987, Vet Immunol Immunopathol 16:23-36, and peroxidase-conjugated rabbit-anti-mouse polyclonal antibodies (Dako) supplemented with 2% pig serum. ABTS and H 2 O 2 are used as chromogen and substrate and the optical density is spectrophotometrically measured at 405 nm (OD405). The cut-off values are calculated as the mean OD 405 -value of all sera (dilution 1/10) at day 0, increased with 3 times the standard deviation. The antibody titer is the inverse of the highest dilution that still had an OD 405 higher than the calculated cut-off value. [00301] Figure 2 shows means of HSA specific IgM (Fig.2A) and IgG (Fig. 2B) serum titers (±SEM) after primary immunization. Figure 2C shows means of HSA specific IgG serum titers after booster immunization. Square symbols indicate pigs immunized with HSA coupled to Sn-specific mAb 41D3; triangle symbols indicate pigs immunized with HSA coupled to irrelevant control mAb; and circle symbols indicate pigs immunized with free HSA. [00302] After primary immunization, low to undetectable titers of IgM antibodies are detected in the pigs immunized with HSA alone, or with HSA coupled to the control mAb 13D12. In contrast, IgM antibodies are present starting from 10 days post immunization (dpi) in the pigs immunized with HSA coupled to the sialoadhesin-specific mAb 41D3. These antibodies remained at a nearly constant level until 17 dpi, and started to decline from 24 dpi as illustrated in Figure 2 A. [00303] Similarly, HSA-specific IgG antibodies are undetectable in pigs immunized with HSA alone until 24 dpi, and low titers are detected from 32 dpi. In pigs immunized with HSA coupled to the control mAb 13D12, low titers of HSA-specific IgG antibodies could be detected from 10 dpi which reached maximum titers at 32 dpi. Cross-linking of HSA and a non-sialoadhesin binding antibody stimulates some HSA-specific IgG antibody response. In contrast, pigs immunized with HSA coupled to the sialoadhesin- specific mAb developed high titers of IgG antibodies already starting at 10 dpi. Maximum antibody titers are detected at 17 dpi and these remained constant until 38 dpi as illustrated in Figure 2B.
[00304] To investigate if immunization with HSA coupled to the sialoadhesin-specific mAb 41D3 had an effect on the induction of HSA-specific memory cells, all animals are boosted 3 months after primary immunization with HSA alone. At the time of the booster immunization and at 4 dpi, all animals had low to undetectable HSA-specific IgG titers. Starting from 7 dpi, an IgG antibody response is detected in all animals, but the highest titers are detected in the animals which received HSA coupled to the sialoadhesin- specific mAb 41D3 as the primary immunization as is shown in Figure 2C.
[00305] Pigs immunized with the HS A-mAb41 D3 constructs showed the highest IgG and IgM antibody titers throughout the study, which indicates that coupling HSA to the sialoadhesin-specific mAb greatly enhances both the speed of induction and the titers of HSA-specific IgG and IgM antibodies. [00306] Thus, targeted delivery of an immunogen to macrophages is possible by coupling the immunogen to the sialoadhesin-specific mAb, and this affects the humoral immune response, enhancing
both the speed of induction and the titers of antigen-specific antibodies. Example 9
[00307] Sialoadhesin binding moiety/viral protein conjugate, administration and immune response. In this example, influenza virus haemagglutinin (HA) is conjugated to sialoadhesin binding moiety monoclonal antibody (mAb) 41D3. Influenza virus haemagglutinin conjugated to sialoadhesin binding moiety monoclonal antibody 41D3 is either the native protein purified from virus or a recombinant form produced in eukaryotic cells. Haemagglutinin conjugated to sialoadhesin binding moiety monoclonal antibody 41D3 is chemically cross-linked with mAb 41D3 in this example and injected in pigs to demonstrate and evaluate the capacity of the conjugates to induce HA-specific antibodies. Purification of native haemagglutinin
[00308] In order to obtain native haemagglutinin, a split HlNl component is prepared essentially as described by Van Reeth, K., S. et al, Vet Rec, 2003. 153(1): p. 9-13. Ten-day-old embryonated SPF chicken eggs are inoculated with the HlNl swine influenza strain A/swine/Belgium/1/98. Allantoic fluid is collected 72h post inoculation and red blood cells and cell debris are removed via centrifugation. The clarified allantoic fluid is then centrifuged to pellet the virus, 70,00Og at 4°C for 90min. Virus pellets are resuspended overnight at 4°C in TSE buffer, 1OmM Tris-HCl pH7.4, 10OmM NaCl and ImM EDTA. Presence of influenza virus is confirmed with a haemagglutination (HA) test such as described by Van Reeth, K., S. et al., Vet Rec, 2003. 153(1): p. 9-13 followed by concentration and purification via ultracentrifugation on a linear 20 to 60% (w/v) sucrose gradient, 130,000g at 4°C for 14hrs. Gradient fractions containing virus are identified with an HA test, pooled, dialysed in a slide-a-lyzer dialysis cassette, 10,000 MWCO, against phosphate buffered saline (PBS) to remove sucrose and concentrated by dialysis in a 20% polyethylene glycol (PEG-20,000) solution. Finally, the haemagglutinin is released from the purified and concentrated virus by centrifugation on a linear denaturing 20 to 60% (w/v) sucrose gradient consisting of 0.1% Tween 80 and 1.2% sodium deoxycholate in TSE buffer, 130,000g at 4°C for 14hrs. Fractions containing haemagglutinin are identified with an HA test, pooled, dialysed in a slide-a- lyzer cassette (10,000 MWCO) against PBS and concentrated by dialysis in a 20% PEG solution. Residual infectious virus is inactivated by UV treatment of the solution (5 J/cm 2 ). Complete inactivation is confirmed by inoculation on MDCK cells and two blind passages in 10-day old embryonated SPF chicken eggs. [00309] The purification process is analysed via SDS-PAGE followed by western blotting and coomassie blue staining. HA is clearly present in the original allantoic fluid, but also in the purified solution after the denaturing sucrose gradient. HA can be detected as a monomer and as two different multimers, most likely a dimer and a trimer during all steps of the purification process. Figure 6A shows SDS-PAGE analysis of the presence and purity of native influenzavirus haemagglutinin in different fractions obtained during purification includes detection of HA via western blotting using a monoclonal antibody directed against HA of the HlNl virus. Figure 6B shows detection of all proteins in the samples
is accomplished via coomassie blue staining. In both Figures 6A and 6 B: Lane A: marker, lane B: allantoic fluid after removal of RBC, lane C: allantoic fluid after removal of cell debris, lane D: supernatant after pelleting the virus, lane E: the virus pellet (1/100 dilution), lane F: virus after the first sucrose gradient and after removal of sucrose (1/100 dilution), lane G-J: virus after denaturing sucrose gradient: lane G: fraction with HAU 64 and 128 (1/100), lane H: fraction with HAU >256 (1/100), lane I: fraction with HAU 64 and 128 (undiluted), lane J: fraction with HAU >256 (undiluted). HA can be detected as a monomer and as two different multimers, most likely a dimer and a trimer. Production of recombinant haemagglutinin [00310] In further embodiments, a recombinant influenza virus haemagglutinin protein is produced. The recombinant influenza virus haemagglutinin protein used in this example includes the extracellular domain of haemagglutinin fused to the V5-His tag in the pcDNA3.1D/V5-His vector (Invitrogen). Viral RNA is isolated from HlNl swine influenza strain A/swine/Belgium/ 1/98 via the RNeasy mini kit (Qiagen) and subsequently converted into cDNA via random primers (Invitrogen) and Superscript II reverse transcriptase (Invitrogen) followed by an RNase H (Gibco) treatment. The obtained single stranded cDNA serves as template for PCR amplification of the HA sequence using following primers: forward primer 5'GAA GAT CTC ACC ATG GAA GCA AAA CTG TTT GTA TTA TTC TG3' (SEQ ID No. 1) and reverse primer 5'TCC CCG CGG AAT CTG GTA AAC TCC CAT TGA TTC3' (SEQ ID NO. T) (Invitrogen). The PCR fragment is then cloned in the pcDNA3.1D/V5-His vector. The sequence is verified via restriction digest and sequencing. The isolated and verified nucleotide sequence encoding the extracellular domain of influenza virus haemagglutinin is shown and referred to as SEQ ID NO. 3 herein. [00311] Extracellular domain of influenza virus haemagglutinin - SEQ ID NO. 3 5'-
ATGGAAGCAAAACTGTTTGTATTATTCTGTGTATTCAATGCGCTGAAAGCTGACACC ATTTGT GTAGGCTACCATGCTAACAATTCCACAGACACTGTCGACACAATACTGGAGAAAAATGTG AC TGTTACCCATTCAGTTAATTTACTAGAAAACAGCCATAATGGAAAACTCTGCAGCCTGAA TGG AAAAGCCCCCCTACAACTGGGGAACTGCAACGTAGCAGGATGGATCCTTGGCAACCCAGA AT GTGACTTGTTGCTCACAGCGAATTCATGGTCTTACATAATAGAGACTTCAAATTCAAAAA ATG GAAAATGCTACCCCGGAGAATTCGCTGATTATGAGGAATTAAGGGAGCAGCTGAGTACAG TT TCTTCATTTGAAAGATTTGAAATTTTCCCAAAAGCAACCTCATGGCCAGATCATGAGACA ACC AAAGGTACCACAACTGCATGCTCCCACTCTGGAACCAGCAGTTTTTACCGGAACTTGCTA TGG ATAGTAAAGAAGGGAAACTCCTATCCTAAGCTCAGCAAGTCATACACAAACAACAAAGGA AA AGAAGTGCTTGTAATCTGGGGAGTGCACCACCCTCCGACTAACAGTGACCAACAAACCCT CTA CCAGAATGCTTATACATATGTTTCAGTTGAATCATCAAAATACTACCGAAGGTTCACACC AGA AATAGCAGCTAGACCTAAAGTCAGAGGACAAGCAGGCAGAATGAATTATTATTGGACACT GT TAGATCAAGGAGACACCATAACATTTGAAGCCACTGGGAACTTAATAGCACCATGGTACG CA TTTGCTTTGAATAAGGGCTCTAATTCTGGAATTATGATGTCGGATGCTCATGTTCACAAT TGCA
CTACAAAGTGCCAAACTCCTCATGGGGCCTTGAAAAGTAATCTTCCTTTTCAgAACG TACATCC CATCACTATTGGAGAATGCCCTAAATATGTTAAAAGCACCCAACTAAGAATGGCAACAGG AT TAAGAAACGTCCCCTCTATCCAATCCAGAGGACTTTTTGGAGCAATTGCTGGGTTCATTG AAG GAGGATGGACAGGAATGATAGATGGATGGTATGGATATCACCATCAAAATGAGCAGGGAT CT GGTTACGCAGCAGATCAGAAAAGCACACAAATTGCAATTGATGGGATCAGCAACAAAGTG AA CTCAGTAATTGAAAAAATGAACATTCAATTTACTTCAGTGGGCAAGGAGTTCAATAATCT GGA GAAAAGGATTGAGAATTTGAATAAGAAGGTCGATGATGGGTTTTTGGATATATGGACATA TA ATGCTGAGTTGCTCATTTTGCTCGAGAATGAAAGGACTCTAGATTTCCATGACTTTAACG TAA AAAATTTATATGAAAAGGTCAAATCACAATTGAGAAACAATGCCAAGGAAGTCGGTAATG GT TGTTTTGAGTTCTATCACAAATGTGATAATGAATGCATGGAGAGCGTAAAGAATGGCACA TAC AATTATCCCAAATATTCAGAAGAATCCAAATTGAATAGAGAGGAAATAGACGGTGTGAAA TT AGAATCAATGGGAGTTTACCAGATT - 3'
[00312] Production and purification of the recombinant, soluble HA is demonstrated in a human embryonic kidney cell line, HEK293T. HEK293T cells are transfected using calcium phosphate to produce the soluble haemagglutinin. Sixteen hours post transfection, medium is replaced by fresh medium with or without fetal bovine serum (FBS). Samples are taken every 24hrs post transfection and analyzed via SDS- PAGE and western blotting to determine at what time post transfection the supernatant contains the highest concentrations of soluble HA (Fig. 7A and 7B). The recombinant, soluble HA is produced in HEK293T cells, no matter whether FBS is present in the serum or not. In the absence of FBS, the maximum amount of HA in the serum is reached at 72hrs post transfection. In the presence of FBS, the amount of HA stays the same until 120 hrs post transfection. The recombinant HA is produced as a monomer and, to a lesser extent as a trimer, which is confirmed by the disulfide-reducing agent beta-mercaptoethanol. [00313] Figures 7A and 7B show SDS-PAGE analysis of the production of recombinant HA with a V5- His tag. The recombinant HA is produced in the absence, Figure 7A or in the presence Figure 7B of fetal bovine serum. Samples are taken every 24hrs post transfection as indicated above the lanes in Figures 7 A and 7B. HA is detected via a monoclonal antibody recognizing the V5 tag. Under non-reducing conditions, HA is mainly present in the supernatant as a monomer, although it also forms trimers. In the presence of the disulfide-reducing agent beta-mercaptoethanol, indicated with an asterix* in Figures 7 A and 7B, HA is only present as a monomer, confirming that the high molecular weight protein was indeed an HA trimer. The molecular weight of the proteins is determined via a marker in lane A (prestained) and B.
[00314] After collection of the supernatant, the recombinant HA is purified via Ni-NTA beads according to the manufacturers instructions (Qiagen). Because of interference of the FBS with this purification step, HA is further produced without FBS and the supernatant is collected at 72hrs post transfection. Different fractions are taken during the purification process and HA is visualized via SDS- PAGE followed by western blot or coomassie blue staining as shown in Figures 8A and 8B, respectively. The recombinant HA is present in the original supernatant, but not in the flow through. HA is clearly
concentrated, both the monomer and the trimer. Figures 8 A and 8B show SDS-PAGE analysis of the purification process of recombinant HA-V5-His via Ni-NTA beads. SDS-PAGE is followed by western blotting and detection of HA via a monoclonal antibody directed against the V5-tag to identify the fractions containing HA, Figure 8 A, or by coomassie blue staining to visualize the purity of the HA, Figure 8B . Lane A: marker, lane B: original supernatant with FBS, lane C and D: original supernatant from 2 different productions without FBS, lane E: flow through of purification, following lanes: elution fractions of 0.8ml, fractions are indicated with their respective number above the lanes. HA is present in all original supernatants but not in the flow through. HA is clearly concentrated, both the monomer and the trimer. [00315] Conjugation of antibodies with HA [00316] Hybridomas producing monoclonal antibody 41D3, described in Duan, X., et al., Adv Exp Med Biol, 1998. 440: p. 81-8, or monoclonal antibody 13D12, described in Nauwynck, HJ. and M.B. Pensaert, Arch Virol, 1995. 140(6): p. 1137-46, directed against porcine sialoadhesin or an isotype matched (IgGl) irrelevant control antibody, respectively, are cultivated and supernatant is collected every 72hrs. Antibodies are purified via protein G sepharose columns as described by the manufacturer (GE Healthcare). [00317] Influenza virus hemagglutinin Type A/swine/Belgium/1/98 having protein sequence identified as GenPept Accession number AY590824, and herein as SEQ ID No. 4, is used in this example as a cargo moiety conjugated to mAb 41D3. [00318] SEQ ID No. 4:
MEAKLFVLFCVFNALKADTICVGYHANNSTDTVDTILEKNVTVTHSVNLLENSHNGK LCSLN GKAPLQLGNCNV AGWILGNPECDLLLTANSWSYIIETSNSKNGKCYPGEF AD YEELREQLSTV SSFERFEIFPKATSWPDHETTKGTTTACSHSGTSSFYRNLLWIVKKGNSYPKLSKSYTNN KGKE VLVIWGVHHPPTNSDQQTLYQNAYTYVSVESSKYYRRFTPEIAARPKVRGQAGRMNYYWT L LDQGDTITFEATGNLIAPWY AFALNKGSNSGIMMSDAHVHNCTTKCQTPHGALKSNLPFQNV HPITIGECPKYVKSTQLRMATGLRNVPSIQSRGLFGAIAGFIEGG WTGMIDGWYGYHHQNEQG SGYAADQKSTQIAIDGISNKVNSVIEKMNIQFTSVGKEFNNLEKRIENLNKKVDDGFLDI WTYN AELLILLENERTLDFHDFNVKNL YEKVKSQLRNNAKEVGNGCFEFYHKCDNECMESVKNGTY NYPKYSEESKLNREEIDGVKLESMGVYQI
[00319] The purified antibodies are coupled to influenza haemagglutinin (HA) SEQ ID No. 4 via a disulfide-bridge. To accomplish this, the 41D3 monoclonal antibody, the isotype matched control monoclonal antibody and HA are activated with the cross-linker SPDP (N-succinimidyl-3-(2- pyridyldithio)-propionate) according to the manufacturers instructions (Pierce Biotechnology). For HA, the SPDP is activated via dithiothreitol (DTT). The activated proteins are purified from the unreacted cross- linkers via PD-10 desalting columns (Amersham Biosciences). The activated proteins are mixed in a 1:1 antibody:HA ratio. The uncoupled HA is removed from the coupled products, 41D3-HA and control monoclonal antibody-HA, by dialysis with a float-a-lyzer (Spectra/Por) with a MWCO 100,000.
[00320] Coupling of the antibodies and HA to form conjugates is verified via SDS-PAGE followed by
western blotting and by analysis of uptake of the coupling products by primary alveolar macrophages. For both antibodies there is a clear shift towards a bigger protein, which confirms that each antibody is coupled with HA. Figures 9A and 9B show visualization of coupling of antibodies 13D12, Figure 9A, or 41D3, Figure 9B, with isolated native HA. Samples taken during the coupling process are analyzed via SDS- PAGE followed by western blotting and detection via a mixture of 3 monoclonal antibodies recognizing HA of HlNl . Lane A: original antibody, lane B : SPDP treated antibody after PD-10 desalting column, lane C: HA coupled with antibody, lane D: HA coupled with antibody after dialysis and lane E: marker. Vaccinations [00321] Twelve six-week-old pigs are obtained from an influenza virus-seronegative farm and randomly assigned to 3 groups of 4 pigs. The animals are housed in isolation units with high efficiency particulate air (HEPA) filters. Water and feed are provided ad libitum. The first group of 4 pigs is immunized with lmg HA- 13Dl 2 conjugate per pig, the second group with lmg HA-41D3 conjugate per pig and the control group with the same volume of PBS without any protein. For each pig, the conjugate is diluted in 3ml PBS. Half of the conjugate is injected intravenously and the other half intramuscularly in the neck.
[00322] Blood samples are collected from all pigs at the time of immunization and on day 4, 7, 11, 14 and 18 after immunization. The sera are examined in haemagglutination inhibition (HI) tests, virus neutralization (VN) test and in immunoperoxidase monolayer assays (IPMA) as described in Van Reeth, K., S. Van Gucht, and M. Pensaert, Vet Rec, 2003. 153(1): p. 9-13. [00323] Haemagglutination assay (HA)
[00324] Samples containing influenzavirus haemagglutinin are serially diluted and mixed with 0.5% chicken erythrocytes for one hour at room temperature. The highest dilution of that still shows haemaglutination is considered to be the haemagglutinating titer. [00325] Haemagglutination inhibition (HI) [00326] The sera are examined in a haemagglutination inhibition (HI) test against HlNl strain A/swine/Belgium/ 1/98. The inactivated sera are first treated with receptor-destroying enzyme (RDE) from Vibrio cholera, followed by inactivation of the enzyme via sodium citrate treatment. Afterwards, the sera are absorbed on chicken erythrocytes to remove non-specific inhibitors of influenza haemagglutination. The HI test is carried out according to standard procedures including positive and negative controls. Because of the pretreatments, the starting dilution of the sera was 1:10 followed by two-fold serum dilutions. Furthermore, each well was mixed with four haemagglutination units of the HlNl strain and 0.5% chicken erythrocytes. After 1 hour incubation, the results are interpreted. In the presence of HA recognizing antibodies, no haemagglutination can be observed and the RBC will all be together in one spot on the bottom of the plate. The HI titer is the reverse of the titer needed for complete inhibition of haemagglutination. As a reference, positive and negative control sera are included in the HI tests.
[00327] Virus neutralization (VN)
[00328] Sera are also examined in a virus neutralization (VN) test for the presence of HlNl neutralizing antibodies. Two-fold serum dilutions are incubated with 100 tissue culture infectious doses (TCID 50 ) of A/swine/Belgium/1/98 virus. Madin-Darby canine kidney (MDCK) cells are then added at a concentration of 600,000 cells per ml. After 24 hours incubation, virus-positive cells are detected by immuno-peroxidase staining. Starting dilution of the sera was 1:2. [00329] Immuno-peroxidase monolayer assay (IPMA)
[00330] Finally, sera are analysed via an immuno-peroxidase monolayer assay (IPMA) for the presence of influenza recognizing antibodies. Therefore, MDCK cells are grown for 24 hours in the presence of 1000 TCID 50 of A/swine/Belgium/1/98 virus. After fixation, cells were incubated with two-fold serum dilutions followed by immuno-peroxidase staining for antibody detection. Starting dilution of the sera is 1 :2. Results are shown in Figure 12. Figure 12 shows mean immuno-peroxidase monolayer assay (IPMA) titers of pigs immunized with 13D12-HA or 41D3-HA. For each group, 4 pigs are immunized with native haemagglutinin (HA) coupled with the isotype matched (IgGl) controi antibody 13D12, or HA coupled with 41D3, a monoclonal antibody directed against porcine sialoadhesin. Serum is collected at day 0, 4, 7, 11, 14 and 18 after immunization and analysed via an IPMA. Pigs immunized with HA coupled to the sialoadhesin specific mAb 41D3 show a faster induction and higher titers of IPMA antibodies. [00331] Example 10 [00332] A conjugate composition including a sialoadhesin binding moiety and a cytotoxic agent is generated in this example. The cytotoxic agent saporin is a 30 kDa plant enzyme, belonging to the family of ribosome inactivating proteins (RIP). Saporin may be isolated from seeds of the plant Saponaria officinalis according to methods known in the art or obtained commercially. Saporin is used in this example as a representative of cytotoxic agents which may be included in a conjugate according to the present invention. [00333] Saporin alone has no cell binding moiety and can thus not enter the cell. However, following conjugation with a sialoadhesin binding moiety to produce a conjugate, saporin is co-internalized in the cell along with the sialoadhesin binding moiety. Saporin is also representative of cytotoxic agents which are capable of linkage to a sialoadhesin binding moiety by a disulfide bond between the sialoadhesin binding moiety and saporin. Further cytotoxic agents are described in Thrush, G.R., et al., Annu Rev Immunol, 1996. 14: p. 49-71. The disulfide bond between the sialoadhesin binding moiety and saporin allows dissociation of toxin.
Conjugation of a cytotoxic agent with a sialoadhesin binding moiety
[00334] The purified antibody 41 D3 is conjugated to saporin (Sigma) via a disulfide-bridge. Therefore, the antibody and saporin are activated with the cross-linker SPDP (N-succinimidyl-3-(2-pyridyldithio)- propionate) according to the manufacturers instructions (Pierce Biotechnology). For saporin, the SPDP is
activated with dithiothreitol and the proteins are purified from the unreacted cross-linkers with PD-10 desalting columns (Amersham Biosciences). The activated proteins are mixed in a 1:1 antibody: saporin ratio. The uncoupled saporin was removed from the coupling products by dialysis with a float-a-lyzer (Spectra/Por) with a MWCO 100,000. [00335] Coupling of saporin and antibody 41D3 is verified via SDS-PAGE followed by coomassie blue staining and by analysis of uptake of the coupling products by primary alveolar macrophages. Coomassie blue staining of an SDS-PAGE shows a clear, upwards shift after conjugation, indicating an increased size, which confirms that part of the antibodies are coupled with saporin. The uncoupled proteins are clearly removed after dialysis. Figure 11 shows SDS-PAGE and Coomassie blue staining of different samples taken during the antibody-saporin conjugation protocol. Lane I: marker, lane A: original antibody, lane B : SPDP treated antibody, lane C: SPDP treated antibody after PD-10 desalting column, lane D: original saporin, lane E: SPDP and DTT treated saporin, lane F: SPDP and DTT treated saporin after PD-10 desalting column, lane G: saporin coupled with antibody, lane H: saporin coupled with antibody after dialysis, and finally lane J: saporin coupled with antibody in the presence of the disulfide-reducing agent beta-mercapto-ethanol in the loading dye. For both antibodies there is a clear shift towards a bigger protein, which confirms that part of the antibodies are coupled with saporin. The uncoupled proteins are clearly removed after dialysis.
[00336] Saporin is conjugated to the mAb 41D3, resulting in a conjugate composition according to the present invention. A control conjugate including a non-sialoadhesin recognizing antibody, mAb 13Dl 2 and saporin is also generated.
[00337] The mAb 41D3/saporin conjugate and the control mAB 13D12/saporin conjugate are each separately incubated with sialoadhesin expressing primary porcine macrophages. After an appropriate time, the cells are immunostained and analyzed by confocal microscopy to determine whether the conjugate binds and is internalized into the cells. Incubation of cells with the mAb 41D3/saporin conjugate results in internalization of the conjugate, indicating that the 41D3 mAb is still functional to bind and stimulate internalization of the conjugate. In contrast, the mAb 41D3/saporin conjugate is observed not to be internalized. Example 11 [00338] Cytotoxic effects of the mAb 41D3/saporin conjugate and the mAB 13D12/saporin conjugate on primary porcine macrophages are tested. Macrophages are incubated with various concentrations of either the mAb 41D3/saporin conjugate or the mAB 13D12/saporin conjugate for various periods of time. An MTT assay is used to colorimetrically assay cell populations and differentiate living and dead cells. [00339] The following table shows OD values as a function of time and the percentage of living cells as a function of conjugate concentration as a result of these treatments: Macrophages
OD values:
0 10 30 100 APOP Levend
41D3-Sap 0.772 0.537 0.541 0.401 2.644
13D12-Sap 0.851 0.708 0.703 0.780 0.445 2.824
Average 0.389 0.423
% Living cells
0 lo- 7 0.3*10 "6 10 "6
41D3-Sap 89.8 29.3 30.4
13D12-Sap 110.2 73.4 72.1 91.9
[00340] Figure 3 depicts the percentage of living cells as a function of conjugate concentration in graphical form. Example 12
[00341] A mAb 41D3/saporin conjugate is incubated with various cells to assess the effect of the cytotoxic agent saporin. CHO cells that express recombinant sialoadhesin and CHO cells do not express sialoadhesin are each incubated with various amounts of the mAb 41D3/saporin conjugate and effects on cell viability are measured at various times following addition of the conjugate. An MTT assay is used to colorimetrically assay cell populations and differentiate living and dead cells.
[00342] The following table shows OD values as a function of time and the percentage of living cells as a function of conjugate concentration as a result of these treatments: CHO (41D3-Sap)
OD values:
0 6.25 12.5 25 50
CHO-Kl 3.475 3.379 3.299 2.873 2.822
CHO-Sn 2.054 1.45 1.474 1.354 1.47
% Living cells
0 lo 7 0.1*10 "6 0.25*10 "6 0.5*10 "6
CHO-Kl 100.0 96.9 94.2 80.3 78.6
CHO-Sn 100.0 63.0 64.4 57.1 64.2
[00343] Figure 4 depicts the percentage of living cells as a function of conjugate concentration in
graphical form. CHO-Sn indicates CHO cells expressing sialoadhesin. CHO-Kl indicates CHO cells which do not express sialoadhesin.
In vivo treatment of pigs with saporin-41D3 immunotoxin
[00344] Pigs are injected intramuscularly with 0.1 or 1 mg saporin-41D3 conjugate in 1 ml of PBS /kg body weight, either as a single dose, or divided in two doses injected with an interval of 6 hours. Four pigs are used for each saporin-41D3 conjugate condition, four control pigs injected with PBS alone; twenty pigs in total. The pigs are euthanized 24 hours after the first injection and the local, draining lymph nodes are collected analyzed. Flow cytometry analysis of lymph node immune cells [00345] Changes in the immune cell population of the lymph nodes are analyzed by flow cytometry. Total immune cells are prepared from lymph nodes by mechanical dissociation or collagenase D digestion. For mechanical dissociation, lymph node samples are dissociatd with needles and filtered on a 40 micron pore size nylon filter. Cells are collected into a 50-ml conical tube and washed twice in RPMI. For collagenase D digestion, lymph nodes are incubated for 1 h at 37 0 C in RPMI with 1 mg collagenase D (Sigma)/ml. Cell suspensions are then filtered through a 40 micron pore size nylon filter and collected in RPMI with 30 % FBS. After centrifugation for 15 min at 400 x g, cells are washed three times with RPMI with 5% FBS. For erythrocyte lysis, cells are incubated for 5 min in 5 ml lysis solution (NH4C1 [0.15 M], KHC03 [1 mM], Na 2+ EDTA [0.1 mM]) and washed three times in RPMI with 5% FBS. Monocyte/macrophage cells are identified with FITC -labelled SWC3 specific mAb 74-22-15. Sialoadhesin expressing macrophages are stained with biotinylated mAb 41 D3 , followed by FITC labelled streptavidin. Total T-cells are quantified by staining with a FITC-labelled CD3-specific mAb, while subpopulations of T-cells are quantified by staining with either FITC-labelled CD4 or CD8. B cells are identified with a FITC-labelled mouse monoclonal anti-pig IgM antibody (Clone M160). Analysis of lymph node micro-anatomy [00346] S amples of lymph nodes are fixed in a phosphate-buffered 3.5% formaldehyde solution for 24 h. After fixation, the samples are embedded in paraffin using an automated system (Shandon Citadel Tissue Processor, Cheshire, UK). Sections of 8 microns in thickness are made, deparaffinised in xylene, rehydrated in descending grades of alcohol, stained, dehydrated in ascending grades of alcohol and xylene, and mounted on slides with DPX. Haematoxylin-eosin staining is done to analyze the morphology and micro-anatomy of the lymph nodes of treated and untreated pigs. Immunohistochemical analysis
[00347] Samples from the draining lymph nodes are embedded in methylcellulose medium and frozen at -70 0 C. Cryostat sections (5 to 8 microns in thickness) are made and fixed in acetone for 20 min at - 20 0 C. Sections are stained with one ore more of the following: (1) FITC labelled goat-anti-mouse IgG antibodies to detect the injected immunotoxin;
(2) biotinylated mAb 41D3 followed by FITC labelled streptavidin to allow quantification of
sialoadhesin expressing cells and evaluate the effect of the immunotoxin on the numbers of sialoadhesin expressing cells;
(3) biotinylated antibody 74-22-15, an anti-SWC3 antibody which stains all monocytes and macrophages, not only the sialoadhesin expressing cells, followed by FITC-labelled streptavidin to assess the effect of the toxin on all cells of the monocyte macrophage lineage; and
(4) biotinylated mAb 41D3 followed by FITC labelled streptavidin together with a staining with a goat polyclonal antibody specific for activated caspase-3 (apoptosis marker) followed by TexasRed labelled rabbit-anti-goat antibodies to quantify the total level of apoptosis and the number of apoptotic sialoadhesin expressing macrophages in the draining local lymph nodes of saporin-41D3 conjugate immunotoxin treated pigs.
[00348] In vivo administration of a sialoadhesin binding moiety/cytotoxic agent conjugate, such as a saporin-41D3 conjugate allows for assessment of the in vivo functionality of a sialoadhesin specific immunotoxin and assessment of the capacity of the conjugate to selectively kill sialoadhesin expressing macrophages in lymph nodes. Both in vitro and in vivo assay provide information on the dose and manner of administration that is optimal for depletion of sialoadhesin expressing macrophages in lymph nodes. Depletion of sialoadhesin expressing macrophages may have utility in treatment of specific diseases that involve macrophages, such as rheumatoid arthritis, inflammatory skin diseases, persistent infections and others. [00349] Sialoadhesin Protein and Nucleotide Sequences Sequence ID No. 5 is a protein sequence for pig sialoadhesin identified by GenBank Accession number AF509585.1. Sequence ID No. 5:
MDFLLLLLLLASSALAGLASWTVSSPETVQGIKGSCLIIPCTFG FPANVEVPHGITAIWYYDYSGKRLVVSHSRNPKVVENHFQGRALLLGQVEQRTCSLLL KDLQPQDSGSYNFRFEISEGNRWSDVKGTVVTVTEVPSVPTIALPAKLHEGMEVDFNC STPYVCPTEPVNLQWQGQDPTRSVTSHLQKLEPSGTSHMETLHMALSWQDHGRILSCQ VSAAERRMQKEIHLQVQYAPKGVEILFSHSGRNVLPGDLVTLSCQVNSSNPQVSSVQW VKDGTKLKDQKRVLQLRRAAWADAGVYTCQAGNAVGSSVSPPVSLHVFMAEVQVSPVG SILENQTVTLACNTPKEAPSELRYSWYKNHALLEGSHSRTLRLHSVTRADSGFYFCEV QNARGRERSPPVSVVVSHPPLTPDLTAFLETQAGLVGILQCSVVSEPPATLVLSHGGL ILASTSGEGDHSPRFSVASAPNSLRLEIQDLGPTDSGEYMCSASSSLGNASSTLDFHA NAARLLISPAAEVVEGQAVTLSCRSSLSLMPDTRFSWYLNGALILEGPSSSLLLPAAS STDAGSYHCRAQNSHSTSGPSSPAVLTVLYAPRQPVFTAQLDPDTAGAGAGRQGLLLC RVDSDPPAQLQLLHRGRVVASSLSWGGGCCTCGGCFHRMKVTKAPNLLRVEIRDPVLE DEGVYLCEASSALGNASASATLDAQATVLVITPSHTLQEGIEANLTCNVSREASGPAN FSWFRDGALWAQGPLDTVTLLPVARTDAALYACRIVTEAGAGLSTPVALNVLYPPDPP KLSALLDVDQGHTAVFVCTVDSRPLAQLALFRGEHLLAASSALRLPPRGRLQAKASAN SLQLEVRDLSLGDSGSYHCEATNILGSANTSLTFQVRGAWVRVSPSPELQEGQAVVLS CQVPIGVLEGTSYRWYRDGQPLQESTSATLRFAAITLSQAGAYHCQAQAPGSATTDLA APVSLHVTYAPRQATLTTLMDSGLGRLGLLLCRVNSDPPAQLRLLHGSRLVASTLQGV EELAGSSPRLQVATAPNTLRLEIHNAVLEDEGVYTCEATNTLGQTLASAAFDAQAMRV QVWPNATVQEGQLVNLTCLVWTTHLAQLTYTWYRDQQQLPGAAHSILLPNVTVTDAAS YRCGILIPGQALRLSRPVALDVLYAPRRLRLTHLLESRGGQLAVVLCTVDSRPAAQLT LSHAGRLLASSTAASVPNTLRLELWEPRPSDEGLYSCSARSPLGQANTSLELRLEGVQ
VALAPSATVPEGAPVTVTCEDPAARPPTLYVWYHNSRWLQEGSAASLSFPAATRAHA G AYTCQVQDAQGTRISQPAALHILYAPRDAVLSSFWDSRASPMAVVQCTVDSEPPAEMT LSHDGKVLATSHGVHGLAVGTGHVQVARNALQLRVQNVPSRDKDTYVCMDRNSLGSVS TMGQLQPEGVHVVAEPGLDVPEGTALNLSCRLPSGPGHIGNSTFAWFRNGRQLHTESV PTLTFTHVARAQAGLYHCQAELPAGAATSAPVLLRVLYPPKTPTMTVFVEPEGGIQGI LDCRVDSEPLASLTLHLGSRLVASSQPQAAPAKPHIRVSASPNALRVDMEELKPSDQG EYVCSASNALGSASAATYFGTRALHRLHLFQHLLWFLGLLASLLFLLLGLGVWYAWRR GNFYKLRMGEYSVEMVSRKETTQMSTDQEEVTGIGDDAGSVNQAAFDPAHLCENTQSV KSTV
Sequence ID No. 6 is a nucleotide sequence encoding pig sialoadhesin identified by GenBank Accession number AF509585.1. Sequence ID No. 6:
1 atggacttcc tgctcctgct cctcctcctg gcttcatctg ctctagcagg cctggcctcg 61 tggacggttt ccagccccga gaccgtgcag ggcatcaagg gctcctgcct catcatcccc
121 tgcaccttcg gcttcccggc caacgtggag gtgccccatg gcatcacagc catctggtac
181 tatgactact caggcaagcg cctggtagtg agccactcca ggaacccaaa ggtggtggag
241 aaccacttcc aaggccgggc cctgctgttg gggcaggttg aacagaggac gtgcagcctg
301 ctgctgaagg acctgcagcc ccaggactcg ggctcctata acttccgctt tgagatcagc 361 gagggcaacc gctggtcaga tgtcaaaggc acagttgtca ccgtgacaga ggtgcccagc
421 gtgcccacca ttgccttgcc agccaagctg catgagggca tggaggtgga cttcaactgc
481 tccactccct atgtgtgccc gacggagccg gtcaacctac agtggcaagg ccaggatccc
541 acccgctccg tcacctccca cctccagaag cttgagccct cgggcaccag ccacatggag
601 accctgcaca tggccctgtc ctggcaggac catggccgga tcctgagctg ccaggtctca 661 gcagccgaac gcaggatgca gaaggagatt cacctccaag tgcagtatgc ccccaagggt
721 gtggagatcc ttttcagcca ctccggacgg aacgtccttc caggtgatct ggtcaccctc
781 agctgccagg tgaatagcag caaccctcag gtcagttccg tgcagtgggt caaggatggg
841 acgaagctca aagaccagaa acgtgtactg cagttgcgcc gggcagcctg ggctgatgct
901 ggcgtctaca cctgccaagc cgggaatgcc gtgggctctt cagtctcacc cccggtcagc 961 ctccacgtct tcatggctga ggtccaggta agccctgtgg gctccatcct ggagaaccag
1021 acggtgacgc tggcctgcaa tacacctaag gaagcgccca gcgagctgcg ctacagctgg
1081 tacaagaacc acgccctgct ggagggctct cacagccgca ccctccggct gcactcagtt 1141 accagggcgg attcgggctt ctacttctgc gaggtgcaga acgcccgggg cagagagcgc
1201 tctccccctg tcagcgtggt ggtcagccac ccacccctca ccccggacct aactgccttc
1261 ctggagacac aggcggggct ggtgggcatc ctccaatgct ctgtggtcag cgagccccca
1321 gctactctgg tgttgtcaca cgggggcctc atcttggcct ctacctccgg ggagggtgac
1381 cacagcccac gcttcagtgt cgcctctgcc cccaactccc tgcgcctgga gattcaagac 1441 ctggggccaa cagacagtgg ggaatacatg tgctcagcca gcagttctct tgggaatgcg
1501 tcctccaccc tggacttcca tgccaatgca gcccgcctcc tcatcagccc agcagcagag
1561 gtggtggaag ggcaggcggt gacactgagc tgcaggagca gcctgagcct gatgcctgac
1621 acccgttttt cctggtacct gaacggggcc ctgattctcg aggggcccag cagcagcctc
1681 ctgctcccag cagcctccag cacagatgcc ggctcatacc actgccgggc ccagaacagc
1741 cacagcacca gcgggccctc ctcacctgct gttctcaccg tgctctacgc cccacgccag
1801 cccgtgttca ctgcccagct ggaccctgat actgcaggag ctggggccgg acgccaaggc 1861 ctcctcttgt gccgtgtgga cagcgacccc ccagcccagc tgcagctgct ccacaggggc
1921 cgtgttgtgg cctcttctct gtcatggggg ggcggctgct gcacctgcgg aggctgtttc
1981 caccgcatga aggtcaccaa agcacccaac ctactgcgtg tagagatccg agacccggtg
2041 ctggaggatg agggtgtgta cctgtgcgag gccagcagcg ccctgggcaa cgcctccgcc
2101 tctgcaacct tggatgccca ggccactgtc ctggtcatca caccgtcaca cacgctgcag 2161 gaaggcattg aagccaacct gacttgcaac gtgagccgtg aagccagcgg ccctgccaac
2221 ttctcctggt tccgagatgg ggcgctatgg gcccagggcc ctctggacac cgtgacgctg
2281 ctacctgtgg ccagaactga tgctgccctc tatgcttgcc gcatcgtcac cgaggctggt
2341 gctggcctct ccacccctgt ggccctgaat gtgctctatc cccccgatcc tccaaagttg
2401 tcagccctcc tggacgtgga ccagggccac acggctgtgt tcgtctgtac tgtggacagt 2461 cgccctcttg cccagttggc cctgttccgt ggggaacacc tcctggccgc cagctcggca
2521 ctccggctcc cccctcgtgg ccgcctccag gccaaagcct cggccaactc cttgcagcta
2581 gaggtccgag acttgagcct tggggactct ggcagctacc actgtgaggc caccaacatc
2641 cttggatcag ccaacacttc tcttaccttc caggtccgag gagcctgggt ccgggtgtca
2701 ccgtcgcctg agctccagga gggccaggct gtggtcctga gctgccaggt acccataggg 2761 gtcctggagg ggacctcata tcgttggtat cgggatggcc agcccctcca ggagtccact
2821 tcggccacgc tccgttttgc agccataact ctgagccagg ctggagccta ccattgccaa
2881 gcccaagctc caggctcagc caccacggac ctggctgccc ctgtcagcct ccacgtgacc
2941 tacgcacctc gccaggccac actcaccacc ctgatggact caggcctcgg gcgactgggc
3001 ctccttctgt gccgtgtgaa cagtgaccct cctgcccagc tccgactgct ccatgggagc 3061 cgcctcgtgg cctctactct acaaggtgtg gaggagcttg caggcagctc tccccgccta
3121 caggtggcca cagcccccaa cacgctgcgc ctggagatcc acaacgcagt gctggaggat
3181 gaaggcgtct acacctgcga ggccaccaac accctgggtc agaccttggc ctccgccgcc
3241 ttcgatgccc aggctatgag agtgcaggtg tggcccaatg ccaccgtgca agaggggcag
3301 ctggtgaacc tgacctgcct tgtatggacc acgcacctgg cccagctcac ctacacgtgg
3361 taccgagacc agcagcagct cccaggtgct gcccactcca tcctcctgcc caatgtcact
3421 gtcacagatg ccgcctccta ccgctgtggc atattgatcc ctggccaggc actccgcctc 3481 tccagacctg tcgccctgga tgtcctctac gcaccccgca gactgcgcct gacccatctc
3541 ttggagagcc gtggtgggca gctggccgtg gtgctgtgca ctgtggacag tcgcccagct
3601 gcccagctga ccctcagcca tgctggccgc ctcctggcct cctcaaccgc agcctctgtc
3661 cccaacaccc tgcgcctgga gctgtgggag ccccggccca gtgatgaggg tctctacagc
3721 tgctcggccc gcagtcctct gggccaggcc aacacatccc tggagctgcg gctagagggc 3781 gtgcaggtgg cactggctcc atcggccact gtgccggagg gggcccctgt cacagtgacc
3841 tgtgaagacc ctgctgcccg cccacccact ctctatgtct ggtaccacaa cagccgttgg
3901 ctgcaggagg ggtcggctgc ctccctctcg tttccagcgg ctacacgggc tcacgcgggc
3961 gcctatacct gccaggtcca ggatgcccag ggcacacgca tctcccagcc cgcagcactg
4021 cacatcctct atgcccctcg ggatgctgtc ctttcctcct tctgggactc aagggccagc 4081 cctatggccg tggtacagtg cactgtggac agcgagccac ctgccgagat gaccctgtcc
4141 catgatggca aggtgctggc caccagccat ggggtccacg gcttagcagt ggggacaggc
4201 catgtccagg tggcccgcaa cgccctgcag ctgcgggtgc agaatgtgcc ctcacgtgac
4261 aaggacacct acgtctgcat ggaccgcaac tccttgggct cagtcagcac catggggcag
4321 ctgcagccag aaggtgtgca cgtggtagct gagccagggc tggatgtgcc tgaaggcaca 4381 gcgctgaacc tgagctgtcg cctccctagt ggccctgggc acataggcaa ctccaccttt
4441 gcttggttcc ggaacggtcg gcagctacac acagagtctg tgcccaccct taccttcacc
4501 catgtggccc gcgcccaagc tggcttgtac cactgccagg ctgagctccc cgccggggct
4561 gccacctctg ctccagtctt gctccgggtg ctctaccctc ccaagacgcc caccatgact
4621 gtttttgtgg agcccgaggg tggcatccag ggcattctgg actgccgagt ggacagtgag 4681 cccctagcca gcctgaccct ccacctgggc agtcggctgg tggcctccag ccagcctcag
4741 gctgcccctg ccaagccgca catccgcgtc tcagccagtc ccaatgcctt gcgagtggac
4801 atggaggagc tgaagcccag tgaccagggg gagtatgtgt gctcggcctc caatgccctg
4861 ggctctgcct ctgctgccac ctacttcgga accagagccc tgcatcgcct gcatctgttc
4921 cagcaccttc tctggttcct ggggctgctg gcgagcctcc tcttcctact gttgggcctg
4981 ggggtctggt acgcctggag acggggaaat ttttacaagc tgagaatggg cgaatattca
5041 gtagagatgg tatctcggaa ggaaaccacg cagatgtcca ctgaccagga agaagttact 5101 ggaatcggtg atgatgcggg ctctgtgaac caggcggcat ttgatcctgc ccacctctgt 5161 gaaaacacac agtctgtgaa aagcacagtc tga
Sequence ID No. 7 is a protein sequence for mouse sialoadhesin identified by GenBank Accession number NM_011426. Sequence ID No. 7
MCVLFSLLLLASVFSLGQTTWGVSSPKNVQGLSGSCLLIPCIFS YPADVPVSNGITAIWYYDYSGKRQVVIHSGDPKLVDKRFRGRAELMGNMDHKVCNLLL KDLKPEDSGTYNFRFEISDSNRWLDVKGTTVTVTTDPSPPTITIPEELREGMERNFNC STPYLCLQEKQVSLQWRGQDPTHSVTSSFQSLEPTGVYHQTTLHMALSWQDHGRTLLC QFSLGAHSSRKEVYLQVPHAPKGVEILLSSSGRNILPGDPVTLTCRVNSSYPAVSAVQ WARDGVNLGVTGHVLRLFSAAWNDSGAYTCQATNDMGSLVSSPLSLHVFMAEVKMNPA GPVLENETVTLLCSTPKEAPQELRYSWYKNHILLEDAHASTLHLPAVTRADTGFYFCE VQNAQGSERSSPLSVVVRYPPLTPDLTTFLETQAGLVGILHCSVVSEPLATVVLSHGG LTLASNSGENDFNPRFRISSAPNSLRLEIRDLQPADSGEYTCLAVNSLGNSTSSLDFY ANVARLLINPSAEVVEGQAVTLSCRSGLSPAPDTRFSWYLNGALLLEGSSSSLLLPAA SSTDAGSYYCRTQAGPNTSGPSLPTVLTVFYPPRKPTFTARLDLDTSGVGDGRRGILL CHVDSDPPAQLRLLHKGHVVATSLPSRCGSCSQRTKVSRTSNSLHVEIQKPVLEDEGV YLCEASNTLGNSSAAASFNAKATVLVITPSNTLREGTEANLTCNVNQEVAVSPANFSW FRNGVLWTQGSLETVRLQPVARTDAAVYACRLLTEDGAQLSAPVVLSVLYAPDPPKLS ALLDVGQGHMAVFICTVDSYPLAHLSLFRGDHLLATNLEPQRPSHGRIQAKATANSLQ LEVRELGLVDSGNYHCEATNILGSANSSLFFQVRGAWVQVSPSPELREGQAVVLSCQV PTGVSEGTSYSWYQDGRPLQESTSSTLRIAAISLRQAGAYHCQAQAPDTAIASLAAPV SLHVSYTPRHVTLSALLSTDPERLGHLVCSVQSDPPAQLQLFHRNRLVASTLQGADEL AGSNPRLHVTVLPNELRLQIHFPELEDDGTYTCEASNTLGQASAAADFDAQAVRVTVW PNATVQEGQQVNLTCLVWSTHQDSLSYTWYKGGQQLLGARSITLPSVKVLDATSYRCG VGLPGHAPHLSRPVTLDVLHAPRNLRLTYLLETQGRQLALVLCTVDSRPPAQLTLSHG DQLVASSTEASVPNTLRLELQDPRPSNEGLYSCSAHSPLGKANTSLELLLEGVRVKMN PSGSVPEGEPVTVTCEDPAALSSALYAWFHNGHWLQEGPASSLQFLVTTRAHAGAYFC QVHDTQGTRSSRPASLQILYAPRDAVLSSFRDSRTRLMVVIQCTVDSEPPAEMVLSHN GKVLAASHERHSSASGIGHIQVARNALRLQVQDVTLGDGNTYVCTAQNTLGSISTTQR LLTETDIRVTAEPGLDVPEGTALNLSCLLPGGSGPTGNSSFTWFWNRHRLHSAPVPTL SFTPVVRAQAGLYHCRADLPTGATTSAPVMLRVLYPPKTPTLIVFVEPQGGHQGILDC RVDSEPLAILTLHRGSQLVASNQLHDAPTKPHIRVTAPPNALRVDIEELGPSNQGEYV CTASNTLGSASASAYFGTRALHQLQLFQRLLWVLGFLAGFLCLLLGLVAYHTWRKKSS TKLNEDENSAEMATKKNTIQEEVVAAL
Sequence ID No. 8 is a nucleotide sequence encoding mouse sialoadhesin identified by GenBank Accession number NM_011426. Sequence ID No. 8:
1 agacaagatt aggcctagag taagtctatg aaacacagag aaaggggaca gcataggggt 61 taagaaatga ggtctttcaa aatctcaggg ggcaatgagg agttttttga gagaggaagg 121 actctttaaa ggaagttgaa ggaggattct gtgaacttga gaccaccctg agctgccaag 181 ttgagaactt tgtctacaaa caagccaggc agcctcagcg tgtgctcagt ccgacttgta 241 gctggagagg caggagacca atttccggtg cttacggtgc ttgctggatg ccctggagta 301 agtgacaggg tctcactgga ctccaggttc tgttggtttg agtaatagga ggcggcaggg 361 gagaagtgaa gagagacatg cactgctgat ctgccttgag gctgtgtcct taaggggtgg 421 agccaagggg cacagaagac tctctgggac atgccaccaa gtgagagcat ttccaatcac
481 tccctgagcc aggaacaggg gcttctggtt ccctgctggt ggctgccaca gcagtccttc
541 ctgttgggtt gaccaacaca gcaggtgaga taaaccctat agacttgggc cctggagtgc
601 tccaggcagt ctctgtgtgc ctacccaccc ggcttcccta ggcacctgaa tgcacctggg
661 cactgggatg tgtgtcctgt tctccctgct cctgctggcc tctgtcttct cactaggcca 721 gaccacatgg ggtgtctcca gtcccaagaa tgtgcagggc ttgtcgggat cctgcctgct
781 cattccctgc atcttcagct accctgccga tgtcccagtg tccaatggca tcacagccat
841 ctggtactat gactactcgg gcaagcggca ggtggtaatc cactcagggg accccaagct
901 ggtggacaag cgtttcaggg gtcgagctga actgatgggg aacatggacc acaaggtgtg
961 caacctgttg ctcaaagact tgaagcctga agactctggc acctacaact tccgctttga 1021 gatcagtgat agcaaccgct ggttagatgt caaaggcacc acggtcactg tgacaacgga
1081 tcccagcccc cccactatta ccattcctga ggagctgcgt gaaggcatgg agaggaactt
1141 caactgttcc acaccctacc tgtgcctgca ggagaagcaa gtcagcctgc agtggcgagg
1201 ccaggacccc acccactctg tcacctccag cttccagagc ctcgagccca ctggcgtcta
1261 tcaccagacg accctacata tggccctatc ctggcaggac cacggtcgga ccctgctctg 1321 ccagttctca ttgggcgcac acagtagtcg gaaagaggtt tacctgcaag tgccacatgc
1381 ccccaaaggt gtggagatcc tcctcagctc ctcagggagg aacatccttc ccggggatcc
1441 agtcacactc acctgcagag tgaacagcag ctatcctgct gtcagtgccg tgcagtgggc
1501 cagggacgga gtgaacctcg gagtcacggg acatgtgctt cggctgttct cagcagcctg
1561 gaatgattct ggggcctaca cctgccaagc aacaaatgat atgggctctc tggtgtcatc 1621 cccgctcagc ctccatgttt ttatggctga agtcaaaatg aaccccgcag ggcccgtctt
1681 ggaaaatgag acagtgactc tgctctgtag cacgccgaag gaggctcccc aggagctccg
1741 ctatagctgg tacaagaacc acattctcct ggaagatgcc catgcctcaa ccttgcacct
1801 gcctgcagtc accagggctg atactggctt ctacttctgt gaagtgcaga atgcccaggg
1861 cagtgagcgc tccagtccat tgagtgtggt ggtcagatat ccacccctta ctccagacct 1921 gaccaccttc ctggagacac aggccggact tgtgggcatc ttgcattgct ccgtggtcag
1981 tgagcccctg gctactgtgg tgctgtcaca cggaggcctc acgttggcct ccaactctgg
2041 agaaaatgac ttcaaccccc gattcaggat ctcctctgcc cccaactccc tgcgcctaga
2101 aatccgagac ttgcagccag cagacagcgg agagtacaca tgcttagctg tcaactccct
2161 tggaaactca acgtccagcc tagacttcta tgctaatgtg gcccgactcc tcatcaaccc 2221 ttcagcagag gttgtggaag ggcaggcggt gaccctgagc tgcaggagtg gcctgagccc
2281 agctcctgac actcgcttct cctggtacct gaacggagct ctacttctgg aaggatccag
2341 cagcagcctc ctgcttcctg cggcttccag cactgatgcg ggctcatact actgtaggac
2401 gcaggctggc cccaacacca gcggcccctc cctgcctact gtcctcactg tgttctatcc 2461 cccaagaaag cccacattca ctgccaggct ggatttggat acctctggag tcggggatgg
2521 acgacggggc atcctcttgt gccacgtaga cagcgatccc ccagcccagc tacggcttct
2581 ccacaaaggc catgttgtgg ccacttctct gccatcaagg tgtgggagct gttcccagcg
2641 cacaaaagtc agcagaacct ccaactcact gcacgtggag atccagaagc ctgtattaga
2701 ggatgagggc gtgtacctgt gtgaggctag caacacattg ggcaactcct cagccgcagc 2761 ctctttcaat gctaaggcca ctgtactggt catcacaccg tcaaatacac tgcgtgaagg
2821 cacagaggcc aacctaactt gcaacgtgaa ccaggaggtt gctgtcagcc ctgccaactt
2881 ctcctggttc cggaatggag tgctgtggac ccagggatca ctggagactg tgaggctgca
2941 gcctgtggcc agaactgatg ctgctgtcta tgcctgccgc ctcctcaccg aggatggggc
3001 tcagctctcg gctcctgtgg tcctaagtgt gctgtatgcc ccagaccctc caaagctgtc 3061 agccctccta gatgtgggtc agggccacat ggccgtgttc atctgcactg tggacagcta
3121 tcccctggct cacctgtctc tgttccgtgg ggaccatctc ctggccacca acttggaacc
3181 ccagcgtccc tcccatggca ggatccaggc caaggccaca gccaactccc tgcagctaga
3241 ggtccgagaa ctaggtcttg tggactctgg aaactaccac tgtgaagcca ccaatattct
3301 tgggtcagcc aacagttcac tcttcttcca ggtcagagga gcctgggtcc aggtttcacc 3361 atcacctgag ctccgggagg gccaggctgt ggtcctgagc tgccaggtgc ccacaggagt
3421 ctctgagggg acctcataca gctggtatca ggatggccgc cccctccagg agtcaacctc
3481 atctacactc cgcattgcag ccataagtct gaggcaagct ggtgcctacc attgccaagc
3541 tcaggcccca gacacagcta ttgccagcct ggctgcccct gtcagcctcc atgtgtccta
3601 taccccacgt catgttacac tcagtgccct gctgagcacg gaccctgagc gactaggcca 3661 cctggtgtgc agtgtacaaa gtgaccctcc agcgcagctg caactgtttc accggaatcg
3721 cctcgtggcc tctaccctac aaggcgcgga cgaattggca ggcagtaatc cccggctgca
3781 tgtgactgtg ctccccaatg agctgcgcct gcagatccac tttccagagc tggaggatga
3841 cgggacctat acatgcgaag ccagcaacac actgggccag gcctcggctg cagctgactt
3901 cgatgcccag gctgtgcgag tgactgtgtg gcccaatgcc actgtgcaag aggggcagca
3961 ggtgaacctg acctgcttgg tgtggagcac ccaccaggac tcactcagct acacatggta
4021 caagggcggg caacaactcc ttggtgccag atccatcacc ctgcccagtg ttaaggtttt 4081 ggatgctacc tcctaccgct gtggtgtggg gctccccggc cacgcacccc atctctccag
4141 acccgtgacc ctggatgtcc tccatgctcc ccgaaacctg cggctgacct acctcctaga
4201 gacccagggc aggcagctgg ccctggtact gtgtacggtg gatagtcgtc cacctgccca
4261 gctaactctc agccatggtg accagcttgt agcctcctca actgaagcct ctgtccccaa
4321 caccctgcgc ctagagcttc aggatccaag gcctagtaat gaggggctct atagctgctc 4381 tgcccacagc ccattgggca aggccaacac gtccctggaa cttctgctgg aaggtgtccg
4441 agtgaaaatg aatccctctg gtagtgtacc cgagggagag cctgtcacag tgacctgcga
4501 ggaccctgct gccctctcat ccgccctcta tgcctggttt cacaatggcc attggcttca
4561 ggagggaccg gcttcctcac tccagttcct ggtgactaca cgggctcacg ctggtgctta
4621 cttttgccag gtgcatgata cacaaggcac acggagctcc agacctgcca gcctgcaaat 4681 tctctatgcc ccccgggatg ctgtcctgtc ttcctttcga gactcaagga ccaggctcat
4741 ggtcgtgatt cagtgcaccg tggacagtga gccacctgct gagatggtcc tatcccacaa
4801 tggcaaggtg ctagctgcca gccacgagcg tcacagctca gcatcaggga taggccacat
4861 ccaggtagcc cgaaatgctc ttcgactaca agtgcaagat gtgactctgg gtgatggcaa
4921 cacctatgtt tgcacagccc agaatacact gggctccatc agtaccaccc agaggcttct 4981 gacggagact gatatacgtg tgacagctga gccaggcttg gatgtgccag agggcacagc
5041 tctgaactta agctgcctcc tccctggtgg ctctgggccc acgggcaact cttccttcac
5101 gtggttctgg aatcgccacc gactacattc agctcctgtg cccacactct ccttcacccc
5161 tgtggtccgg gctcaggctg ggctgtacca ctgcagggct gatctcccca ccggggccac
5221 tacctctgct ccagttatgc tccgtgtcct ctatcccccc aagacgccca ctctcatagt 5281 gtttgtggag cctcagggtg gccaccaggg catcctcgac tgtcgagtgg acagtgagcc
5341 cctggccatc ctcactcttc accggggcag tcaactagta gcctccaacc aacttcacga
5401 tgctcccacc aagccccaca tccgagtcac tgctcctccc aatgccttga gagtggacat
5461 agaggagctc ggccctagca atcaagggga gtatgtgtgc actgcctcca acactctggg
5521 ctctgcctca gcctctgcct actttgggac cagagctctg caccaactgc agctgttcca
5581 gaggctgctc tgggtcctgg gatttctggc aggcttcctg tgcctgctgc tgggtctggt
5641 ggcctatcac acctggagaa agaagagttc taccaagctg aatgaggatg agaattcagc 5701 agagatggcc actaagaaaa atactatcca ggaggaagtg gttgctgctc tctgacaact
5761 caggtgctgt gaacaagatc ctgcctacct ctgtataagc agtacagaga catctggctt
5821 tcctgacctg cccgacttgc cttccaagcc tcttgatcct aagaaaaatg gacgaaggga
5881 ggtttggggt tggaggtcaa cctgccgcct ccagggctct gagacggact cagccatgtt
5941 gcccacgtct ctctgtgtgg ttttcctctg tatccctttg cctttctctt caaagctcac 6001 cttggacttt cttggtgggt tagagcaaca tccagtttct cacagacttt ctaagacggt
6061 ctgtaccagc caggatatca gtcaggttgc tctaacagag actcaataca gtgaccacag
6121 catgacaggg tcttagtttt ccctcctggc ctggttatgt tgttgtggta tcagaatcct
6181 tcttgcttga ttttctccat tccccaagtg ttgcctttga ttatgaagct caggtaactg
6241 cagtgcccat ggaccctaca gggagaagga agagtgaagg gaagacatac ccatccccat 6301 ggtccatgga ctgtgtgtgc aattgcaccc cacccaactt ctcatccgct agaaactggt
6361 cacataaaca taccatgctg aaaggga
Sequence ID No. 9 is a protein sequence for human sialoadhesin identified by GenBank Accession number NM_023068. Sequence ID No. 9
MGFLPKLLLLASFFPAGQASWGVSSPQDVQGVKGSCLLIPCIFS FPADVEVPDGITAIWYYDYSGQRQVVSHSADPKLVEARFRGRTEFMGNPEHRVCNLLL KDLQPEDSGSYNFRFEISEVNRWSDVKGTLVTVTEEPRVPTIASPVELLEGTEVDFNC STPYVCLQEQVRLQWQGQDPARSVTFNSQKFEPTGVGHLETLHMAMSWQDHGRILRCQ LSVANHRAQSEIHLQVKYAPKGVKILLSPSGRNILPGELVTLTCQVNSSYPAVSSIKW LKDGVRLQTKTGVLHLPQAAWSDAGVYTCQAENGVGSLVSPPISLHIFMAEVQVSPAG PILENQTVTLVCNTPNEAPSDLRYSWYKNHVLLEDAHSHTLRLHLATRADTGFYFCEV QNVHGSERSGPVSVVVNHPPLTPVLTAFLETQAGLVGILHCSVVSEPLATLVLSHGGH ILASTSGDSDHSPRFSGTSGPNSLRLEIRDLEETDSGEYKCSATNSLGNATSTLDFHA NAARLLISPAAEVVEGQAVTLSCRSGLSPTPDARFSWYLNGALLHEGPGSSLLLPAAS STDAGSYHCRARDGHSASGPSSPAVLTVLYPPRQPTFTTRLDLDAAGAGAGRRGLLLC RVDSDPPARLQLLHKDRVVATSLPSGGGCSTCGGCSPRMKVTKAPNLLRVEIHNPLLE EEGLYLCEASNALGNASTSATFNGQATVLAIAPSHTLQEGTEANLTCNVSREAAGSPA NFSWFRNGVLWAQGPLETVTLLPVARTDAALYACRILTEAGAQLSTPVLLSVLYPPDR PKLSALLDMGQGHMALFICTVDSRPLALLALFHGEHLLATSLGPQVPSHGRFQAKAEA NSLKLEVRELGLGDSGSYRCEATNVLGSSNTSLFFQVRGAWVQVSPSPELQEGQAVVL SCQVHTGVPEGTSYRWYRDGQPLQESTSATLRFAAITLTQAGAYHCQAQAPGSATTSL AAPISLHVSYAPRHVTLTTLMDTGPGRLGLLLCRVDSDPPAQLRLLHGDRLVASTLQG VGGPEGSSPRLHVAVAPNTLRLEIHGAMLEDEGVYICEASNTLGQASASADFDAQAVN VQVWPGATVREGQLVNLTCLVWTTHPAQLTYTWYQDGQQRLDAHSIPLPNVTVRDATS YRCGVGPPGRAPRLSRPITLDVLYAPRNLRLTYLLESHGGQLALVLCTVDSRPPAQLA LSHAGRLLASSTAASVPNTLRLELRGPQPRDEGFYSCSARSPLGQANTSLELRLEGVR
VILAPEAAVPEGAPITVTCADPAAHAPTLYTWYHNGRWLQEGPAASLSFLVATRAHA G AYSCQAQDAQGTRSSRPAALQVLYAPQDAVLSSFRDSRARSMAVIQCTVDSEPPAELA LSHDGKVLATSSGVHSLASGTGHVQVARNALRLQVQDVPAGDDTYVCTAQNLLGSIST IGRLQVEGARVVAEPGLDVPEGAALNLSCRLLGGPGPVGNSTFAWFWNDRRLHAEPVP TLAFTHVARAQAGMYHCLAELPTGAAASAPVMLRVLYPPKTPTMMVFVEPEGGLRGIL DCRVDSEPLASLTLHLGSRLVASSQPQGAPAEPHIHVLASPNALRVDIEALRPSDQGE YICSASNVLGSASTSTYFGVRALHRLHQFQQLLWVLGLLVGLLLLLLGLGACYTWRRR RVCKQSMGENSVEMAFQKETTQLIDPDAATCETSTCAPPLG Sequence ID No. 10 is a nucleotide sequence encoding mouse sialoadhesin identified by GenBank Accession number NM_023068. Sequence ID No. 10:
1 atgggcttct tgcccaagct tctcctcctg gcctcattct tcccagcagg ccaggcctca
61 tggggcgtct ccagtcccca ggacgtgcag ggtgtgaagg ggtcttgcct gcttatcccc 121 tgcatcttca gcttccctgc cgacgtggag gtgcccgacg gcatcacggc catctggtac
181 tacgactact cgggccagcg gcaggtggtg agccactcgg cggaccccaa gctggtggag
241 gcccgcttcc gcggccgcac cgagttcatg gggaaccccg agcacagggt gtgcaacctg
301 ctgctgaagg acctgcagcc cgaggactct ggttcctaca acttccgctt cgagatcagt
361 gaggtcaacc gctggtcaga tgtgaaaggc accttggtca cagtaacaga ggagcccagg 421 gtgcccacca ttgcctcccc ggtggagctt ctcgagggca cagaggtgga cttcaactgc
481 tccactccct acgtatgcct gcaggagcag gtcagactgc agtggcaagg ccaggaccct
541 gctcgctctg tcaccttcaa cagccagaag tttgagccca ccggcgtcgg ccacctggag
601 accctccaca tggccatgtc ctggcaggac cacggccgga tcctgcgctg ccagctctcc
661 gtggccaatc acagggctca gagcgagatt cacctccaag tgaagtatgc ccccaagggt 721 gtgaagatcc tcctcagccc ctcggggagg aacatccttc caggtgagct ggtcacactc
781 acctgccagg tgaacagcag ctaccctgca gtcagttcca ttaagtggct caaggatggg
841 gtacgcctcc aaaccaagac tggtgtgctg cacctgcccc aggcagcctg gagcgatgct
901 ggcgtctaca cctgccaagc tgagaacggc gtgggctctt tggtctcacc ccccatcagc
961 ctccacatct tcatggctga ggtccaggtg agcccagcag gtcccatcct ggagaaccag 1021 acagtgacac tagtctgcaa cacacccaat gaggcaccca gtgatctccg ctacagctgg
1081 tacaagaacc atgtcctgct ggaggatgcc cactcccata ccctccggct gcacttggcc
1141 actagggctg atactggctt ctacttctgt gaggtgcaga acgtccatgg cagcgagcgc
1201 tcgggccctg tcagcgtggt agtcaaccac ccgcctctca ctccagtcct gacagccttc
1261 ctggagaccc aggcgggact tgtgggcatc cttcactgct ctgtggtcag tgagcccctg 1321 gccacactgg tgctgtcaca tgggggtcat atcctggcct ccacctccgg ggacagtgat
1381 cacagcccac gcttcagtgg tacctctggt cccaactccc tgcgcctgga gatccgagac
1441 ctggaggaaa ctgacagtgg ggagtacaag tgctcagcca ccaactccct tggaaatgca
1501 acctccaccc tggacttcca tgccaatgcc gcccgtctcc tcatcagccc ggcagccgag
1561 gtggtggaag gacaggcagt gacactgagc tgcagaagcg gcctaagccc cacacctgat 1621 gcccgcttct cctggtacct gaatggagcc ctgcttcacg agggtcccgg cagcagcctc
1681 ctgctccccg cggcctccag cactgacgcc ggctcatacc actgccgggc ccgggacggc
1741 cacagtgcca gtggcccctc ttcgccagct gttctcactg tgctctaccc ccctcgacaa
1801 ccaacattca ccaccaggct ggaccttgat gccgctgggg ccggggctgg acggcgaggc 1861 ctccttttgt gccgtgtgga cagcgacccc cccgccaggc tgcagctgct ccacaaggac
1921 cgtgttgtgg ccacttccct gccatcaggg ggtggctgca gcacctgtgg gggctgttcc
1981 ccacgcatga aggtcaccaa agcccccaac ttgctgcgtg tggagattca caaccctttg
2041 ctggaagagg agggcttgta cctctgtgag gccagcaatg ccctgggcaa cgcctccacc
2101 tcagccacct tcaatggcca ggccactgtc ctggccattg caccatcaca cacacttcag 2161 gagggcacag aagccaactt gacttgcaac gtgagccggg aagctgctgg cagccctgct
2221 aacttctcct ggttccgaaa tggggtgctg tgggcccagg gtcccctgga gaccgtgaca
2281 ctgctgcccg tggccagaac tgatgctgcc ctttacgcct gccgcatcct gactgaggct
2341 ggtgcccagc tctccactcc cgtgctcctg agtgtactct atcccccgga ccgtccaaag
2401 ctgtcagccc tcctagacat gggccagggc cacatggctc tgttcatctg cactgtggac 2461 agccgccccc tggccttgct ggccttgttc catggggagc acctcctggc caccagcctg
2521 ggtccccagg tcccatccca tggtcggttc caggctaaag ctgaggccaa ctccctgaag
2581 ttagaggtcc gagaactggg ccttggggac tctggcagct accgctgtga ggccacaaat
2641 gttcttggat catccaacac ctcactcttc ttccaggtcc gaggagcctg ggtccaggtg
2701 tcaccatcac ctgagctcca agagggccag gctgtggtcc tgagctgcca ggtacacaca 2761 ggagtcccag aggggacctc atatcgttgg tatcgggatg gccagcccct ccaggagtcg
2821 acctcggcca cgctccgctt tgcagccata actttgacac aagctggggc ctatcattgc
2881 caagcccagg ccccaggctc agccaccacg agcctagctg cacccatcag cctccacgtg
2941 tcctatgccc cacgccacgt cacactcact accctgatgg acacaggccc tggacgactg
3001 ggcctcctcc tgtgccgtgt ggacagtgac cctccggccc agctgcggct gctccacggg 3061 gatcgccttg tggcctccac cctacaaggt gtggggggac ccgaaggcag ctctcccagg
3121 ctgcatgtgg ctgtggcccc caacacactg cgtctggaga tccacggggc tatgctggag
3181 gatgagggtg tctatatctg tgaggcctcc aacaccctgg gccaggcctc ggcctcagct
3241 gacttcgacg ctcaagctgt gaatgtgcag gtgtggcccg gggctaccgt gcgggagggg
3301 cagctggtga acctgacctg ccttgtgtgg accactcacc cggcccagct cacctacaca
3361 tggtaccagg atgggcagca gcgcctggat gcccactcca tccccctgcc caacgtcaca
3421 gtcagggatg ccacctccta ccgctgcggt gtgggccccc ctggtcgggc accccgcctc 3481 tccagaccta tcaccttgga cgtcctctac gcgccccgca acctgcgcct gacctacctc
3541 ctggagagcc atggcgggca gctggccctg gtactgtgca ctgtggacag ccgcccgccc
3601 gcccagctgg ccctcagcca cgccggtcgc ctcttggcct cctcgacagc agcctctgtc
3661 cccaacaccc tgcgcctgga gctgcgaggg ccacagccca gggatgaggg tttctacagc
3721 tgctctgccc gcagccctct gggccaggcc aacacgtccc tggagctgcg gctggagggt 3781 gtgcgggtga tcctggctcc ggaggctgcc gtgcctgaag gtgcccccat cacagtgacc
3841 tgtgcggacc ctgctgccca cgcacccaca ctctatactt ggtaccacaa cggtcgttgg
3901 ctgcaggagg gtccagctgc ctcactctca ttcctggtgg ccacgcgggc tcatgcaggc
3961 gcctactctt gccaggccca ggatgcccag ggcacccgca gctcccgtcc tgctgccctg
4021 caagtcctct atgcccctca ggacgctgtc ctgtcctcct tccgggactc cagggccaga 4081 tccatggctg tgatacagtg cactgtggac agtgagccac ctgctgagct ggccctatct
4141 catgatggca aggtgctggc cacgagcagc ggggtccaca gcttggcatc agggacaggc
4201 catgtccagg tggcccgaaa cgccctacgg ctgcaggtgc aagatgtgcc tgcaggtgat
4261 gacacctatg tttgcacagc ccaaaacttg ctgggctcaa tcagcaccat cgggcggttg
4321 caggtagaag gtgcacgcgt ggtggcagag cctggcctgg acgtgcctga gggcgctgcc 4381 ctgaacctca gctgccgcct cctgggtggc cctgggcctg tgggcaactc cacctttgca
4441 tggttctgga atgaccggcg gctgcacgcg gagcctgtgc ccactctcgc cttcacccac
4501 gtggctcgtg ctcaagctgg gatgtaccac tgcctggctg agctccccac tggggctgct
4561 gcctctgctc cagtcatgct ccgtgtgctc taccctccca agacgcccac catgatggtc
4621 ttcgtggagc ctgagggtgg cctccggggc atcctggatt gccgagtgga cagcgagccg 4681 ctcgccagcc tgactctcca ccttggcagt cgactggtgg cctccagtca gccccagggt
4741 gctcctgcag agccacacat ccatgtcctg gcttccccca atgccctgag ggtggacatc
4801 gaggcgctga ggcccagcga ccaaggggaa tacatctgtt ctgcctcaaa tgtcctgggc
4861 tctgcctcta cctccaccta ctttggggtc agagccctgc accgcctgca tcagttccag
4921 cagctgctct gggtcctggg actgctggtg ggcctcctgc tcctgctgtt gggcctgggg
4981 gcctgctaca cctggagaag gaggcgtgtt tgtaagcaga gcatgggcga gaattcggtg
5041 gagatggctt ttcagaaaga gaccacgcag ctcattgatc ctgatgcagc cacatgtgag 5101 acctcaacct gtgccccacc cctgggctga ccagtggtgt tgcctgccct ccggaggaga
5161 aagtggccag aatctgtgat gactccagcc tatgaatgtg aatgaggcag tgttgagtcc
5221 tgcccgcctc tacgaaaaca gctctgtgac atctgacttt ttatgacctg gccccaagcc
5281 tcttgccccc ccaaaaatgg gtggtgagag gtctgcccag gagggtgttg accctggagg
5341 acactgaaga gcactgagct gatctcgctc tctcttctct ggatctcctc ccttctctcc 5401 atttctccct caaaggaagc cctgcccttt cacatccttc tcctcgaaag tcaccctgga
5461 ctttggttgg attgcagcat cctgcatcct cagaggctca ccaaggcatt ctgtattcaa
5521 cagagtatca gtcagcctgc tctaacaaga gaccaaatac agtgacttca acatgataga
5581 attttatttt tctctcccac gctagtctgg ctgttacgat ggtttatgat gttggggctc
5641 aggatccttc tatcttcctt ttctctatcc ctaaaatgat gcctttgatt gtgaggctca 5701 ccatggcccc gctttgtcca catgccctcc agccagaaga aggaagagtg gaggtagaag
5761 cacacccatg cccatggtgg acgcaactca gaagctgcac aggacttttc cactcacttc
5821 ccattggctg gagtattgtc acatggctac tgcaagctac aagggagact gggaaatgta
5881 gtttttattt tgagtccaga ggacatttgg aattggactt ccaaaggact cccaactgtg
5941 agctcatccc tgagactttt gacattgttg ggaatgccac cagcaggcca tgttttgtct 6001 cagtgcccat ctactgaggg ccagggtgtg cccctggcca ttctggttgt gggcttcctg
6061 gaagaggtga tcactctcac actaagactg aggaaataaa aaaggtttgg tgttttccta
6121 gggagagagc atgccaggca gtggagttgc ctaagcagac atccttgtgc cagatttggc
6181 ccctgaaaga agagatgccc tcattcccac caccaccccc cctaccccca gggactgggt
6241 actaccttac tggcccttac aagagtggag ggcagacaca gatgttgtca gcatccttat 6301 tcctgctcca gatgcatctc tgttcatgac tgtgtgagct cctgtccttt tcctggagac
6361 cctgtgtcgg gctgttaaag agaatgagtt accaagaagg aatgacgtgc ccctgcgaat
6421 cagggaccaa caggagagag ctcttgagtg ggctagtgac tccccctgca gcctggtgga
6481 gatggtgtga ggagcgaaga gccctctgct ctaggatttg ggttgaaaaa cagagagaga
6541 agtggggagt tgccacagga gctaacacgc tgggaggcag ttgggggcgg gtgaactttg
6601 tgtagccgag gccgcaccct ccctcattcc aggctcattc attttcatgc tccattgcca
6661 gactcttgct gggagcccgt ccagaatgtc ctcccaataa aactccatcc tatgacgcaa 6721 aaaaaaaaaa aaaaaa
[00350] Any p atents or publications mentioned in this specification are incorporated herein by reference to the same extent as if each individual publication is specifically and individually indicated to be incorporated by reference. Protein and nucleic acid sequences identified by a database accession number are incorporated herein by reference in their entirety. This application claims priority to U.S. Provisional Patent Application Serial No. 60/799,566, filed May 11 , 2006, the entire content of which is incorporated herein by reference.
[00351] The compositions and methods described herein are presently representative of preferred embodiments, exemplary, and not intended as limitations on the scope of the invention. Changes therein and other uses will occur to those skilled in the art. Such changes and other uses can be made without departing from the scope of the invention as set forth in the claims.