Treating Allergic Airway Disorders Using Anti-IL-20 Receptor Antibodies

BACKGROUND OF THE INVENTION IL-20 receptor is a dimeric complex containing subunits IL-20R1 and IL-20R2 (also known as RA and RB). Human IL-20R1 and IL-20R2 are disclosed under GenBank accession numbers NP_055247 (protein)/NM_014432.2 (mRNA) and NP_653318

(protein)/NM_144717 (mRNA), respectively. This IL-20 receptor is a common receptor for three functionally different cytokines, i.e., IL-19, IL-20, and IL-24, suggesting that it can mediate different signaling pathways when triggered by different cytokines.

Allergic airway diseases are allergic diseases of the airways, including asthma, allergic rhinitis, and allergic pneumonia. Asthma is a common chronic inflammatory disease of the airways characterized by reversible airflow obstruction, bronchospasm, and other recurring symptoms. Asthma patients often suffer from wheezing, coughing, chest tightness, and shortness of breath. While long-term control medications and quick-relief medications are available for treating asthma, there is currently no cure for this disease.

SUMMARY OF THE INVENTION

The present disclosure is based on the unexpected discoveries that (a) IL-20 receptor Rl (IL-20R1) knock-out mice were protected from developing asthma when challgened with allergens, and (b) an antibody specifically binding to human IL-20R1 successfully reduced the levels of IL-13 and IgE in mice challenged with allergen Der P and reduced the amounts of eosinophil and neutrophil cells in the bronchoalveolar lavage fluid (BALF) of such mice. These results suggest that antibodies binding to IL-20 receptor, e.g., anti-IL-20Rl antibodies, can reduce allergic responses in the airway, thereby being effective in treating allergic airway diseases such as asthma.

Accordingly, disclosed herein are methods for treating an allergic airway disorder (e.g., asthma or bronchial airway obstruction), the method comprising administering to a subject in need thereof (e.g., a human patient having, suspected of having, or at risk for the disorder) an effective amount of an antibody that binds an IL-20 receptor and neutralizes its activity. Such an antibody can be an anti-IL-20Rl antibody.

In some embodiments, the anti-IL-20Rl can comprise: (a) a heavy chain variable region (V _H ) that includes a V _H CDR1, a V _H CDR2, and a V _H CDR3 at least 85% (e.g., 90%, 95, or 98%) identical to the V _H CDR1, V _H CDR2, and V _H CDR3 of monoclonal antibody mAb51D or mAb7GW, respectively, and (b) a light chain variable region (V _L ) that includes a V _L CDRl, a V _L CDR2, and a V _L CDR3 at least 85% (e.g., 90%, 95%, or 98%) identical to the V _L CDRl, V _L CDR2, and V _L CDR3 of mAb51D or mAb7GW, respectively.

In other embodiments, the anti-IL-20Rl antibody can comprise (a) a V _H that includes up to 5 amino acid variations (e.g., 1, 2, 3, 4, or 5 amino acid residue substitutions) in V _H CDRs as compared to the V _H CDRS of mAb51D or mAb7GW, and (b) a V _L that includes up to 5 amino acid variations (e.g., 1, 2, 3, 4, or 5 amino acid residue substitutions) in V _L CDRS as compared to the V _L CDRs of mAb5 ID or mAb7GW.

In one example, the anti-IL-20Rl antibody comprises a V _H that includes the same V _H CDRs as those of mAb51D or mAb7GW, a V _L that includes the same V _L CDRS as those of mAb51D or mAb7GW, or both.

Any of the antibodies described herein, e.g., the anti-IL-20Rl antibody as described above, can be a full-length antibody or an antigen-binding fragment thereof, e.g., Fab, F(ab') ₂ , Fab', or Fv. Alternatively, the antibody can be a humanized antibody, a chimeric antibody, or a single-chain antibody.

Also within the scope of the present disclosure are (a) pharmaceutical compositions for use in treating an allergic airway disorder such as asthma or bronchial airway obstruction, the composition comprising any of the antibodies described herein (e.g., an anti-IL-20Rl antibody as disclosed above) and a pharmaceutically acceptable carrier, and (b) use of the just-noted pharmaceutical composition in manufacturing a medicament for treating an allergic airway disease such as asthma or bronchial airway obstruction.

The details of one or more embodiments of the invention are set forth in the description below. Other features or advantages of the present invention will be apparent from the following drawings and detailed description of several embodiments, and also from the appended claims.

BRIEF DESCRIPTION OF THE DRAWINGS

The drawings are first described. Fig. 1 is a chart showing the total cell number in the bronchoalveolar lavage fluid (BALF) of wild-type (WT) and IL-20Rl-knock out (KO) mice.

Fig. 2 is a chart showing the levels of IgE (panel A) and IL-13 (panel B) in WT and KO mice.

Figure 3 is a chart showing the effects of mAb51D in reducing the numbers of total cells (panel A), eosinophil (panel B), and neutrophil (panel C) in the BALF of mice challenged with allergen Der P.

Figure 4 is a chart showing the effects of mAb51D in reducing the serum levels of IgE (panel A) and IL-13 in mice challenged with allergen Der P (panel B).

Figure 5 is a schematic illustration showing the procedure of establishing a mouse allergy model.

BRIEF DESCRIPTION OF THE SEQUENCES

SEQ ID NO: 1 is the amino acid sequence of the heavy chain of monoclonal antibody mAb7GW (precursor form, which includes the signal peptide).

SEQ ID NO:2 is the nucleotide sequence encoding the heavy chain of monoclonal antibody mAb7GW (precursor form, which includes the signal peptide).

SEQ ID NO:3 is the amino acid sequence of the light chain of monoclonal antibody mAb7GW (precursor form, which includes the signal peptide).

SEQ ID NO:4 is the nucleotide sequence encoding the light chain of monoclonal antibody mAb7GW (precursor form, which includes the signal peptide).

SEQ ID NO:5 is the amino acid sequence of the heavy chain of monoclonal antibody mAb51D (precursor form, which includes the signal peptide).

SEQ ID NO:6 is the nucleotide sequence encoding the heavy chain of monoclonal antibody mAb51D (precursor form, which includes the signal peptide).

SEQ ID NO:7 is the amino acid sequence of the light chain of monoclonal antibody mAb51D (precursor form, which includes the signal peptide).

SEQ ID NO: 8 is the nucleotide sequence encoding the light chain of monoclonal antibody mAb51D (precursor form, which includes the signal peptide). DETAILED DESCRIPTION OF THE INVENTION

The present disclosure is based on the unexpected discovery that an anti-IL-20Rl antibody, which was found to interfere with both the IL-19 and the IL-20 signaling pathways, successfully suppressed allergic responses in the airway of mice challenged by an allergen. Accordingly, disclosed herein are methods for treating allergic airway diseases, such as asthma, allergic rhinitis, allergic pneumonia, and bronchial airway obstruction, with an effective amount of an anti-IL-20Rl antibody. In some embodiments, this antibody binds (e.g., specifically) human IL-20R1 and interferes with the signaling pathway mediated by IL- 19 and/or IL-20. General Techniques

The practice of the present invention will employ, unless otherwise indicated, conventional techniques of molecular biology (including recombinant techniques), microbiology, cell biology, biochemistry and immunology, which are within the skill of the art. Such techniques are explained fully in the literature, such as, Molecular Cloning: A Laboratory Manual, second edition (Sambrook, et al., 1989) Cold Spring Harbor Press;

Oligonucleotide Synthesis (M. J. Gait, ed., 1984); Methods in Molecular Biology, Humana Press; Cell Biology: A Laboratory Notebook (J. E. Cellis, ed., 1998) Academic Press; Animal Cell Culture (R. I. Freshney, ed., 1987); Introduction to Cell and Tissue Culture (J. P. Mather and P. E. Roberts, 1998) Plenum Press; Cell and Tissue Culture: Laboratory Procedures (A. Doyle, J. B. Griffiths, and D. G. Newell, eds., 1993-8) J. Wiley and Sons; Methods in

Enzymology (Academic Press, Inc.); Handbook of Experimental Immunology (D. M. Weir and C. C. Blackwell, eds.); Gene Transfer Vectors for Mammalian Cells (J. M. Miller and M. P. Calos, eds., 1987); Current Protocols in Molecular Biology (F. M. Ausubel, et al., eds., 1987); PCR: The Polymerase Chain Reaction, (Mullis, et al., eds., 1994); Current Protocols in Immunology (J. E. Coligan et al., eds., 1991); Short Protocols in Molecular Biology

(Wiley and Sons, 1999); Immunobiology (C. A. Janeway and P. Travers, 1997); Antibodies (P. Finch, 1997); Antibodies: a practical approach (D. Catty., ed., IRL Press, 1988-1989); Monoclonal antibodies: a practical approach (P. Shepherd and C. Dean, eds., Oxford

University Press, 2000); Using antibodies: a laboratory manual (E. Harlow and D. Lane (Cold Spring Harbor Laboratory Press, 1999); The Antibodies (M. Zanetti and J. D. Capra, eds., Harwood Academic Publishers, 1995).

Anti-IL-20R Antibodies

The antibodies to be used in the methods described herein includes intact (full-length) immunoglobulin molecules, e.g., IgG, IgA, IgD, IgE, and IgM, antigen binding fragments 5 thereof, e.g., Fab, F(ab') ₂ , Fab', and Fv, and genetically engineered antibody molecules, e.g., chimeric antibody, humanized antibody, scFv (single chain antibody), dAb (domain antibody; see Ward, et. al. (1989) Nature, 341: 544), and bi-specific antibody (e.g., capable of binding to both IL-20R1 and IL-19).

In some embodiments, the antibody used in the methods described herein an antibody l o having the same heavy chain and light chain variable regions (V _H and V _L ) as those of

monoclonal antibody mAb7GW or mAb51D, the monoclonal antibodies, an antigen-binding fragment thereof, or a functional equivalent of either mAb7GW or mAb51D. Shown below are the amino acid sequences of the heavy chains and light chains of mAb7GW and mAb51D, as well as their encoding nucleotide sequences.

15 Heavy Chain of mAb7GW:

Amino Acid Sequence (SEQ ID NO:l)

MRVLILLWLFTAFPGILSV VQLQESGPGLVKPSQSLSLTCTVTGYSI

Signal peptide

20 TSDYAWNWIROFPGNRLEWMGYIDYSGSTKYNPSLKSRISVTRD

CDR1 CDR2

TSKNQFFLQLNSVTTEDTATYYC ARMGDAYWG QGTLVTVSAA ^"

CDR3

25

TTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGV HTFPA VLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIV PRDCGCKPCICTVPEVSSVFIFPPKPKD VLTITLTPKVTCVVVDISKD DPEVQFSWFVDDVEVHTA QTQPREEQFNSTFRSVSELPIMHQDWLN

30 GKEFKCR VNSAA FPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDK VSLTCMITDFFPEDITVEWQ WNGQPAENYKNTQPIMDTDGSYFVYSK LNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK (The italic region refers to the heavy chain constant region.)

35 Nucleotide Sequence (SEQ ID NO:2) ATGAGAGTGCTGATTCTTTTGTGGCTGTTCACAGCCTTTCCTGGTATCCTGTCTGTTGTG CAGC Signal peptide

TTCAGGAGTCGGGACCTGGCCTGGTGAAACCTTCTCAGTCTCTGTCCCTCACCTGCACTG TCACTGGCTACTCAATCACCAGTGATTATGCCTGGAACTGGATCCGGCAGTTTCCAGGA

CDR1

AACAGACTGGAGTGGATGGGCTACATAGACTACAGTGGTAGCACTAAATACAACCCC

CDR2

TCTCTCAAAAGTCGAATCTCTGTCACTCGAGACACATCCAAGAACCAGTTCTTCCTG CA GTTGAATTCTGTGACTACTGAGGACACAGCCACATATTACTGTGCAAGAGACTTTGGTG

CDR3

ATGCTTACTGGGGCC AGGGGACTCTGGTC ACTGTCTCTGC AGCCA A CGA CA CCCCCA T CTGTCTATCCACTGGCCCCTGGATCTGCTGCCCAAACTAACTCCATGGTGACCCTGGGAT GCC TGGTCAAGGGCTA TTTCCCTGAGCCAGTGA CA GTGA CCTGGAA CTCTGGA TCCCTGTCCAGCG GTGTGCACACCTTCCCAGCTGTCCTGCAGTCTGACCTCTACACTCTGAGCAGCTCAGTGA CTGT CCCCTCCAGCA CCTGGCCCAGCGAGA CCGTCA CCTGCAA CGTTGCCCA CCCGGCCAGCA GCA CCAAGGTGGACAAGAAAATTGTGCCCAGGGATTGTGGTTGTAAGCCTTGCATATGTACAG TCCC AGAAGTA TCA TCTGTCTTCA TCTTCCCCCCAAAGCCCAAGGA TGTGCTCA CCA TTA CTCTGA CTC CTAAGGTCACGTGTGTTGTGGTAGACATCAGCAAGGATGATCCCGAGGTCCAGTTCAGCT GGT TTGTAGATGATGTGGAGGTGCACACAGCTCAAACGCAACCCCGGGAGGAGCAGTTCAACA GCA CTTTCCGCTCAGTCAGTGAACTTCCCATCATGCACCAGGACTGGCTCAATGGCAAGGAGT TCAA ATGCAGGGTCAACAGTGCAGCTTTCCCTGCCCCCATCGAGAAAACCATCTCCAAAACCAA AGG CAGACCGAAGGCTCCACAGGTGTACACCATTCCACCTCCCAAGGAGCAAATGGCCAAGGA TAA AGTCAGTCTGACCTGCATGATAACAGACTTCTTCCCTGAAGACATTACTGTGGAGTGGCA GTGG AATGGGCAGCCAGCGGAGAACTACAAGAACACTCAGCCCATCATGGACACAGATGGCTCT TAC TTCGTCTACAGCAAGCTCAATGTGCAGAAGAGCAACTGGGAGGCAGGAAATACTTTCACC TGCT CTGTGTTACATGAGGGCCTGCACAACCACCATACTGAGAAGAGCCTCTCCCACTCTCCTG GTAA ATGA (The italic region encodes the heavy chain constant region.)

Light Chain of mAb7GW:

Amino Acid Sequence (SEQ ID NO:3)

MDSOAOVLMLLLLWVSGSCGD IVMSQSPSSLAVSVGEKVTMSC KSS

Signal peptide

OSLLYSRNOKNYLAW YQLKPGQSPKLLIY WASTRES GVPDRFTG CDR1 CDR2

SGSGTDFTLTISSVKAEDLAVYYCOOYYSYPLTFGAGTKLELKRA

CDR3

DAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQN GVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPI VKSFNRNEC (The italic region refers to the light chain constant region.) Nucleotide Sequence (SEQ ID NO:4)

ATGGATTCACAGGCCCAGGTTCTTATGTTACTGCTGCTATGGGTATCTGGTTCCTGTGGG GACA

Signal peptide

TTGTGATGTCACAGTCTCCATCCTCCCTAGCTGTGTCAGTTGGAGAGAAGGTTACTATGA GCTGCAAGTCCAGTCAGAGCCTTTTATATAGTAGGAATCAAAAGAACTACTTGGCCT

CDR1

GGTACCAGCTGAAGCCAGGGCAGTCTCCTAAACTGCTGATTTACTGGGCATCCACTA GG

CDR2

GAATCTGGGGTCCCTGATCGCTTCACAGGCAGTGGATCTGGGACAGATTTCACTCTC ACC ATCAGCAGTGTGAAGGCTGAAGACCTGGCAGTTTATTACTGTCAGCAATATTATAGCTA

CDR3

TCCGCTCACGTTCGGTGCTGGGACCAAGCTGGAGCTGAAACGGGCrGArGCrGCACCA C TGTATCCATCTTCCCACCATCCAGTGAGCAGTTAACATCTGGAGGTGCCTCAGTCGTGTG CTTC TTGAA CAA CTTCTA CCCCAAA GA CA TCAA TGTCAAGTGGAA GA TTGA TGGCAGTGAA CGA CAAA ATGGCGTCCTGAACAGTTGGACTGATCAGGACAGCAAAGACAGCACCTACAGCATGAGCA GCA CCCTCA CGTTGA CCAAGGA CGAGTA TGAA CGA CA TAA CAGCTA TA CCTGTGAGGCCA CTCA CAA GACATCAACTTCACCCATTGTCAAGAGCTTCAACAGGAATGAGTGTTAG (The italic region encodes the light chain constant region.)

Heavy Chain of mAb51D:

Amino Acid Sequence (SEQ ID NO:5)

MNFGLSLIFLALILKGVOCEVOLVEAGGDLVKPGGSLKLSCAASGFSLSNYGMSWVROTP DK

Signal peptide CDR1

RLEWVASISSGGRFTSYPDSVRGRFTISRDNAKNTLYLOMSGLKSEDTAMYYCARHD GNG

CDR2 CDR3

GOYWGOGTSVTVSSAKTTPPSWPMPGSAAOTNSMWLGCLVKGYFPEPVTVTWNSGSL SSGVH TFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTV PEVSSVFIF PPKPKDVLTITLTPKVTCVWDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVS ELPIM HQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMI TDFFPE DITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNH HTEK SLSHSPGK (The italic region refers to the heavy chain constant region.)

Nucleotide Sequence (SEQ ID NO:6)

ATGAACTTCGGGCTCAGCCTGATTTTCCTTGCCCTCATTTTAAAAGGTGTCCAGTGTGAG GTGC

Signal peptide

AGCTGGTGGAGGCTGGGGGAGACTTAGTGAAGCCTGGAGGGTCCCTGAAACTCTCCTGT GCGGCCTCTGGATTCAGTTTGAGTAACTATGGCATGTCCTGGGTTCGCCAGACTCCAGA

CDR1

CAAGAGGCTGGAGTGGGTCGCAAGCATTAGTAGTGGTGGTCGTTTCACCTCCTATCC CDR2

AGACAGTGTGAGGGGGCGATTCACCATCTCCAGAGACAATGCCAAGAACACCCTGTAC CTGCAAATGAGCGGTCTGAAGTCTGAGGACACAGCCATGTATTACTGTGCAAGACACGA CGGCAACGGTGGGGACTACTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCAGCCAAA CDR3

ACGACACCCCCATCTGTCTATCCACTGGCCCCTGGATCTGCTGCCCAAACTAACTCCATG GTGA CCCTGGGATGCCTGGTCAAGGGCTATTTCCCTGAGCCAGTGACAGTGACCTGGAACTCTG GAT CCCTGTCCAGCGGTGTGCACACCTTCCCAGCTGTCCTGCAGTCTGACCTCTACACTCTGA GCA GCTCAGTGACTGTCCCCTCCAGCACCTGGCCCAGCGAGACCGTCACCTGCAACGTTGCCC AC CCGGCCAGCAGCACCAAGGTGGACAAGAAAATTGTGCCCAGGGATTGTGGTTGTAAGCCT TGC ATATGTACAGTCCCAGAAGTATCATCTGTCTTCATCTTCCCCCCAAAGCCCAAGGATGTG CTCA CCATTACTCTGACTCCTAAGGTCACGTGTGTTGTGGTAGACATCAGCAAGGATGATCCCG AGGT CCAGTTCAGCTGGTTTGTAGATGATGTGGAGGTGCACACAGCTCAGACGCAACCCCGGGA GGA GCAGTTCAACAGCACTTTCCGCTCAGTCAGTGAACTTCCCATCATGCACCAGGACTGGCT CAAT GGCAAGGAGTTCAAATGCAGGGTCAACAGTGCAGCTTTCCCTGCCCCCATCGAGAAAACC ATC

TCCAAAACCAAAGGCAGACCGAAGGCTCCACAGGTGTACACCATTCCACCTCCCAAG GAGCAG ATGGCCAAGGATAAAGTCAGTCTGACCTGCATGATAACAGACTTCTTCCCTGAAGACATT ACTG TGGAGTGGCAGTGGAATGGGCAGCCAGCGGAGAACTACAAGAACACTCAGCCCATCATGG AC ACAGATGGCTCTTACTTCGTCTACAGCAAGCTCAATGTGCAGAAGAGCAACTGGGAGGCA GGA AATACTTTCACCTGCTCTGTGTTACATGAGGGCCTGCACAACCACCATACTGAGAAGAGC CTCT CCCACTCTCCTGGTAAATGA (The italic region encodes the heavy chain constant region.)

Light Chain of mAb51D:

Amino Acid Sequence (SEQ ID NO:7)

MDFOVOIFSFLLISASVIMSRGOIVLSOFPAILSASPGEKVTMTCRARSSVSFMHWY OOKPGS

Signal peptide CDR1

SPKPWIYATSNLASGVPPRFSGSGSGTSYSLTISRVEAEDAATYYCOOWSSNPYTFG GGTKLE

CDR2 CDR3

lKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNS WTDQDSKDST YSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

(The italic region refers to the light chain constant region)

Nucleotide Sequence (SEQ ID NO: 8)

ATGGATTTTCAAGTGCAGATTTTCAGCTTCCTGCTAATCAGTGCTTCAGTCATAATG TCCA

Signal peptide

GAGGACAAATTGTTCTCTCCCAGTTTCCAGCAATCCTGTCTGCATCTCCAGGGGAGAAGG TCACAATGACTTGCAGGGCCAGGTCAAGTGTAAGTTTCATGCACTGGTACCAGCAGAA CDRl

GCCAGGATCCTCCCCCAAACCCTGGATTTATGCCACATCCAACCTGGCTTCTGGAGTCC

CDR2

CTCCTCGCTTCAGTGGCAGTGGGTCTGGGACCTCTTACTCTCTCACAATCAGCAGAGTGG AGGCTGAAGATGCTGCCACTTATTACTGCCAGCAGTGGAGTAGTAACCCATACACGTTC

CDR3

GGAGGGGGGACT A AGCTGGA A AT A A A ACGGGCTGA TGCTGCA CCAA CTGTA TCCA TCTTCC

CACCATCCAGTGAGCAGTTAACATCTGGAGGTGCCTCAGTCGTGTGCTTCTTGAACA ACTTCTA

CCCCAAAGA CA TCAA TGTCAAGTGGAAGA TTGA TGGCAGTGAA CGA CAAAA TGGCGTCCTGAA

CAGTTGGACTGATCAGGACAGCAAAGACAGCACCTACAGCATGAGCAGCACCCTCAC GTTGAC

CAA GGA CGAGTA TGAA CGA CA TAA CAGCTA TA CCTGTGA GGCCA CTCA CAA GA CA TCAA CTTCA

CCCATTGTCAAGAGCTTCAACAGGAATGAGTGTTAG

(The italic region encodes the light chain constant region.)

A functional equivalent of mAb7GW or mAb51D has the same epitope-binding specificity as mAb7GW or mAb5 ID and exhibits at least 20% (e.g., 30%, 40%, 50%, 60%, 70%, 80%, 90%, or greater) of the activity of neutralizing a signaling pathway mediated by IL-19 and/or IL-20 as relative to mAb7GW or mAb51D. In some embodiments, a functional equivalent of mAb7GW or mAb51D contains the same regions/residues responsible for antigen-binding as mAb7GW or mAb51D, such as the same specificity-determining residues in the CDRs or the whole CDRs. The regions/residues that are responsible for antigen- binding can be identified from amino acid sequences of the heavy chain/light chain sequences of mAb7GW or mAb51D (shown above) by methods known in the art. See, e.g.,

www.bioinf.org.uk/abs;, Almagro, J. Mol. Recognit. 17: 132-143 (2004); and Chothia et al., J. Mol. Biol. 227:799-817 (1987).

In some examples, a functional equivalent (variant) of mAb7GW or mAb51D comprises a V _H chain that includes a V _H CDRl, V _H CDR2, and V _H CDR3 at least 75% (e.g., 80%, 85%, 90%, 95%, or 98%) identical to the corresponding V _H CDRs of mAb7GW or mAb51D, and a V _L chain that includes a V _L CDRl, V _L CDR2, and V _L CDR3 at least 75% (e.g., 80%, 85%, 90%, 95%, or 98%) identical to the corresponding V _H CDRs of mAb7GW or mAb51D.

Alternatively, the functional equivalent of mAb7GW or mAb51D comprises a V _H chain at least 75% (e.g., 80%, 85%, 90%, 95%, or 98%) identical to the V _H chain (mature or precursor) of mAb7GW or mAb51D and a V _L chain at least 75% (e.g., 80%, 85%, 90%, 95%, or 98%) identical to the V _L chain (mature of precursor) of mAb7GW or mAb51D.

The "percent identity" of two amino acid sequences is determined using the algorithm of Karlin and Altschul Proc. Natl. Acad. Set USA 87:2264-68, 1990, modified as in Karlin and Altschul Proc. Natl. Acad. Sci. USA 90:5873-77, 1993. Such an algorithm is

incorporated into the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. J. Mol. Biol. 215:403-10, 1990. BLAST protein searches can be performed with the XBLAST program, score=50, wordlength=3 to obtain amino acid sequences homologous to the protein molecules of interest. Where gaps exist between two sequences, Gapped BLAST can be utilized as described in Altschul et al, Nucleic Acids Res. 25(17):3389-3402, 1997. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST and NBLAST) can be used.

In other examples, a functional equivalent of mAb7GW or mAb51D comprises a V _H chain that includes up to 5 (e.g., 1, 2, 3, 4, or 5) amino acid residue variations in the V _H CDR regions (V _H CDR1 , CDR2, and/or CDR3) as compared to the V _H CDRs of mAb7GW or mAb51D, and/or a V _L chain that includes up to 5 (e.g., 1, 2, 3, 4, or 5) amino acid residue variations in the V _L CDR regions (V _L CDRl, CDR2, and/or CDR3) as compared to the V _H CDRs of mAb7GW or mAb51D.

A functional equivalent of mAb7GW or mAb51D can be a genetically engineered antibody derived from one of the monoclonal antibodies (e.g., chimeric, single-chain, or humanized) via, e.g., routine recombinant technology.

Any of the anti-IL-20Rl antibodies described herein can be either monoclonal or polyclonal. A "monoclonal antibody" refers to a homogenous antibody population and a "polyclonal antibody" refers to a heterogenous antibody population. These two terms do not limit the source of an antibody or the manner in which it is made.

In one example, the anti-IL-20Rl antibody is a humanized antibody. A humanized antibody contains a human immunoglobulin (i.e., recipient antibody) in which

regions/residues responsible for antigen binding (e.g.., the complementarity determining regions, particularly the specificity-determining residues therein) are replaced with those from a non-human immunoglobulin (i.e., donor antibody). Methods to identify regions/residues in the heavy and light chains of an antibody are well known in the art. See, e.g., Almagro, J. Mol. Recognit. 17: 132-143 (2004); and Chothia et al., J. Mol. Biol.

227:799-817 (1987). In some instances, one or more residues inside a framework region of the recipient antibody are also replaced with those from the donor antibody. A humanized antibody may also contain residues from neither the recipient antibody nor the donor antibody. These residues are included to further refine and optimize antibody performance.

In another example, the anti-IL-20Rl antibody described herein is a chimeric antibody, which can include a heavy constant region and a light constant region from a human antibody. A chimeric antibody has a variable region or part of variable region from a first species and a constant region from a second species. Typically, in these chimeric antibodies, the variable region of both light and heavy chains mimics the variable regions of antibodies derived from one species of mammals (e.g., a non-human mammal), while the constant portions are homologous to the sequences in antibodies derived from another (e.g., human). In some embodiments, amino acid modifications can be made in the variable region and/or the constant region.

Methods of making various types of antibodies (e.g., monoclonal and polyclonal antibodies, antigen-binding fragments thereof, and genetically engineered antibodies), are well known in the art. See, for example, Harlow and Lane, (1988) Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, New York.

In general, to produce antibodies against a protein (e.g., IL-20R1 or IL-20R2), the protein or a fragment thereof, optionally coupled to a carrier protein, such as KLH, can be mixed with an adjuvant, and injected into a host animal. Antibodies produced in the animal can then be purified by peptide affinity chromatography. Commonly employed host animals include rabbits, mice, guinea pigs, and rats. Various adjuvants that can be used to increase the immunological response depend on the host species and include Freund's adjuvant

(complete and incomplete), mineral gels such as aluminum hydroxide, CpG, surface-active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanin, and dinitrophenol. Useful human adjuvants include BCG (bacille Calmette-Guerin) and Corynebacterium parvum.

Polyclonal antibodies are present in the sera of the immunized subjects. Monoclonal antibodies can be prepared using standard hybridoma technology (see, for example, Kohler et al. (1975) Nature 256, 495; Kohler et al. (1976) Eur. J. Immunol. 6, 511; Kohler et al. (1976) Eur J Immunol 6, 292; and Hammerling et al. (1981) Monoclonal Antibodies and T Cell Hybridomas, Elsevier, N.Y.). In particular, monoclonal antibodies can be obtained by any technique that provides for the production of antibody molecules by continuous cell lines in culture such as described in Kohler et al. (1975) Nature 256, 495 and U.S. Patent No.

4,376,110; the human B-cell hybridoma technique (Kosbor et al. (1983) Immunol Today 4, 72; Cole et al. (1983) Proc. Natl. Acad. Sci. USA 80, 2026, and the EBV hybridoma technique (Cole et al. (1983) Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc., pp. 77-96). Such antibodies can be of any immunoglobulin class including IgG, IgM, IgE, IgA, IgD, and any subclass thereof. The hybridoma producing the monoclonal antibodies disclosed herein may be cultivated in vitro or in vivo. The ability to produce high titers of monoclonal antibodies in vivo makes it a particularly useful method of production.

Antigen-binding fragments of the just-mentioned IL-20 receptor neutralizing antibody can be prepared via routine methods. For example, F(ab') ₂ fragments can be produced by pepsin digestion of an antibody molecule, and Fab fragments that can be generated by reducing the disulfide bridges of F(ab') ₂ fragments.

Genetically engineered antibodies, such as humanized antibodies, chimeric antibodies, single-chain antibodies, and bi-specific antibodies, can be produced via conventional recombinant technology. Techniques developed for the production of

"chimeric antibodies" can be used. See, e.g., Morrison et al. (1984) Proc. Natl. Acad. Sci. USA 81, 6851; Neuberger et al. (1984) Nature 312, 604; and Takeda et al. (1984) Nature 314:452.

Antibodies can also be humanized by methods known in the art. For example, a humanized antibodies can be designed as follows. First, the variable regions of V _H and V _L of a parent non-human antibody are subjected to three-dimensional molecular modeling analysis following methods known in the art. See, e.g., Queen et al., Proc. Natl. Acad. Sci. USA, 86: 10029-10033 (1989). Next, framework amino acid residues predicted to be important for the formation of the correct CDR structures are identified using the same molecular modeling analysis. In parallel, human V _H and V _L chains having amino acid sequences that are homologous to those of the parent non-human antibody are identified from any antibody gene database using the parent V _H and V _L sequences as search queries. Human V _H and V _L acceptor genes are then selected. The CDR regions within the selected human acceptor genes can be replaced with the CDR regions from the parent non-human antibody or functional 5 variants thereof. When necessary, residues within the framework regions of the parent chain that are predicted to be important in interacting with the CDR regions (see above description) can be used to substitute for the corresponding residues in the human acceptor genes.

A single-chain antibody can be prepared via recombinant technology by linking a nucleotide sequence coding for a heavy chain variable region and a nucleotide sequence o coding for a light chain variable region. Preferably, a flexible linker is incorporated between the two variable regions. Alternatively, techniques described for the production of single chain antibodies (U.S. Patent Nos. 4,946,778 and 4,704,692) can be adapted to produce a phage scFv library and scFv clones specific to IL-20R1 or IL-20R2 can be identified from the library following routine procedures. Positive clones can be subjected to further screening to5 identify those that suppress IL-20 receptor activity.

After obtaining antibodies specific to the target antigen, their ability to neutralize the signaling pathway mediated by IL-19 and/or IL-20 can be determined by a routine procedure. For example, the level of IL-10 secretion induced by IL-19 in peripheral blood mononuclear cells is used as an indicator of IL-19/IL-20 receptor activity. In an example, IL-20 receptor o activity can be determined by examining IL- 19-induced caspase 3 and caspase 9 cleavage in renal epithelial cells. Antibodies that specifically binding to IL-20 receptor and suppressing its activity (e.g., neutralizing IL-20 receptor activated by IL-19) are selected for use in the methods disclosed herein.

Use of Anti-IL-20R antibodies for Treating Allergic Airway Diseases

5 Any of the anti-IL-20R antibodies described herein can be formulated into a

pharmaceutical composition, which further comprises one or more pharmaceutically acceptable carriers. "Acceptable" means that the carrier must be compatible with the active ingredient of the composition (and preferably, capable of stabilizing the active ingredient) and not deleterious to the subject to be treated. Suitable carriers include microcrystalline 0 cellulose, mannitol, glucose, defatted milk powder, polyvinylpyrrolidone, and starch, or a combination thereof.

The pharmaceutically acceptable carriers, excipients, or stabilizers suitable for use in preparation of the just-noted pharmaceutical compositions can be in the form of lyophilized formulations or aqueous solutions. Remington: The Science and Practice of Pharmacy 20th Ed. (2000) Lippincott Williams and Wilkins, Ed. K. E. Hoover. They may comprise buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride;

hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol;

cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrans; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants such as TWEEN™, PLURONICS™ or polyethylene glycol (PEG).

The pharmaceutical compositions as described herein can be formulated for storage by mixing an antibody having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers mentioned above.

In some examples, the pharmaceutical compositions comprise liposomes

encapsulating any of the antibodies described herein. Such liposomes can be prepared by methods known in the art. See, e.g., Epstein, et al., Proc. Natl. Acad. Sci. USA 82:3688 (1985); Hwang, et al., Proc. Natl. Acad. Sci. USA 77:4030 (1980); and U.S. Pat. Nos.

4,485,045 and 4,544,545. Liposomes with enhanced circulation time are disclosed in U.S.

Pat. No. 5,013,556. Particularly useful liposomes can be generated by the reverse phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol and PEG-derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter.

The active ingredients (e.g., the antbody) may also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in

macroemulsions. Such techniques are disclosed in Remington, The Science and Practice of Pharmacy 20th Ed. Mack Publishing (2000).

In other examples, the pharmaceutical compositions can be formulated in sustained- release form. Suitable examples of sustained-release formulatons include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g. films, or microcapsules. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(v nylalcohol)), polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutamic acid and 7 ethyl-L-glutamate, non-degradable ethylene- vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOT™ (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), sucrose acetate isobutyrate, and poly-D-(-)-3-hydroxybutyric acid.

The pharmaceutical compositions to be used for in vivo administration must be sterile. This is readily accomplished by, for example, filtration through sterile filtration membranes. Therapeutic antibody compositions are generally placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.

The pharmaceutical compositions described herein can also be prepared

in unit dosage forms such as tablets, pills, capsules, powders, granules, solutions or suspensions, or suppositories, for oral, parenteral or rectal administration, or administration by inhalation or insufflation.

For preparing solid compositions such as tablets, the principal active ingredient is mixed with a pharmaceutical carrier, e.g. conventional tableting ingredients such as corn starch, lactose, sucrose, sorbitol, talc, stearic acid, magnesium stearate, dicalcium phosphate or gums, and other pharmaceutical diluents, e.g. water, to form a solid preformulation composition containing a homogeneous mixture of a compound of the present invention, or a non-toxic pharmaceutically acceptable salt thereof. When referring to these preformulation compositions as homogeneous, it is meant that the active ingredient is dispersed evenly throughout the composition so that the composition may be readily subdivided into equally effective unit dosage forms such as tablets, pills and capsules. This solid preformulation 5 composition is then subdivided into unit dosage forms of the type described above containing from 0.1 to about 500 mg of the active ingredient of the present invention. The tablets or pills of the novel composition can be coated or otherwise compounded to provide a dosage form affording the advantage of prolonged action. For example, the tablet or pill can comprise an inner dosage and an outer dosage component, the latter being in the form of an o envelope over the former. The two components can be separated by an enteric layer that serves to resist disintegration in the stomach and permits the inner component to pass intact into the duodenum or to be delayed in release. A variety of materials can be used for such enteric layers or coatings, such materials including a number of polymeric acids and mixtures of polymeric acids with such materials as shellac, cetyl alcohol and cellulose acetate.

5 Suitable surface-active agents include, in particular, non-ionic agents, such as

polyoxyethylenesorbitans (e.g. Tween.TM. 20, 40, 60, 80 or 85) and other sorbitans (e.g. Span™ 20, 40, 60, 80 or 85). Compositions with a surface-active agent will conveniently comprise between 0.05 and 5% surface-active agent, and can be between 0.1 and 2.5%. It will be appreciated that other ingredients may be added, for example mannitol or other

o pharmaceutically acceptable vehicles, if necessary.

Suitable emulsions may be prepared using commercially available fat emulsions, such as Intralipid™, Liposyn™, Infonutrol™, Lipofundin™ and Lipiphysan™. The active ingredient may be either dissolved in a pre-mixed emulsion composition or alternatively it may be dissolved in an oil (e.g. soybean oil, safflower oil, cottonseed oil, sesame oil, corn oil 5 or almond oil) and an emulsion formed upon mixing with a phospholipid (e.g. egg

phospholipids, soybean phospholipids or soybean lecithin) and water. It will be appreciated that other ingredients may be added, for example glycerol or glucose, to adjust the tonicity of the emulsion. Suitable emulsions will typically contain up to 20% oil, for example, between 5 and 20%. The fat emulsion can comprise fat droplets between 0.1 and 1.0 .im, particularly 0 0.1 and 0.5 .im, and have a pH in the range of 5.5 to 8.0. The emulsion compositions can be those prepared by mixing an IL-20 antagonist with Intralipid™ or the components thereof (soybean oil, egg phospholipids, glycerol and water).

Compositions for inhalation or insufflation include solutions and suspensions in pharmaceutically acceptable, aqueous or organic solvents, or mixtures thereof, and powders. The liquid or solid compositions may contain suitable pharmaceutically acceptable excipients as set out above. In some embodiments, the compositions are administered by the oral or nasal respiratory route for local or systemic effect. Compositions in preferably sterile pharmaceutically acceptable solvents may be nebulised by use of gases. Nebulised solutions may be breathed directly from the nebulising device or the nebulising device may be attached to a face mask, tent or intermittent positive pressure breathing machine. Solution, suspension or powder compositions may be administered, preferably orally or nasally, from devices which deliver the formulation in an appropriate manner.

To practice the method disclosed herein, an effective amount of the pharmaceutical composition noted above can be administered to a subject (e.g., a human) in need of the treatment via a suitable route. The subject to be treated by the methods described herein can be a mammal, more preferably a human. Mammals include, but are not limited to, farm animals, sport animals, pets, primates, horses, dogs, cats, mice and rats. A human subject who needs the treatment may be a human patient having, at risk for, or suspected of having an allergic airway disorder, such as asthma, allergic rhinitis, allergic pneumonia, and bronchial airway obstruction. A subject having an allergic airway disorder can be identified by routine medical examination. A subject suspected of having an allergic airway disorder might show one or more symptoms of the disorder, e.g., wheezing, coughing, chest tightness, and shortness of breath. Such subjects can also be identified via routine medical examination. A subject at risk for an allergic airway disorder such as asthma can be a subject having one or more of the risk factors for that disorder. For example, risk factors associated with asthma include (a) having a family member such as a parent or sibling with asthma, (b) having allergic conditions, such as atopic dermatitis or allergic rhinitis (hay fever), (c) being overweight, (d) being a smoker or exposure to secondhand smoke, (e) Exposure to exhaust fumes or other types of pollution, (f) exposure to occupational triggers, such as chemicals used in farming, hairdressing and manufacturing, and (g) low birth weight. "An effective amount" as used herein refers to the amount of each active agent required to confer therapeutic effect on the subject, either alone or in combination with one or more other active agents. Effective amounts vary, as recognized by those skilled in the art, depending on the particular condition being treated, the severity of the condition, the

5 individual patient parameters including age, physical condition, size, gender and weight, the duration of the treatment, the nature of concurrent therapy (if any), the specific route of administration and like factors within the knowledge and expertise of the health practitioner. These factors are well known to those of ordinary skill in the art and can be addressed with no more than routine experimentation. It is generally preferred that a maximum dose of the o individual components or combinations thereof be used, that is, the highest safe dose

according to sound medical judgment. It will be understood by those of ordinary skill in the art, however, that a patient may insist upon a lower dose or tolerable dose for medical reasons, psychological reasons or for virtually any other reasons.

Empirical considerations, such as the half-life, generally will contribute to the

5 determination of the dosage. For example, antibodies that are compatible with the human immune system, such as humanized antibodies or fully human antibodies, may be used to prolong half-life of the antibody and to prevent the antibody being attacked by the host's immune system. Frequency of administration may be determined and adjusted over the course of therapy, and is generally, but not necessarily, based on treatment and/or suppression o and/or amelioration and/or delay of allergic airway disorders. Alternatively, sustained

continuous release formulations of anti-IL-20R antibodies may be appropriate. Various formulations and devices for achieving sustained release are known in the art.

In one example, dosages for an IL-20R antibody may be determined empirically in individuals who have been given one or more administration(s) of anti-IL-20R antibodies. 5 Individuals are given incremental dosages of the antibodies. To assess efficacy of the

antibodies, an indicator of the allergic airway disorder (such as serum levels of IgE and/or IL- 13) can be followed.

Generally, for administration of any of the antibodies described herein, an initial candidate dosage can be about 2 mg/kg. For the purpose of the present disclosure, a typical 0 daily dosage might range from about any of 0.1 g/kg to 3 g/kg to 30 g/kg to 300 g/kg to 3 mg/kg, to 30 mg/kg to 100 mg/kg or more, depending on the factors mentioned above. For repeated administrations over several days or longer, depending on the condition, the treatment is sustained until a desired suppression of symptoms occurs or until sufficient therapeutic levels are achieved to alleviate an allergic airway disorder (e.g., asthma) or a 5 symptom thereof. An exemplary dosing regimen comprises administering an initial dose of about 2 mg/kg, followed by a weekly maintenance dose of about 1 mg/kg of the antibody, or followed by a maintenance dose of about 1 mg/kg every other week. However, other dosage regimens may be useful, depending on the pattern of pharmacokinetic decay that the practitioner wishes to achieve. For example, dosing from one-four times a week is

o contemplated. In some embodiments, dosing ranging from about 3 g/mg to about 2 mg/kg

(such as about 3 g/mg, about 10 g/mg, about 30 g/mg, about 100 μg/mg, about 300 μg/mg, about 1 mg/kg, and about 2 mg/kg) may be used. In some embodiments, dosing frequency is once every week, every 2 weeks, every 4 weeks, every 5 weeks, every 6 weeks, every 7 weeks, every 8 weeks, every 9 weeks, or every 10 weeks; or once every month, every5 2 months, or every 3 months, or longer. The progress of this therapy is easily monitored by conventional techniques and assays. The dosing regimen (including the antibody used) can vary over time.

For the purpose of the present disclosure, the appropriate dosage of an antibody will depend on the specific antibody (or compositions thereof) employed, the type and severity of o the allergic airway disorder to be treated, whether the antibody is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the antibody, and the discretion of the attending physician. Typically the clinician will administer an IL-20R1 antibody until a dosage is reached that achieves the desired result. Administration of an antibody can be continuous or intermittent, depending, for example, 5 upon the recipient's physiological condition, whether the purpose of the administration is therapeutic or prophylactic, and other factors known to skilled practitioners. The

administration of an antibody may be essentially continuous over a preselected period of time or may be in a series of spaced dose, e.g., either before, during, or after developing an allergic airway disorder.

0 As used herein, the term "treating" refers to the application or administration of a composition including one or more active agents to a subject, who has an allergic airway disorder, a symptom of the disorder, or a predisposition toward the disorder, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect the disorder, the symptom of the disorder, or the predisposition toward the disorder.

5 In some embodiments, the antibody described herein that suppress the activation of

IL-20 receptor via IL-19 and/or IL-20 is administered to a subject in need of the treatment at an amount sufficient to reduce the level of the IL-20 receptor/IL-19-mediated signaling and/or the level of the IL-20 receptor/IL-20 -mediated signaling by at least 20% (e.g., 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater). In other embodiments, the antibody is

o administered in an amount effective in reducing the serum IgE and/or IL- 13 levels in the subject. In yet other embodiments, the antibody is administered in an amount effective in reducing the number of immune cells, particularly eosinophil and neutrophil cells, in the airway (BALF) of the subject.

Conventional methods, known to those of ordinary skill in the art of medicine, can be5 used to administer the pharmaceutical composition to the subject, depending upon the type of disease to be treated or the site of the disease. This composition can also be administered via other conventional routes, e.g., administered orally, parenterally, by inhalation spray, topically, rectally, nasally, buccally, vaginally or via an implanted reservoir. The term "parenteral" as used herein includes subcutaneous, intracutaneous, intravenous,

o intramuscular, intraarticular, intraarterial, intrasynovial, intrasternal, intrathecal, intralesional, and intracranial injection or infusion techniques. In addition, it can be administered to the subject via injectable depot routes of administration such as using 1-, 3-, or 6-month depot injectable or biodegradable materials and methods.

Injectable compositions may contain various carriers such as vegetable oils, 5 dimethylactamide, dimethyformamide, ethyl lactate, ethyl carbonate, isopropyl myristate, ethanol, and polyols (glycerol, propylene glycol, liquid polyethylene glycol, and the like). For intravenous injection, water soluble antibodies can be administered by the drip method, whereby a pharmaceutical formulation containing the antibody and a physiologically acceptable excipients is infused. Physiologically acceptable excipients may include, for 0 example, 5% dextrose, 0.9% saline, Ringer's solution or other suitable excipients. Intramuscular preparations, e.g., a sterile formulation of a suitable soluble salt form of the antibody, can be dissolved and administered in a pharmaceutical excipient such as Water-for- Injection, 0.9% saline, or 5% glucose solution.

In some embodiments, an anti-IL-20R antibody is administered via site- specific or targeted local delivery techniques, e.g., delivered to the airway of a patient. Examples of site- specific or targeted local delivery techniques include various implantable depot sources of the antibody or local delivery catheters, such as infusion catheters, an indwelling catheter, or a needle catheter, synthetic grafts, adventitial wraps, shunts and stents or other implantable devices, site specific carriers, direct injection, or direct application. See, e.g., PCT Publication No. WO 00/53211 and U.S. Pat. No. 5,981,568.

It is also apparent that an expression vector can be used to direct expression of any of the antibodies described herein (e.g., anti-IL-20Rl antibody). The therapeutic antibodies described herein can be delivered using gene delivery vehicles. The gene delivery vehicle can be of viral or non- viral origin (see generally, Jolly, Cancer Gene Therapy (1994) 1:51; Kimura, Human Gene Therapy ( 1994) 5 : 845 ; Connelly, Human Gene Therapy (1995) 1: 185; and Kaplitt, Nature Genetics (1994) 6: 148). Expression of such coding sequences can be induced using endogenous mammalian or heterologous promoters and/or enhancers.

Expression of the coding sequence can be either constitutive or regulated.

Viral-based vectors for delivery of a desired polynucleotide and expression in a desired cell are well known in the art. Exemplary viral-based vehicles include, but are not limited to, recombinant retroviruses (see, e.g., PCT Publication Nos. WO 90/07936; WO 94/03622; WO 93/25698; WO 93/25234; WO 93/11230; WO 93/10218; WO 91/02805; U.S. Pat. Nos. 5,219,740 and 4,777,127; GB Patent No. 2,200,651; and EP Patent No. 0 345 242), alphavirus-based vectors (e.g., Sindbis virus vectors, Semliki forest virus (ATCC VR-67; ATCC VR-1247), Ross River virus (ATCC VR-373; ATCC VR-1246) and Venezuelan equine encephalitis virus (ATCC VR-923; ATCC VR-1250; ATCC VR 1249; ATCC VR- 532)), and adeno-associated virus (AAV) vectors (see, e.g., PCT Publication Nos. WO 94/12649, WO 93/03769; WO 93/19191; WO 94/28938; WO 95/11984 and WO 95/00655). Administration of DNA linked to killed adenovirus as described in Curiel, Hum. Gene Ther. (1992) 3: 147 can also be employed. Non-viral delivery vehicles and methods can also be employed, including, but not limited to, polycationic condensed DNA linked or unlinked to killed adenovirus alone (see, e.g., Curiel, Hum. Gene Ther. (1992) 3: 147); ligand-linked DNA (see, e.g., Wu, J. Biol. Chem. (1989) 264: 16985); eukaryotic cell delivery vehicles cells (see, e.g., U.S. Pat. No. 5,814,482; PCT Publication Nos. WO 95/07994; WO 96/17072; WO 95/30763; and WO

97/42338) and nucleic charge neutralization or fusion with cell membranes. Naked DNA can also be employed. Exemplary naked DNA introduction methods are described in PCT Publication No. WO 90/11092 and U.S. Pat. No. 5,580,859. Liposomes that can act as gene delivery vehicles are described in U.S. Pat. No. 5,422,120; PCT Publication Nos. WO 95/13796; WO 94/23697; WO 91/14445; and EP Patent No. 0524968. Additional approaches are described in Philip, Mol. Cell. Biol. (1994) 14:2411, and in Woffendin, Proc. Natl. Acad. Sci. (1994) 91: 1581.

The particular dosage regimen, i.e., dose, timing and repetition, used in the methods described herein will depend on the particular subject and that subject's medical history. Kits for Use in Treating Allergic Airway Disorders

The present disclosure also provides kits for use in the instant methods. Kits of the invention include one or more containers comprising one or more of the anti-IL-20R antibodies described herein (e.g., a functional equivalent of mAb7GW or mAb51D as described above), and in some embodiments, further comprise instructions for use in accordance with any of the methods described herein. In some embodiments, the antibody is a full-length antibody or an antigen-binding fragment thereof. In other embodiments, the antibody contained in the kit is a humanized antibody or a chimeric antibody comprising human constant heavy and light chains.

When necessary, the kit can include instructions comprise a description of administration of the antibody to treat a target allergic airway disorder such as asthma according to any of the methods described herein. The kit may further comprise a description of selecting an individual suitable for the treatment based on identifying whether that individual has the target disorder. In still other embodiments, the instructions comprise a description of administering the antibody to an individual at risk of the target allergic airway disorder. The instructions relating to the use of any of the antibodies described herein generally include information as to dosage, dosing schedule, and route of administration for the intended treatment. The containers may be unit doses, bulk packages (e.g., multi-dose packages) or sub-unit doses. Instructions supplied in the kits of the invention are typically 5 written instructions on a label or package insert (e.g., a paper sheet included in the kit), but machine-readable instructions (e.g., instructions carried on a magnetic or optical storage disk) are also acceptable.

The label or package insert indicates that the composition is used for treating an allergic airway disorder, e.g. asthma, allergic rhinitis, allergic pneumonia, and bronchial o airway obstruction. Instructions may be provided for practicing any of the methods described herein.

Any of the kits disclosed herein are in suitable packaging. Suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g., sealed Mylar or plastic bags), and the like. Also contemplated are packages for use in combination with a5 specific device, such as an inhaler, nasal administration device (e.g., an atomizer) or an

infusion device such as a minipump. A kit may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). The container may also have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a o hypodermic injection needle). At least one active agent in the composition is one of the anti-

IL-20R antibodies disclosed herein, such as monoclonal antibody mAb7GW, mAb51D, or a functional equivalent thereof.

Kits may optionally provide additional components such as buffers and interpretive information. Normally, the kit comprises a container and a label or package insert(s) on or 5 associated with the container.

In some embodiments, the invention provides articles of manufacture comprising contents of the kits described above. In some embodiments, the kits comprise an IL-20 antagonist (such as anti-IL-20 antibody) with information indicating use to treat allergic airway disorders.

0 Without further elaboration, it is believed that one skilled in the art can, based on the above description, utilize the present invention to its fullest extent. The following specific embodiments are, therefore, to be construed as merely illustrative, and not limitative of the remainder of the disclosure in any way whatsoever. All publications cited herein are incorporated by reference for the purposes or subject matter referenced herein.

5

EXAMPLE 1: IL-20R1 knock-out mice did not develop asthma when challenged with

allergen Der P

IL-20R1 knock-out mice were constructed as described in US 2011/0256093, which is incorporated by reference in its entirety. Briefly, the exon 2 in mouse IL-20R1 gene was deleted via the traditional homologous recombination technology. The deletion of exon 2 was confirmed by Southernblot using a DNA probe hybridizable to the 3' end of exon 2.

To induce allergic responses in the mouse airway, mice were anesthetized and administered with allergen Der P via nasal injection (i.p.) at the dosage of 25 μg/day. Both wild type and IL-20R1 knock-out mice were treated in the same manner. The allergic response to the allergen was analyzed by counting total lymphocytes, eosinophil, and neutrophil accumulation in the airway.

To examine the lymphocytes in the airway of the IL-20R1 knock-out mice, the trachea of the mice was exposed and cannulated, and bronchoalveolar lavage (BAL) was performed o with two aliquots of saline (1-mL each). If necessary, red blood cells were lysed following routine procedures. A total of 1.8 to 1.9 mL bronchoalveolar lavage fluid (BALF) was consistently recovered from each mouse by this technique. The lymphocytes in the BALF were harvested, suspended in a lxHBSS buffer. The cell suspension was then centrifuged at 300g for 10 minutes. After discarding the supernatant, the cells were suspended in RPM16405 medium. 10 ⁵ lymphocytes were cytospinned on a slide. The number of total lymphocytes was counted. The numbers of eosinophil cells and neutrophil cells were determined by Liu's staining and counted under the microscope.

As shown in Figure 1, the total number of lymphocytes in the BALF of IL-20R1 knock-out mice was much lower than that in the BALF of wild-type mice.

o Next, the serum levels of IgE and IL-13, two major players in allergic responses, in the knock-out mice were examined as follows. Serum samples were obtained from the blood of wild-type and knock-out mice. The levels of IgE and IL-13 in the serum samples were determined using the ELISA kit purchased from R& D, following the manufacture's

(standard ) protocol.

It was found that the levels of both serum IgE and IL-13 were significantly reduced in the IL-20R1 mice as compared to the wild-type mice. Figure 2.

Taken together, this study indicates that IL-20R1 might be involved in the

pathogenesis of allergic disease development in the airway.

EXAMPLE 2: An anti-IL-20Rl antibody protected mice from developing asthma in response to allergen exposure

To induce allergic responses in mouse airway, mice were anesthetized and administered with allergen Der P via nasal injection (i.p.) at the dosage of 25 g/day for 10 days. See also Figure 5. To examine the effects of mAb51D in the allergic mice induced with Der P, the mice were co-administered with mAb51D at 6mg, mAb51D at lOmg, a control mlgG. Untreated mice (native) were used as a blank control.

Three days after the treatment, the mice were sacrificed. Blood samples and B ALF samples were collected following the methods described in Example 1 above. The serum levels of IgE and IL-13, as well as the amounts of lymphocytes, including eosinophil and neutrophil, were determined also following the methods described above.

As shown in Figure 3, panel A, mice challenged with Der p showed elevated levels of lymphocytes in BALF and mAb5 ID significantly reduced the number of BALF lymphocytes in the mice challenged with Der p. Similarly, mAb51D also significantly reduced the levels of eosinophil and neutrophil in the BALF of mice challenged by Der p (Figure 3, panels B and C). Moreover, mAb51D significantly reduced the serum levels of IgE and IL-13 in mice challenged by Der p. Figure 4. All these results indicate that mAb51D successfully neutralized the allergic responses induced by Der p, suggesting that anti-IL-20Rl antibodies would be effective in alleviating allergic responses in the airway of a subject in response to stimulations by allergens. As such, these antibodies can be used as therapeutic agents for treating allergic airway disorders such as asthma and bronchial airway obstruction. OTHER EMBODIMENTS

All of the features disclosed in this specification may be combined in any combination. Each feature disclosed in this specification may be replaced by an alternative feature serving the same, equivalent, or similar purpose. Thus, unless expressly stated otherwise, each feature disclosed is only an example of a generic series of equivalent or similar features.

From the above description, one skilled in the art can easily ascertain the essential characteristics of the present invention, and without departing from the spirit and scope thereof, can make various changes and modifications of the invention to adapt it to various usages and conditions. Thus, other embodiments are also within the claims.

What is claimed is: