Tuberculosis Compositions And Methods Of Using The Same

Field

The present disclosure is directed, in part, to fusion proteins comprising Mycobacterium tuberculosis (Mtb) antigens, nucleic acid molecules encoding the same, vectors comprising nucleic acid molecules, compositions comprising the same, and methods of eliciting an immune response against tuberculosis.

Background

Tuberculosis (TB) is a global health problem resulting in 8 million new cases and 2 million deaths each year. The emergence of multi-drug and totally-drug resistant strains of TB only makes this problem more severe. The life cycle of Mtb has 3 stages. In the acute phase following initial infection the bacteria replicate in the host and virulence factors are expressed, leading to the generation of an immune response by the host. As the immune response begins to control the infection, the Mtb enters a latent, asymptomatic state in which the bacteria become non-replicating and are encased in granulomas. The bacterium can persist in this latent state in infected individuals for many years, making diagnosis and treatment of disease difficult. In some cases, the bacteria are reactivated and begin replicating again, leading back to the disease state. Reactivation can occur for numerous reasons, including immune suppression caused by diseases such as HIV, treatments such as chemotherapy, or the weakening of the immune system due to aging. An estimated 2 billion people are latently infected with Mtb worldwide, and reactivation of latent Mtb accounts for most new cases of active TB disease. Reactivation is associated with inflammation, necrosis and cavitation of the lung, a process that results in draining of the lesions into the bronchus. Aerosols generated when individuals with bronchial lesions cough causes dissemination of the Mtb organism to uninfected, susceptible persons, and the transmission cycle is thus maintained.

The only currently available vaccine against TB, Mycobacterium bovis (Bacille

Calmette-Guerin) (BCG), was first introduced in 1921. BCG has been widely utilized and while studies show that for some purposes BCG is effective (e.g. against disseminated TB), it is known to be ineffective with respect to preventing the development, persistence and reactivation of latent TB. There is an ongoing need to develop improved, more effective vaccines against TB. In particular, there is a need to develop vaccines that provide protection against the development, maintenance and/or reactivation of latent tuberculosis infection. With the availability of the entire genomic sequence of Mtb, and the tools for bioinformatic and experimental analysis of

#28044985 vl Mtb antigens, many new potential Mtb vaccine candidates have been identified in recent years. These include antigens that are involved in acute infection, maintenance of latency, or reactivation of Mtb. There are a range of delivery strategies in clinical development that are comprised of combinations of these and other antigens that have been tested in animal models and are currently or will soon be in clinical trials.

While vaccines are often effective to immunize individuals prophylactically or therapeutically against pathogen infection or human diseases, there is a need for improved vaccines. There is also a need for compositions and methods that produce an enhanced immune response. Likewise, while some immunotherapeutics are useful to modulate immune response in a patient, there remains a need for improved immunotherapeutic compositions and methods.

Summary

This disclosure describes an antigen cassette (and specified variants) that can be used to create tuberculosis vaccines comprising specified Mycobacterium tuberculosis (Mtb) antigens which are involved with 3 identified stages of disease: 1) infection or acute infection, 2) latency or the latent state, and 3) resuscitation or reactivation of active disease. The disclosure also describes the strategic combination of antigens which are incorporated into a variety of delivery platforms in such a way as to provide pathways to a matrix of matched combinations of antigen delivery to obtain an optimized immune response. The subject matter described herein can be used as a prophylactic or therapeutic TB vaccine. The initial selection of antigens for inclusion into a usable cassette was based on a number of parameters including, for example, a thorough review of the literature, expression data, responses by human T cells, inclusion of human immunogenic regions, mouse protection studies, and conservation in sequence across most strains of TB with full genome sequences. Specific antigens were then probed to be sure they were able to be expressed in a variety of systems (BCG, protein, viral vectors, nucleic acids), that they were immunogenic, and they could be made as fusions in proteins or other vectors to simplify downstream manufacturing concerns. All of the selected antigens were then shown to be immunogenic in mice, either when used alone, or in a variety of combinations, to arrive at the present application.

The constructs described herein have been integrated into a specified range of delivery platforms that include the following classes (but not exhaustive) of representative delivery platforms: 1) viral vector delivery systems, 2) recombinant BCG, 3) recombinant purified protein fusions, 4) DNA plasmid vector systems, and 5) RNA vector systems. These delivery platforms can be used either in a single platform alone or in combinations as matched antigen prime-boost

#28044985 vl approaches. In addition, the use of these antigens in a single rBCG vector system, which is envisioned to be used as an antigen matched prime for a boost with any of the modalities above, including protein, viral vectors, nucleic acids, or others.

The present disclosure provides fusion proteins that comprise at least three

Mycobacterium tuberculosis (Mtb) antigens, wherein the fusion protein comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen.

The present disclosure also provides nucleic acid molecules encoding fusion proteins that comprise at least three Mycobacterium tuberculosis (Mtb) antigens, wherein the fusion protein comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen.

The present disclosure also provides: compositions comprising the fusion proteins and a pharmaceutically acceptable carrier; vectors encoding the fusion proteins; compositions comprising the vectors and a pharmaceutically acceptable carrier; cells comprising the vectors; compositions comprising the cells and a pharmaceutically acceptable carrier.

The present disclosure also provides compositions that comprise at least three

Mycobacterium tuberculosis (Mtb) antigens, wherein the composition comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen.

The present disclosure also provides compositions that comprise at least three

Mycobacterium tuberculosis (Mtb) antigens, wherein the composition comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen; wherein the composition comprises at least one nucleic acid molecule encoding at least one of the Mtb antigens.

The present disclosure also provides methods of eliciting an immune response against Mycobacterium tuberculosis in a mammal comprising administering to the mammal an immunologically sufficient amount of one or more fusion proteins comprising at least three Mycobacterium tuberculosis (Mtb) antigens, wherein at least one fusion protein comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen.

The present disclosure also provides methods of eliciting an immune response against Mycobacterium tuberculosis in a mammal comprising administering to the mammal an

#28044985 vl immunologically sufficient amount of a composition comprising at least three Mycobacterium tuberculosis (Mtb) antigens, wherein the composition comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen; and a pharmaceutically acceptable carrier.

The present disclosure also provides methods of eliciting an immune response against Mycobacterium tuberculosis in a mammal comprising administering to the mammal an immunologically sufficient amount of a composition comprising at least three Mycobacterium tuberculosis (Mtb) antigens, wherein the composition comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen; and a pharmaceutically acceptable carrier; wherein the composition comprises at least one nucleic acid molecule encoding at least one of the Mtb antigens.

The present disclosure also provides fusion proteins for use in the preparation of a medicament for treating or preventing a Mycobacterium tuberculosis infection, wherein the fusion protein comprises at least three Mycobacterium tuberculosis (Mtb) antigens, and wherein the fusion protein comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen.

The present disclosure also provides fusion proteins for use in treating or preventing a

Mycobacterium tuberculosis infection, wherein the fusion protein comprises at least three Mycobacterium tuberculosis (Mtb) antigens, and wherein the fusion protein comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen.

The present disclosure also provides uses of a fusion protein in the preparation of a medicament for treating or preventing a Mycobacterium tuberculosis infection, wherein the fusion protein comprises at least three Mycobacterium tuberculosis (Mtb) antigens, and wherein the fusion protein comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen.

The present disclosure also provides uses of a fusion protein in treating or preventing a Mycobacterium tuberculosis infection, wherein the fusion protein comprises at least three Mycobacterium tuberculosis (Mtb) antigens, and wherein the fusion protein comprises: at least

#28044985 vl one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen.

The present disclosure also provides compositions for use in the preparation of a medicament for treating or preventing a Mycobacterium tuberculosis infection, wherein the composition comprises at least three Mycobacterium tuberculosis (Mtb) antigens, and wherein the composition comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen; and a pharmaceutically acceptable carrier.

The present disclosure also provides composition for use in treating or preventing a Mycobacterium tuberculosis infection, wherein the composition comprises at least three

Mycobacterium tuberculosis (Mtb) antigens, and wherein the composition comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen; and a

pharmaceutically acceptable carrier.

The present disclosure also provides uses of a composition in the preparation of a medicament for treating or preventing a Mycobacterium tuberculosis infection, wherein the composition comprises at least three Mycobacterium tuberculosis (Mtb) antigens, and wherein the composition comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen; and a pharmaceutically acceptable carrier.

The present disclosure also provides uses of a composition in treating or preventing a Mycobacterium tuberculosis infection, wherein the composition comprises at least three

Mycobacterium tuberculosis (Mtb) antigens, and wherein the composition comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen; and a

pharmaceutically acceptable carrier.

The present disclosure also provides compositions for use in the preparation of a medicament for treating or preventing a Mycobacterium tuberculosis infection, wherein the composition comprises at least three Mycobacterium tuberculosis (Mtb) antigens, and wherein the composition comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen; and a pharmaceutically acceptable carrier; wherein the composition comprises at least one nucleic acid molecule encoding at least one of the Mtb antigens.

#28044985 vl The present disclosure also provides compositions for use in treating or preventing a Mycobacterium tuberculosis infection, wherein the composition comprises at least three

Mycobacterium tuberculosis (Mtb) antigens, and wherein the composition comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen; and a

pharmaceutically acceptable carrier; wherein the composition comprises at least one nucleic acid molecule encoding at least one of the Mtb antigens.

The present disclosure also provides uses of a composition in the preparation of a medicament for treating or preventing a Mycobacterium tuberculosis infection, wherein the composition comprises at least three Mycobacterium tuberculosis (Mtb) antigens, and wherein the composition comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen; and a pharmaceutically acceptable carrier; wherein the composition comprises at least one nucleic acid molecule encoding at least one of the Mtb antigens.

The present disclosure also provides uses of a composition in treating or preventing a

Mycobacterium tuberculosis infection, wherein the composition comprises at least three

Mycobacterium tuberculosis (Mtb) antigens, and wherein the composition comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen; and a

pharmaceutically acceptable carrier; wherein the composition comprises at least one nucleic acid molecule encoding at least one of the Mtb antigens.

The present disclosure also provides fusion proteins, compositions, cells, vectors, methods, and uses, as described herein, substantially as described with reference to the accompanying examples and/or figures.

Brief Description Of The Drawings

Figures 1A and IB show maps of the plasmids used to insert the genes of interest into the chromosome of BCG SSI or other strains of BCG: (A) constructs with the Ag85B signal sequence for secretion of the fusions; and (B) constructs with the 19 kDa signal sequence to anchor the fusions into the membrane.

Figure 2 shows in vitro antigen responsiveness after vaccination with BCG strains carrying antigen cassette.

Figures 3 A and 3B show in vitro stimulation: (A) showing INF-γ induction in splenocytes following protein stimulation and ELISpot; and (B) analysis showing number of

#28044985 vl splenocytes expressing INF-γ from CB6F1 mice immunized twice with 10 μg of the 5 Ag fusion protein (Construct D) and a synthetic poly I:C adjuvant.

Figures 4A and 4B show in vitro stimulation: (A) ELISpot; and (B) analysis of splenocytes from CB6F1 mice immunized twice with 3 μg of the 5 Ag fusion protein (Construct D) or 4 Ag fusion protein (Construct A) and a synthetic MPL TLR4 adjuvant; when Ag85B is removed from the 5 Ag fusion protein, the responses to the other 4 antigens in the 4 Ag protein increase.

Figures 5A and 5B show in vitro stimulation: (A) ELISpot; and (B) analysis of splenocytes from CB6F1 mice immunized twice with 3 μg of the 5 Ag fusion protein (Construct D) and 4 Ag fusion proteins with either wild-type or modified Rvl733 or the 4 Ag protein with RpfD replaced by RpfB, with RpfB either at the 3 ' or 5' end of the fusion protein; the proteins were adjuvanted with a synthetic poly I:C adjuvant; RpfB induces a much stronger immune response than RpfD, particularly when RpfB is at the 5 ' end of the fusion protein; neither modified nor wild-type Rvl733 induced a strong immune response.

Figures 6A and 6B show bacterial numbers in: (A) the lungs and (B) spleen of CB6F1 mice primed with BCG and boosted with either the 4 Ag or 5 Ag fusion protein 4 weeks after challenge with Mycobacterium tuberculosis H37Rv.

Description Of Embodiments

The terminology used herein is for the purpose of describing particular embodiments only and is not intended to be limiting.

As used herein, the singular forms "a," "an" and "the" include plural referents unless the context clearly dictates otherwise.

For recitation of numeric ranges herein, each intervening number there between with the same degree of precision is explicitly contemplated. For example, for the range of 6-9, the numbers 7 and 8 are contemplated in addition to 6 and 9, and for the range 6.0-7.0, the numbers 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, and 7.0 are explicitly contemplated.

As used herein, "acute Mtb antigen" means any Mtb antigen involved in the acute phase tuberculosis infection.

As used herein, "adjuvant" means any molecule added to any composition described herein to enhance the immunogenicity of the Mtb antigens.

As used herein, "coding sequence" or "encoding nucleic acid" means the nucleic acids (RNA or DNA molecule) that comprise a nucleotide sequence which encodes an Mtb antigen. The coding sequence can further include initiation and termination signals operably linked to

#28044985 vl regulatory elements including a promoter and polyadenylation signal capable of directing expression in the cells of an individual or mammal to which the nucleic acid is administered.

As used herein, "consensus" or "consensus sequence" means a polypeptide sequence based on analysis of an alignment of multiple subtypes of a particular Mtb antigen. Nucleic acid sequences that encode a consensus polypeptide sequence can be prepared. Vaccines comprising Mtb antigens that comprise consensus sequences and/or nucleic acid molecules that encode such antigens can be used to induce broad immunity against multiple subtypes or serotypes of a particular antigen.

As used herein, "electroporation" means the use of a transmembrane electric field pulse to induce microscopic pathways (pores) in a bio-membrane; their presence allows biomolecules such as plasmids, oligonucleotides, siRNA, drugs, ions, and water to pass from one side of the cellular membrane to the other.

As used herein, "fragment" with respect to nucleic acid sequences, means a nucleic acid sequence or a portion thereof, that encodes a portion of an Mtb antigen capable of eliciting an immune response in a mammal that cross reacts with a full length wild type Mtb antigen. The fragments can be DNA fragments selected from at least one of the various nucleotide sequences that encode protein fragments set forth below.

As used herein, "fragment" or "immunogenic fragment" with respect to polypeptide sequences, means a portion of an MTB antigen capable of eliciting an immune response in a mammal that cross reacts with a full length wild type strain Mtb antigen. Fragments of consensus or wild type Mtb antigens can comprise at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or at least 95% of a consensus or wild type Mtb antigen. In some embodiments, fragments of consensus proteins can comprise at least 20 amino acids or more, at least 30 amino acids or more, at least 40 amino acids or more, at least 50 amino acids or more, at least 60 amino acids or more, at least 70 amino acids or more, at least 80 amino acids or more, at least 90 amino acids or more, at least 100 amino acids or more, at least 110 amino acids or more, at least 120 amino acids or more, at least 130 amino acids or more, at least 140 amino acids or more, at least 150 amino acids or more, at least 160 amino acids or more, at least 170 amino acids or more, at least 180 amino acids or more of a consensus or wild type protein.

As used herein, "genetic construct" refers to the DNA or RNA molecules that comprise a nucleotide sequence which encodes an Mtb antigen. The coding sequence includes initiation and termination signals operably linked to regulatory elements including a promoter and

#28044985 vl polyadenylation signal capable of directing expression in the cells of the individual to whom the nucleic acid molecule is administered.

As used herein, "expressible form" refers to gene constructs that contain the necessary regulatory elements operable linked to a coding sequence that encodes an Mtb antigen such that when present in the cell of the individual, the coding sequence will be expressed.

As used herein, "homology" refers to a degree of complementarity. There can be partial homology or complete homology (i.e., identity). A partially complementary sequence that at least partially inhibits a completely complementary sequence from hybridizing to a target nucleic acid is referred to using the functional term "substantially homologous." When used in reference to a double-stranded nucleic acid sequence such as a cDNA or genomic clone, the term

"substantially homologous" refers to a probe that can hybridize to a strand of the double- stranded nucleic acid sequence under conditions of low stringency. When used in reference to a single-stranded nucleic acid sequence, the term "substantially homologous" refers to a probe that can hybridize to (i.e., is the complement of) the single-stranded nucleic acid template sequence under conditions of low stringency.

As used herein, "identical" or "identity" in the context of two or more nucleic acids or polypeptide sequences, means that the sequences have a specified percentage of residues that are the same over a specified region. The percentage can be calculated by optimally aligning the two sequences, comparing the two sequences over the specified region, determining the number of positions at which the identical residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the specified region, and multiplying the result by 100 to yield the percentage of sequence identity. In cases where the two sequences are of different lengths or the alignment produces one or more staggered ends and the specified region of comparison includes only a single sequence, the residues of single sequence are included in the denominator but not the numerator of the calculation. When comparing DNA and RNA, thymine (T) and uracil (U) residues can be considered equivalent. Identity can be performed manually or by using a computer sequence algorithm such as BLAST or BLAST 2.0.

As used herein, "immune response" means the activation of a host's immune system, e.g., that of a mammal, in response to the introduction of an Mtb antigen. The immune response can be in the form of a cellular or humoral response, or both.

As used herein, "latent Mtb antigen" means any Mtb antigen involved in the latent phase tuberculosis infection.

#28044985 vl As used herein, "Mtb antigen" means an antigen from Mycobacterium tuberculosis, which may be an isolated antigen, or an antigen that forms part of a fusion protein with other antigen(s).

As used herein, "nucleic acid" or "oligonucleotide" or "polynucleotide" means at least two nucleotides covalently linked together. The depiction of a single strand also defines the sequence of the complementary strand. Thus, a nucleic acid also encompasses the

complementary strand of a depicted single strand. Many variants of a nucleic acid can be used for the same purpose as a given nucleic acid. Thus, a nucleic acid also encompasses substantially identical nucleic acids and complements thereof. A single strand provides a probe that can hybridize to a target sequence under stringent hybridization conditions. Thus, a nucleic acid also encompasses a probe that hybridizes under stringent hybridization conditions. Nucleic acids can be single stranded or double stranded, or can contain portions of both double stranded and single stranded sequence. The nucleic acid can be DNA, both genomic and cDNA, RNA, or a hybrid, where the nucleic acid can contain combinations of deoxyribo- and ribo-nucleotides, and combinations of bases including uracil, adenine, thymine, cytosine, guanine, inosine, xanthine hypoxanthine, isocytosine and isoguanine. Nucleic acids can be obtained by chemical synthesis methods or by recombinant methods.

As used herein, "operably linked" means that expression of a gene is under the control of a promoter with which it is spatially connected. A promoter can be positioned 5' (upstream) or 3' (downstream) of a gene under its control. The distance between the promoter and a gene can be approximately the same as the distance between that promoter and the gene it controls in the gene from which the promoter is derived. As is known in the art, variation in this distance can be accommodated without loss of promoter function.

As used herein, "promoter" means a synthetic or naturally-derived molecule which is capable of conferring, activating or enhancing expression of a nucleic acid in a cell. A promoter can comprise one or more specific transcriptional regulatory sequences to further enhance expression and/or to alter the spatial expression and/or temporal expression of same. A promoter can also comprise distal enhancer or repressor elements, which can be located as much as several thousand base pairs from the start site of transcription. A promoter can be derived from sources including viral, bacterial, fungal, plants, insects, and animals. A promoter can regulate the expression of a gene component constitutively, or differentially with respect to cell, the tissue or organ in which expression occurs or, with respect to the developmental stage at which expression occurs, or in response to external stimuli such as physiological stresses, pathogens, metal ions, or inducing agents.

#28044985 vl As used herein, "resuscitation Mtb antigen" means any Mtb antigen involved in the resuscitation or reactivation of a tuberculosis infection.

As used herein, "signal peptide" and "leader sequence", used interchangeably, refer to an amino acid sequence that can be linked at the amino terminus of an Mtb antigenic protein set forth herein. Signal peptides/leader sequences typically direct localization of a protein. Signal peptides/leader sequences used herein can facilitate secretion of the protein from the cell in which it is produced or anchor it in the membrane. Signal peptides/leader sequences are often cleaved from the remainder of the protein, often referred to as the mature protein, upon secretion from the cell. Signal peptides/leader sequences are linked at the N terminus of the protein.

As used herein, "stringent hybridization conditions" means conditions under which a first nucleic acid sequence (e.g., probe) will hybridize to a second nucleic acid sequence (e.g., target), such as in a complex mixture of nucleic acids. Stringent conditions are sequence- dependent and will be different in different circumstances. Stringent conditions can be selected to be about 5 to 10°C lower than the thermal melting point (T _m ) for the specific sequence at a defined ionic strength pH. The T _m can be the temperature (under defined ionic strength, pH, and nucleic concentration) at which 50% of the probes complementary to the target hybridize to the target sequence at equilibrium (as the target sequences are present in excess, at T _m , 50% of the probes are occupied at equilibrium). Stringent conditions can be those in which the salt concentration is less than about 1.0 M sodium ion, such as about 0.01 to 1.0 M sodium ion concentration (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30°C for short probes (e.g., about 10 to 50 nucleotides) and at least about 60°C for long probes (e.g., greater than about 50 nucleotides). Stringent conditions can also be achieved with the addition of destabilizing agents such as formamide. For selective or specific hybridization, a positive signal can be at least 2 to 10 times background hybridization. Exemplary stringent hybridization conditions include the following: 50% formamide, 5x SSC, and 1% SDS, incubating at 42°C, or, 5x SSC, 1% SDS, incubating at 65°C, with wash in 0.2x SSC, and 0.1% SDS at 65°C.

As used herein, "substantially complementary" means that a first sequence is at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical to the complement of a second sequence over a region of 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 180, 270, 360, 450, 540, or more nucleotides or amino acids, or that the two sequences hybridize under stringent hybridization conditions.

As used herein, "substantially identical" means that a first and second sequence are at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical over a region of

#28044985 vl 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 180, 270, 360, 450, 540 or more nucleotides or amino acids, or with respect to nucleic acids, if the first sequence is substantially complementary to the complement of the second sequence.

As used herein, "variant" with respect to a nucleic acid means: i) a portion or fragment of a referenced nucleotide sequence; ii) the complement of a referenced nucleotide sequence or portion thereof; iii) a nucleic acid that is substantially identical to a referenced nucleic acid or the complement thereof; or iv) a nucleic acid that hybridizes under stringent conditions to the referenced nucleic acid, complement thereof, or a sequences substantially identical thereto.

As used herein, "variant" with respect to a peptide or polypeptide means that it differs in amino acid sequence by the insertion, deletion, or conservative substitution of amino acids, but retains at least one biological activity. Variant can also mean a protein with an amino acid sequence that is substantially identical to a referenced protein with an amino acid sequence that retains at least one biological activity. A conservative substitution of an amino acid, i.e., replacing an amino acid with a different amino acid of similar properties (e.g., hydrophilicity, degree and distribution of charged regions) is recognized in the art as typically involving a minor change. Amino acid substitutions that are compatible with biological function are understood to depend on the relative similarity of the amino acids, and particularly the side chains of those amino acids, as revealed by the hydrophobicity, hydrophilicity, charge, size, and other properties.

As used herein, "vector" means a nucleic acid sequence containing an origin of replication. A vector can be a viral vector, bacteriophage, bacterial artificial chromosome or yeast artificial chromosome. A vector can be a DNA or RNA vector. A vector can be a self- replicating extrachromosomal vector.

The present disclosure provides fusion proteins comprising at least three

Mycobacterium tuberculosis (Mtb) antigens. In some embodiments, the fusion protein comprises at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen. In some embodiments, the fusion protein comprises at least two latent Mtb antigens and at least one resuscitation Mtb antigen.

In some embodiments, the nucleic acid molecule encoding any particular Mtb antigen can be a mycobacterial sequence, a bacterial codon optimized sequence (such as an E. coli optimized sequence), or a mammalian optimized sequence (such as a human optimized sequence). The E. coli optimized sequences can be used, for example, to produce fusion proteins.

#28044985 vl The human optimized sequences can be used in, for example, viral vectors. Methods of codon optimization (whether for bacterial or mammalian) are well known to the skilled artisan.

In some embodiments, the acute Mtb antigen is Ag85B, ESAT6, MPT64, PPE15, PPE51, or Rv3615c. In some embodiments, the acute Mtb antigen is Ag85B, ESAT6, or Rv3615c. In some embodiments, the acute Mtb antigen is Ag85B or ESAT6. Additional acute Mtb antigens are well known to the skilled artisan.

The acute Mtb antigen Ag85B is also known as Rv 1886c. A nucleotide sequence encoding Ag85B is shown in Table 1 as SEQ ID NO: l (mycobacterial sequence; not codon optimized), SEQ ID NO:2 (E. coli optimized), and SEQ ID NO:3 (human optimized), and an amino acid sequence of Ag85B is shown in Table 1 as SEQ ID NO:4 (mycobacterial sequence) and SEQ ID NO:5 (E. coli and human optimized).

The acute Mtb antigen ESAT-6 is also known as Rv3875. A nucleotide sequence encoding ESAT-6 is shown in Table 1 as SEQ ID NO: 6 (mycobacterial sequence; not codon optimized) and SEQ ID NO:7 (human optimized), and an amino acid sequence of ESAT-6 is shown in Table 1 as SEQ ID NO: 8.

The acute Mtb antigen MPT64 is also known as Rvl980c. A nucleotide sequence encoding the acute Mtb antigen MPT64 is shown in Table 1 as SEQ ID NO: 9 (mycobacterial sequence; not codon optimized) and as SEQ ID NO: 10 (human optimized), and an amino acid sequence of MPT64 is shown in Table 1 as SEQ ID NO: 11.

The acute Mtb antigen PPE15 is also known as Rvl039c. A nucleotide sequence encoding the acute Mtb antigen PPE15 is shown in Table 1 as SEQ ID NO: 12 (mycobacterial sequence; not codon optimized) and as SEQ ID NO: 13 (human optimized), and an amino acid sequence of PPE15 is shown in Table 1 as SEQ ID NO: 14.

The acute Mtb antigen PPE51 is also known as Rv3136. A nucleotide sequence encoding the acute Mtb antigen PPE51 is shown in Table 1 as SEQ ID NO: 15 (mycobacterial sequence; not codon optimized), SEQ ID NO: 16 (E. coli optimized) and as SEQ ID NO: 17 (human optimized), and an amino acid sequence of PPE51 is shown in Table 1 as SEQ ID NO: 18.

A nucleotide sequence encoding the acute Mtb antigen Rv3615c is shown in Table 1 as SEQ ID NO: 19 (mycobacterial sequence; not codon optimized) and as SEQ ID NO:20 (human optimized), and an amino acid sequence of Rv3615c is shown in Table 1 as SEQ ID NO:21.

#28044985 vl Table 1

#28044985 vl AGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWER NDPTQQIPKLVA TRLWVYCGNGTPNELGGANIPAEFLENFVRSSN LKFQDAY AAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSL GAG (SEQ ID NO:4)

MFSRPGLPVEYLQVPSPSMGRDIKVQFQSGG SPAVYLLDGLRAQD

DY GWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGC

QTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAY

HPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSS

DPAWER DPTQQIPKLVA TRLWVYCGNGTPNELGGANIPAEFLE

NFVRSSNLKFQDAY AAGGHNAVFNFPPNGTHSWEYWGAQLNAMK

GDLQSSLGAG (SEQ ID NO:5)

ESAT6 atgacagagcagcagtggaatttcgcgggtatcgaggccgcggcaagcgcaatccaggga aatgtcacgtc cattcattccctccttgacgaggggaagcagtccctgaccaagctcgcagcggcctgggg cggtagcggttc ggaggcgtaccagggtgtccagcaaaaatgggacgccacggctaccgagctgaacaacgc gctgcagaa cctggcgcggacgatcagcgaagccggtcaggcaatggcttcgaccgaaggcaacgtcac tgggatgttcg catag (SEQ ID NO: 6)

accgagcagcagtggaacttcgccggcatcgaagctgccgctagcgccatccaaggcaac gtgaccagcat ccacagcctgctggacgagggcaagcagagcctgaccaagctggctgctgcttggggcgg atccggaagc gaagcctaccagggcgtgcagcagaagtgggacgccacagccaccgagctgaacaacgcc ctgcagaac ctcgccagaaccatcagcgaggccggacaggctatggccagcacagagggcaatgtgacc ggcatgttcg cc (SEQ ID NO:7)

TEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGS EAYQGVQQKWDATATELNNALQNLARTISEAGQAMASTEGNVTGM FA (SEQ ID NO: 8)

MPT64 gtgcgcatcaagatcttcatgctggtcacggctgtcgttttgctctgttgttcgggtgtg gccacggccgcgccc aagacctactgcgaggagttgaaaggcaccgataccggccaggcgtgccagattcaaatg tccgacccggc ctacaacatcaacatcagcctgcccagttactaccccgaccagaagtcgctggaaaatta catcgcccagacg cgcgacaagttcctcagcgcggccacatcgtccactccacgcgaagccccctacgaattg aatatcacctcg gccacataccagtccgcgataccgccgcgtggtacgcaggccgtggtgctcaaggtctac cagaacgccgg cggcacgcacccaacgaccacgtacaaggccttcgattgggaccaggcctatcgcaagcc aatcacctatg acacgctgtggcaggctgacaccgatccgctgccagtcgtcttccccattgtgcaaggtg aactgagcaagc agaccggacaacaggtatcgatagcgccgaatgccggcttggacccggtgaattatcaga acttcgcagtca cgaacgacggggtgattttcttcttcaacccgggggagttgctgcccgaagcagccggcc caacccaggtat tggtcccacgttccgcgatcgactcgatgctggcctag (SEQ ID NO: 9)

atggtcaggatcaagatcttcatgctcgtgaccgccgtggtgctcctgtgttgttccggc gtggctaccgctgct cccaagacctactgcgaggagctgaagggaaccgacaccggccaggcctgccagatccaa atgagcgac cccgcctacaacatcaacatctccctcccctcctactaccccgatcagaagtccctcgag aactacatcgctca gaccagggacaagttcctgagcgccgccacaagcagcacacccagagaggccccctacga gctgaacatc acctccgccacctaccagtccgctattcctcccagaggcacccaggctgtggtgctcaag gtctaccaaaacg ctggcggaacacaccccaccaccacctacaaggccttcgactgggaccaggcctacagga agcccatcac atacgacaccctgtggcaggctgataccgatcccctgcccgtggtgttccccatcgtgca gggcgagctctcc aagcagaccggccagcaagtgagcatcgcccccaatgctggactggaccccgtgaactac cagaacttcgc cgtcaccaacgacggcgtgatcttcttcttcaatcccggcgaactgctgcctgaagctgc tggccccacccaa gtgctggtgcctagaagcgccatcgactccatgctggcctga (SEQ ID NO: 10)

VRIKIFMLVTAVVLLCCSGVATAAPKTYCEELKGTDTGQACQIQMSD PAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITS ATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPIT

#28044985 vl YDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPV YQNF AVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA (SEQ ID NO: 11)

PPE15 atggatttcggagctttaccccctgagatcaactccgcacgcatgtacgccggcgcgggt gcaggaccgatg atggccgccggggccgcatggaacggcctggccgccgagttgggtacgacggccgcgtcg tatgagtcgg tgatcacccggctgaccaccgagtcgtggatgggtccggcctcgatggcgatggtcgccg cagcccagccc tatctggcttggttgacctacaccgccgaagccgctgcgcatgccggctcgcaggccatg gcgtcggcggc cgcctacgaggcggcctatgcgatgacagtgccgccggaggtggtcgcggccaaccgggc gctgctggc ggccctggtcgcgacgaacgtcctggggatcaacacaccggcaatcatggcgaccgaagc cctctatgccg agatgtgggctcaggacgctctggctatgtacggctacgcggccgcttcgggagccgccg ggatgctgcaa ccgttaagcccgccgtcgcagaccaccaacccgggcgggctggccgcccagtccgccgcg gtcggctcg gctgccgccaccgccgccgtcaaccaggtgagcgtagcggacctgatcagtagcctgccc aacgcggtga gtgggctcgcctccccagtcacatcggttctcgactcgacggggctgagcggaatcattg ccgacatcgacg ccctgctcgcgaccccgttcgtggcaaacatcatcaacagcgcagtcaacaccgccgctt ggtatgtcaacgc cgccatccccaccgcgatattcctagcaaatgccctgaacagtggggcgccggtagcgat cgccgaaggcg ccatcgaggctgccgagggtgccgccagtgcggccgccgcggggttggcggactcggtga cgccagcgg ggctcggcgcaagtttaggcgaggccaccctggtcggccggctgtcagtgccggcggcct ggtctacggcc gcaccggcgacaaccgccggcgccacagcgctcgaaggcagcggctggaccgtcgccgcc gaagaagc cggcccagttaccgggatgatgccgggaatggcctcggccgccaagggcaccggtgccta tgccgggccg cggtacggattcaagcccactgtcatgcccaaacaggtcgtcgtgtga (SEQ ID NO: 12) atggattttggcgccctgcctcccgagatcaacagcgctaggatgtatgctggcgctgga gccggacctatga tggccgctggagccgcctggaatggactggctgccgaactgggcacaacagccgcttcct acgagtccgtg atcaccagactcaccacagagtcctggatgggacctgccagcatggctatggtcgccgct gctcaaccctac ctggcctggctgacctatacagctgaagccgctgctcacgccggaagccaagctatggct agcgccgccgct tatgaggccgcttatgccatgaccgtgcctcccgaggtcgtggctgccaacagagctctc ctggccgccctcg tggctaccaacgtgctgggaatcaacacccccgctattatggccaccgaggctctgtacg ctgagatgtgggc ccaggatgccctcgccatgtacggatacgccgctgcttccggagctgctggaatgctgca gcccctgtcccc cccttcccagaccaccaaccccggaggactggctgctcaaagcgctgctgtgggatccgc tgctgctaccgc tgccgtcaatcaggtcagcgtcgccgacctcatctccagcctgcctaacgctgtgagcgg actggcctcccct gtcacatccgtgctcgatagcaccggcctgtccggcatcatcgccgacattgatgctctc ctcgccacccccttt gtcgccaacatcatcaattccgccgtgaacaccgctgcctggtacgtcaacgctgccatt cccaccgccatctt cctcgccaacgccctgaactccggagctcctgtcgccatcgctgagggcgctattgaggc tgctgaaggagc cgctagcgctgctgctgctggactggctgatagcgtcacccctgctggactcggagctag cctgggagaagc caccctggtcggcagactgtccgtgcctgctgcttggagcaccgctgctcctgctacaac cgctggagctacc gctctggagggatccggatggacagtggctgctgaggaagctggacccgtgaccggaatg atgcctggcat ggccagcgctgctaagggaaccggcgcctatgccggacccagatacggattcaagcccac cgtcatgccca agcaggtcgtcgtctaa (SEQ ID NO: 13)

MDFGALPPEINSARMYAGAGAGPMMAAGAAWNGLAAELGTTAAS

YESVITRLTTESWMGPASMAMVAAAQPYLAWLTYTAEAAAHAGSQ

AMASAAAYEAAYAMTVPPEVVAANRALLAALVATNVLGINTPAIM

ATEALYAEMWAQDALAMYGYAAASGAAGMLQPLSPPSQTTNPGGL

AAQSAAVGSAAATAAVNQVSVADLISSLPNAVSGLASPVTSVLDSTG

LSGIIADIDALLATPFVANIINSAVNTAAWYVNAAIPTAIFLANALNSG

APVAIAEGAIEAAEGAASAAAAGLADSVTPAGLGASLGEATLVGRLS

VPAAWSTAAPATTAGATALEGSGWTVAAEEAGPVTGMMPGMASA

AKGTGAYAGPRYGFKPTVMPKQVVV (SEQ ID NO: 14)

PPE51 atggatttcgcactgttaccaccggaagtcaactccgcccggatgtacaccggccctggg gcaggatcgctgt tggctgccgcgggcggctgggattcgctggccgccgagttggccaccacagccgaggcat atggatcggt gctgtccggactggccgccttgcattggcgtggaccggcagcggaatcgatggcggtgac ggccgctccct atatcggttggctgtacacgaccgccgaaaagacacagcaaacagcgatccaagccaggg cggcagcgct ggccttcgagcaagcatacgcaatgaccctgccgccaccggtggtagcggccaaccggat acagctgctag cactgatcgcgacgaacttcttcggccagaacactgcggcgatcgcggccaccgaggcac agtacgccga gatgtgggcccaggacgccgccgcgatgtacggttacgccaccgcctcagcggctgcggc cctgctgaca ccgttctccccgccgcggcagaccaccaacccggccggcctgaccgctcaggccgccgcg gtcagccag gccaccgacccactgtcgctgctgattgagacggtgacccaagcgctgcaagcgctgacg attccgagcttc atccctgaggacttcaccttccttgacgccatattcgctggatatgccacggtaggtgtg acgcaggatgtcga gtcctttgttgccgggaccatcggggccgagagcaacctaggccttttgaacgtcggcga cgagaatccc gcggaggtgacaccgggcgactttgggatcggcgagttggtttccgcgaccagtcccggc ggtggggtgtc tgcgtcgggtgccggcggtgcggcgagcgtcggcaacacggtgctcgcgagtgtcggccg ggcaaactc gattgggcaactatcggtcccaccgagctgggccgcgccctcgacgcgccctgtctcggc attgtcgcccgc cggcctgaccacactcccggggaccgacgtggccgagcacgggatgccaggtgtaccggg ggtgccagt ggcagcagggcgagcctccggcgtcctacctcgatacggggttcggctcacggtgatggc ccacccaccc gcggcagggtaa (SEQ ID NO: 15)

atggattttgcgctgctgccgccggaagtgaacagcgcgcgcatgtataccggcccg ggcgcgggcagcct gctggcggcggcgggcggctgggatagcctggcggcggaactggcgaccaccgcggaagc gtatggca gcgtgctgagcggcctggcggcgctgcattggcgcggcccggcggcggaaagcatggcgg tgaccgcg gcgccgtatattggctggctgtataccaccgcggaaaaaacccagcagaccgcgattcag gcgcgcgcggc ggcgctggcgtttgaacaggcgtatgcgatgaccctgccgccgccggtggtggcggcgaa ccgcattcagc tgctggcgctgattgcgaccaacttttttggccagaacaccgcggcgattgcggcgaccg aagcgcagtatg cggaaatgtgggcgcaggatgcggcggcgatgtatggctatgcgaccgcgagcgcggcgg cggcgctgc tgaccccgtttagcccgccgcgccagaccaccaacccggcgggcctgaccgcgcaggcgg cggcggtga gccaggcgaccgatccgctgagcctgctgattgaaaccgtgacccaggcgctgcaggcgc tgaccattccg agctttattccggaagattttacctttctggatgcgatttttgcgggctatgcgaccgtg ggcgtgacccaggatg tggaaagctttgtggcgggcaccattggcgcggaaagcaacctgggcctgctgaacgtgg gcgatgaaaac ccggcggaagtgaccccgggcgattttggcattggcgaactggtgagcgcgaccagcccg ggcggcggc gtgagcgcgagcggcgcgggcggcgcggcgagcgtgggcaacaccgtgctggcgagcgtg ggccgcg cgaacagcattggccagctgagcgtgccgccgagctgggcggcgccgagcacccgcccgg tgagcgcgc tgagcccggcgggcctgaccaccctgccgggcaccgatgtggcggaacatggcatgccgg gcgtgccgg gcgtgccggtggcggcgggccgcgcgagcggcgtgctgccgcgctatggcgtgcgcctga ccgtgatgg cgcatccgccggcggcgggcgaattt (SEQ ID NO: 16)

atggatttcgctctgctcccccccgaggtgaatagcgctaggatgtacacaggaccc ggagctggaagcctc ctggctgctgctggaggatgggactccctggctgccgagctcgctacaaccgctgaggct tacggaagcgtg ctctccggcctggctgctctccattggagaggccctgctgccgagtccatggctgtcaca gccgctccctacat tggatggctgtacaccaccgccgagaagacccagcaaaccgctattcaggccagagctgc cgccctggcct tcgaacaggcctacgctatgacactccccccccctgtcgtggctgccaataggatccagc tcctggccctcat cgccaccaacttcttcggccaaaacaccgctgccatcgctgccaccgaagcccagtacgc cgaaatgtggg cccaggatgccgctgctatgtacggctatgccacagctagcgctgccgctgctctgctca cacccttcagccc ccccaggcaaacaaccaaccctgccggactgacagcccaagctgctgccgtcagccaagc taccgacccc ctgagcctcctgatcgaaaccgtgacacaggccctgcaggccctgaccattcccagcttt atccccgaggact tcacctttctggacgctatcttcgctggctacgccaccgtgggcgtgacacaagacgtcg agtccttcgtcgcc ggcacaatcggagccgagtccaacctcggactcctcaacgtcggcgacgaaaatcccgcc gaagtgacac ctggagacttcggcattggagaactcgtcagcgccacatcccctggcggaggagtgagcg cttccggagct ggaggagctgcttccgtgggcaataccgtgctggccagcgtgggaagggccaactccatt ggccagctcag cgtccccccttcctgggctgccccttccacaaggcctgtgtccgctctcagccctgctgg actgaccacactcc ctggcacagacgtggctgagcatggcatgcccggagtgcctggagtccctgtggctgctg gcagagcttcc ggagtcctccctaggtatggcgtgaggctgacagtgatggctcatccccccgctgccgga taa (SEQ ID

NO: 17) MDFALLPPEV SARMYTGPGAGSLLAAAGGWDSLAAELATTAEAY

GSVLSGLAALHWRGPAAESMAVTAAPYIGWLYTTAEKTQQTAIQAR

AAALAFEQAYAMTLPPPVVAANRIQLLALIATNFFGQNTAAIAATEA

QYAEMWAQDAAAMYGYATASAAAALLTPFSPPRQTTNPAGLTAQA

AAVSQATDPLSLLIETVTQALQALTIPSFIPEDFTFLDAIFAGYATVGV

TQDVESFVAGTIGAESNLGLLNVGDENPAEVTPGDFGIGELVSATSPG

GGVSASGAGGAASVGNTVLASVGRANSIGQLSVPPSWAAPSTRPVSA

LSPAGLTTLPGTDVAEHGMPGVPGVPVAAGRASGVLPRYGVRLTVM

AHPPAAG (SEQ ID NO: 18)

Rv3615c atgacggaaaacttgaccgtccagcccgagcgtctcggtgtactggcgtcgcaccatgac aacgcggcggt cgatgcctcctcgggcgtcgaagctgccgctggcctaggcgaatctgtggcgatcactca cggtccgtactg ctcacagttcaacgacacgttaaatgtgtacttgactgcccacaatgccctgggctcgtc cttgcatacggccg gtgtcgatctcgccaaaagtcttcgaattgcggcgaagatatatagcgaggccgacgaag cgtggcgcaag gctatcgacgggttgtttacctga (SEQ ID NO: 19) atgaccgagaacctgaccgtgcagcctgagaggctgggagtgctggccagccaccacgac aacgctgccg tggacgcttccagcggagtggaggctgctgctggactgggagagagcgtggccatcaccc acggacccta ctgcagccagttcaacgacaccctgaacgtgtacctgacagcccacaacgccctgggaag cagcctgcata cagccggcgtggacctggctaagtccctgaggatcgccgccaagatctacagcgaggccg acgaggcctg gaggaaagccatcgacggcctgttcacctaa (SEQ ID NO:20)

MTENLTVQPERLGVLASHHDNAAVDASSGVEAAAGLGESVAITHGP YCSQFNDTLNVYLTAHNALGSSLHTAGVDLAKSLRIAAKIYSEADEA WRKAIDGLFT (SEQ ID NO:21)

In some embodiments, the latent Mtb antigen is Rvl733c, Rv2626c, Rv3407, or Rv2628c. In some embodiments, the latent Mtb antigen is Rvl733c or Rv2626c. Additional latent Mtb antigens are well known to the skilled artisan.

A nucleotide sequence encoding the wild type latent Mtb antigen Rvl733c is shown in

Table 2 as SEQ ID NO:22 (mycobacterial sequence; not codon optimized), SEQ ID NO:23 (E. coli optimized), and an amino acid sequence of wild type Rvl733c is shown in Table 2 as SEQ ID NO:24. These sequences include two transmembrane regions of Rvl733c. A nucleotide sequence encoding Rvl733c, whereby both transmembrane regions are deleted is shown in Table 2 as SEQ ID NO:25 (E. coli optimized) and SEQ ID NO:26 (human optimized), and

corresponding amino acid sequences are shown in Table 2 as SEQ ID NO:27 (E. coli optimized) and SEQ ID NO:28 (human optimized) (RV1733C _A TM). In some embodiments, only a portion of the first and/or second or both transmembrane regions are deleted. In the E. coli optimized nucleotide sequence (SEQ ID NO:23), an Xmal restriction site was added, corresponding to an addition of amino acids PG; and an Xbal restriction site was added, corresponding to an addition of amino acids SR (see underlined and bolded added sequences).

A nucleotide sequence encoding the latent Mtb antigen Rv2626c is shown in Table 2 as SEQ ID NO:29 (mycobacterial sequence; not codon optimized), SEQ ID NO:30 (E. coli optimized), and SEQ ID NO:31 (human optimized), and an amino acid sequence of Rv2626c is shown in Table 2 as SEQ ID NO:32.

A nucleotide sequence encoding the latent Mtb antigen Rv3407 is shown in Table 2 as SEQ ID NO:33 (mycobacterial sequence; not codon optimized), SEQ ID NO:34 (E. coli optimized), and SEQ ID NO:35 (human optimized), and an amino acid sequence of Rv3407 is shown in Table 2 as SEQ ID NO: 36.

A nucleotide sequence encoding the latent Mtb antigen Rv2628c is shown in Table 2 as SEQ ID NO:37 (mycobacterial sequence; not codon optimized) and as SEQ ID NO:38 (human optimized), and an amino acid sequence of Rv2628c is shown in Table 2 as SEQ ID NO:39.

Table 2

#28044985 vl ctasacgcgcaattctgatccgcgttcgcaatgcgagctggcagcacgatattgatagcc tgttttgcaccca acgt (SEQ ID O:25)

atcgccaccaccagggacagggaaggcgctaccatgatcaccttcaggctgaggctcccc tgcaggacca tcctgagggtgttcagcaggaaccccctggtgaggggcaccgacagactggaagccgtgc aggacagca ggagccacgtgtatgcccaccaggctcagaccaggcaccctgctaccgccaccgtgatcg accacgagg gcgtgatcgactccaacaccaccgccaccagcgctcctcccagaaccaagatcacagtgc ccgccaggtg ggtggtgaacggcatcgagaggagcggcgaggtgaacgccaagcctggaaccaagagcgg cgacagg gtgggcatttgggtcgatagcgccggccagctggtggatgaacctgctccccctgccaga gccatcgccg atagggccatcctgatcagggtgaggaacgccagctggcagcacgacatcgacagcctgt tctgcaccca aagg (SEQ ID NO:26)

MIATTRDREGATMITFRLRLP CRTILRVF SRNPLVRGTDRLEAP GVQ DSRSHVYAHQAQTRHPATATVIDHEGVIDSNTTATSAPPRTKITVPA RWVV GIERSGEV AKPGTKSGDRVGIWVDSAGQLVDEPAPPARAI ADSRRAILIRVRNASWQHDIDSLFCTQR (SEQ ID NO:27)

IATTRDREGATMITFRLRLPCRTILRVFSRNPLVRGTDRLEAVQDSRS HVYAHQ AQTRHP ATAT VIDHEGVID SNTTAT S APPRTKIT VP ARWV VNGIERSGEV AKPGTKSGDRVGIWVDSAGQLVDEPAPPARAIADR AILIRVRNASWQHDIDSLFCTQR (SEQ ID NO:28)

Rv2626c atgaccaccgcacgcgacatcatgaacgcaggtgtgacctgtgttggcgaacacgagacg ctaaccgctg ccgctcaatacatgcgtgagcacgacatcggcgcgttgccgatctgcggggacgacgacc ggctgcacg gcatgctcaccgaccgcgacattgtgatcaaaggcctggctgcgggcctagacccgaata ccgccacggc tggcgagttggcccgggacagcatctactacgtcgatgcgaacgcaagcatccaggagat gctcaacgtc atggaagaacatcaggtccgccgtgttccggtcatctcagagcaccgcttggtcggaatc gtcaccgaagc cgacatcgcccgacacctgcccgagcacgccattgtgcagttcgtcaaggcaatctgctc gcccatggccc tcgccagctag (SEQ ID NO:29)

atgaccacggcgcgtgatatcatgaatgcgggtgtcacctgtgttggcgagcacgaaacg ttgaccgcagc agcacagtacatgcgcgaacatgatatcggcgcattgccgatttgcggcgacgatgatcg tctgcacggtat gctgaccgaccgcgatatcgttatcaagggtctggccgcaggcttggacccgaacaccgc gaccgccggt gaactggcacgtgacagcatctattacgtcgacgcgaacgccagcattcaagagatgctg aacgtgatgga agagcatcaggtgcgtcgtgtcccggttatcagcgaacatcgtctggttggtatcgttac cgaagccgacatc gcacgtcacctgccggagcacgcgattgttcagttcgtgaaagcgatttgcagcccgatg gcgttggcgtc

(SEQ ID NO:30)

acaacagccagggacatcatgaacgccggcgtgacctgcgtgggagagcatgaaaccctc accgccgcc gcccaatacatgagggagcacgacatcggcgccctgcccatctgtggagacgacgacagg ctgcacggc atgctgaccgacagggacatcgtgatcaagggcctggctgccggcctcgatcctaacacc gctacagccg gcgagctggccagagacagcatctactacgtggacgccaacgccagcatccaggagatgc tcaacgtgat ggaggagcaccaggtgagaagggtgcctgtgatcagcgagcacaggctggtgggcatcgt gaccgagg ccgatatcgctaggcacctgcccgagcacgccatcgtgcagttcgtgaaggccatctgca gccccatggct ctggccagc (SEQ ID N0:31)

MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRL HGMLTDRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEML VMEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSP MALAS (SEQ ID NO:32)

Rv3407 atgcgtgctaccgttgggcttgtggaggcaatcggaatccgagaactaagacagcacgca tcgcgatacct cgcccgggttgaagccggcgaggaacttggcgtcaccaacaaaggaagacttgtggcccg actcatcccg gtgcaggccgcggagcgttctcgcgaagccctgattgaatcaggtgtcctgattccggct cgtcgtccacaa

#28044985 vl aaccttctcgacgtcaccgccgaaccggcgcgcggccgcaagcgcaccctgtccgatgtt ctcaacgaaat gcgcgacgagcagtga (SEQ ID NO:33)

atgcgtgcgactgtgggtctggttgaggcgattggcattcgcgagctgcgccaacatgcc agccgttacttg gctcgtgtcgaggcgggtgaagaactgggcgtgacgaataagggtcgtctggtcgcccgt ctgattccggt tcaggcagctgagcgttctcgcgaggcgctgattgaatccggcgtcctgatcccggctcg ccgtccgcaaa acctgctggacgtgacggcggagccagctcgtggtcgcaaacgcacgctgtctgatgtcc tgaacgaaatg cgcgacgagcag (SEQ ID NO: 34)

atgagggcgaccgtcgggctggtggaggcgataggtatccgggagttgcgacagcacgca tcacgatatc tggcacgggtggaagctggggaggaactgggcgtgaccaacaaggggcggctggtcgcga ggctgatc cccgtgcaggccgccgagcggtcccgcgaagccctcatcgagtctggggtgctcattcca gcacgcagg ccgcaaaatctcctggacgtcactgcggagcccgccagaggcagaaagaggacgctgagt gacgtgctg aacgagatgagggacgaacag (SEQ ID NO:35)

MRATVGLVEAIGIRELRQHASRYLARVEAGEELGVTNKGRLVARLI PVQAAERSREALIESGVLIPARRPQNLLDVTAEPARGRKRTLSDVLN EMRDEQ (SEQ ID NO:36)

Rv2628c atgtccacgcaacgaccgaggcactccggtattcgggctgttggcccctacgcatgggcc ggccgatgtg gtcggataggcaggtggggggtgcaccaggaggcgatgatgaatctagcgatatggcacc cgcgcaagg tgcaatccgccaccatctatcaggtgaccgatcgctcgcacgacgggcgcacagcacggg tgcctggtga cgagatcactagcaccgtgtccggttggttgtcggagttgggcacccaaagcccgttggc cgatgagcttgc gcgtgcggtgcggatcggcgactggcccgctgcgtacgcaatcggtgagcacctgtccgt tgagattgcc gttgcggtctaa (SEQ ID NO: 37)

atgagcacccagagacccaggcacagcggcattagggccgtgggaccttatgcttgggcc ggcagatgc ggaaggatcggcagatggggcgtgcaccaagaggccatgatgaacctggccatctggcac cccaggaa ggtgcagagcgccaccatctaccaggtgaccgacaggagccatgacggaaggaccgccag agtgcccg gcgatgagatcaccagcaccgtgagcggctggctgagcgaactgggcacccaatcccccc tggctgatga actggccagggctgtgaggatcggcgattggcctgccgcctatgccatcggcgagcatct gagcgtggag atcgccgtggccgtgtaa (SEQ ID NO:38)

MSTQRPRHSGIRAVGPYAWAGRCGRIGRWGVHQEAMMNLAIWHP RKVQSATIYQVTDRSHDGRTARVPGDEITSTVSGWLSELGTQSPLAD ELARAVRIGDWPAAYAIGEHLSVEIAVAV (SEQ ID NO: 39)

In some embodiments, the resuscitation Mtb antigen is RpfB, RpfD, or RpfE. In some embodiments, the resuscitation Mtb antigen is RpfB or RpfD. Additional resuscitation antigens include, but are not limited to, Rv0867c, Rv0288, Rvl009, Rv0685, Rv0824c, Rv2744c, Rv3347c, Rvl 130, Rvl 169c, Rvl884c, Rv2389c, and Rv2450c. In some embodiments, the resuscitation antigen is Rv0867c, Rvl 884c, or Rv2389c. Additional resuscitation Mtb antigens are well known to the skilled artisan. In some embodiments, the resuscitation antigen is not any one or more of the following: Rv0867c, Rv0288, Rvl009, Rv0685, Rv0824c, Rv2744c, Rv3347c, Rvl 130, Rvl 169c, Rvl884c, Rv2389c, and Rv2450c. In some embodiments, the resuscitation antigen is not Rv0867c, Rvl 884c, or Rv2389c.

The resuscitation Mtb antigen RpfB is also known as Rvl009. A nucleotide sequence encoding the resuscitation Mtb antigen RpfB is shown in Table 3 as SEQ ID NO:40 (mycobacterial sequence; not codon optimized) and SEQ ID NO:41 (mycobacterial sequence; signal sequence deleted), and amino acid sequences of RpfB corresponding thereto are shown in Table 3 as SEQ ID NO:42 and SEQ ID NO:43, respectively.

The resuscitation Mtb antigen RpfD is also known as Rv2389c. A nucleotide sequence encoding the resuscitation Mtb antigen RpfD is shown in Table 3 as SEQ ID NO:44

(mycobacterial sequence; not codon optimized), SEQ ID NO:45 (E. coli optimized; leader sequence deleted) and SEQ ID NO:46 (human optimized; leader sequence present), and amino acid sequences of RpfD are shown in Table 3 as SEQ ID NO:47 (E. coli optimized) and SEQ ID NO:48 (mycobacterial sequence and human optimized).

The resuscitation Mtb antigen RpfE is also known as Rv2450c. A nucleotide sequence encoding the resuscitation Mtb antigen RpfE is shown in Table 3 as SEQ ID NO:49

(mycobacterial sequence; not codon optimized), and an amino acid sequence of RpfE is shown in Table 3 as SEQ ID NO:50.

Table 3

#28044985 vl ccaggatgtgacgttcgcggtagctgaggtcaacggcgtcgagaccggccgtttgcccgt cgccaacgtcgt ggtgaccccggcccacgaagccgtggtgcgggtgggcaccaagcccggtaccgaggtgcc cccggtgat cgacggaagcatctgggacgcgatcgccggctgtgaggccggtggcaactgggcgatcaa caccggcaa cgggtattacggtggtgtgcagtttgaccagggcacctgggaggccaacggcgggctgcg gtatgcacccc gcgctgacctcgccacccgcgaagagcagatcgccgttgccgaggtgacccgactgcgtc aaggttgggg cgcctggccggtatgtgctgcacgagcgggtgcgcgctga (SEQ ID N0:41)

MLRLVVGALLLVLAFAGGYAVAACKTVTLTVDGTAMRVTTMKSRV

IDIVEENGFSVDDRDDLYPAAGVQVHDADTIVLRRSRPLQISLDGHDA

KQVWTTASTVDEALAQLAMTDTAPAAASRASRVPLSGMALPVVSA

KTVQLNDGGLVRTVHLPAPNVAGLLSAAGVPLLQSDHVVPAATAPI

VEGMQIQVTRNRIKKVTERLPLPPNARRVEDPEMNMSREVVEDPGVP

GTQDVTFAVAEV GVETGRLPVANVVVTPAHEAVVRVGTKPGTEVP

PVIDGSIWDAIAGCEAGGNWAINTGNGYYGGVQFDQGTWEANGGL

RYAPRADLATREEQIAVAEVTRLRQGWGAWPVCAARAGAR (SEQ

ID NO:42)

ACKTVTLTVDGTAMRVTTMKSRVIDIVEENGFSVDDRDDLYPAAGV

QVHDADTIVLRRSRPLQISLDGHDAKQVWTTASTVDEALAQLAMTD

TAPAAASRASRVPLSGMALPVVSAKTVQLNDGGLVRTVHLPAPNVA

GLLSAAGVPLLQSDHVVPAATAPIVEGMQIQVTRNRIKKVTERLPLPP

NARRVEDPEMNMSREVVEDPGVPGTQDVTFAVAEV GVETGRLPV

ANVVVTPAHEAVVRVGTKPGTEVPPVIDGSIWDAIAGCEAGGNWAI

NTGNGYYGGVQFDQGTWEANGGLRYAPRADLATREEQIAVAEVTR

LRQGWGAWPVCAARAGAR (SEQ ID NO: 43)

RpfD atgacaccgggtttgcttactactgcgggtgctggccgaccacgtgacaggtgcgccagg atcgtatgcacg gtgttcatcgaaaccgccgttgtcgcgaccatgtttgtcgcgttgttgggtctgtccacc atcagctcgaaagcc gacgacatcgattgggacgccatcgcgcaatgcgaatccggcggcaattgggcggccaac accggtaacg ggttatacggtggtctgcagatcagccaggcgacgtgggattccaacggtggtgtcgggt cgccggcggcc gcgagtccccagcaacagatcgaggtcgcagacaacattatgaaaacccaaggcccgggt gcgtggccga aatgtagttcttgtagtcagggagacgcaccgctgggctcgctcacccacatcctgacgt tcctcgcggccga gactggaggttgttcggggagcagggacgattga (SEQ ID NO:44)

aagcttttgctgggcctgagcaccattagcagcaaagcggatgacatcgactgggatgcg attgcgcagtgtg agagcggtggcaattgggcagcgaataccggcaatggcctgtacggcggtctgcagatct cccaggcgac gtgggacagcaatggtggcgtcggcagcccggctgccgcgtccccacaacaacagatcga ggtggcagat aacattatgaaaacgcagggtccgggtgcttggccaaaatgctccagctgcagccagggt gacgcaccgct gggcagcctgacccacattctgacgttcctggcagcggaaaccggtggttgtagcggtag ccgcgatgac

(SEQ ID NO:45)

acccccggactcctcaccacagctggagctggcaggcccagagacagatgcgccaggatc gtgtgcaccg tgttcatcgagaccgccgtggtggctaccatgttcgtggccctgctgggcctgagcacca tcagcagcaagg ccgacgacatcgactgggacgccatcgcccagtgtgaatccggcggaaactgggccgcca ataccggcaa tggcctgtacggcggcctgcagatcagccaggctacctgggactccaacggaggagtggg aagccctgcc gctgcttcccctcagcagcagatcgaggtggccgacaacatcatgaagacccaaggccct ggcgcctggcc taagtgttccagctgtagccagggcgatgctcctctgggcagcctgacccacatcctgac ctttctcgccgccg agacaggcggatgtagcggaagcagggacgactaatga (SEQ ID NO:46)

LLGLSTISSKADDIDWDAIAQCESGGNWAANTGNGLYGGLQISQAT WDSNGGVGSPAAASPQQQIEVADNIMKTQGPGAWPKCSSCSQGDAP LGSLTHILTFLAAETGGCSGSRDD (SEQ ID NO:47)

#28044985 vl TPGLLTTAGAGRPRDRCARIVCTVFIETAVVATMFVALLGLSTISSKA DDIDWDAIAQCESGGNWAANTGNGLYGGLQISQATWDSNGGVGSP AAASPQQQIEVADNIMKTQGPGAWPKCSSCSQGDAPLGSLTHILTFL AAETGGCSGSRDD (SEQ ID NO:48)

Rpffi ttgaagaacgcccgtacgacgctcatcgccgccgcgattgccgggacgttggtgaccacg tcaccagccgg tatcgccaatgccgacgacgcgggcttggacccaaacgccgcagccggcccggatgccgt gggctttgacc cgaacctgccgccggccccggacgctgcacccgtcgatactccgccggctccggaggacg cgggctttgat cccaacctccccccgccgctggccccggacttcctgtccccgcctgcggaggaagcgcct cccgtgcccgt ggcctacagcgtgaactgggacgcgatcgcgcagtgcgagtccggtggaaactggtcgat caacaccggta acggttactacggcggcctgcggttcaccgccggcacctggcgtgccaacggtggctcgg ggtccgcggc caacgcgagccgggaggagcagatccgggtggctgagaacgtgctgcgttcgcagggtat ccgcgcctgg ccggtctgcggccgccgcggctga (SEQ ID NO:49)

LKNARTTLIAAAIAGTLVTTSPAGIANADDAGLDPNAAAGPDAVGFD PNLPPAPDAAPVDTPPAPEDAGFDPNLPPPLAPDFLSPPAEEAPPVPVA YSV WDAIAQCESGGNWSINTGNGYYGGLRFTAGTWRANGGSGSA ANASREEQIRVAENVLRSQGIRAWPVCGRRG (SEQ ID NO:50)

In some embodiments, the fusion protein comprises at least four Mycobacterium tuberculosis (Mtb) antigens. In some embodiments, the fusion protein comprises at least five Mtb antigens. In some embodiments, the fusion protein comprises at least six Mtb antigens. In some embodiments, the fusion protein comprises from at least three to at least six Mtb antigens. In some embodiments, the fusion protein comprises from at least three to at least five Mtb antigens. In some embodiments, the fusion protein comprises at least three or at least four Mtb antigens. In some embodiments, the fusion protein comprises from at least four to at least six Mtb antigens. In some embodiments, the fusion protein comprises at least four or at least five Mtb antigens.

In some embodiments, the fusion protein comprises ESAT6, Rvl733c, Rv2626c, and RpfD Mtb antigens. In some embodiments, the fusion protein comprises ESAT6, Rvl733c, Rv2626c, and RpfB Mtb antigens. In some embodiments, the fusion protein comprises RpfB, ESAT6, Rvl733c, and Rv2626c Mtb antigens. In some embodiments, the fusion protein comprises Ag85B, ESAT6, Rvl733c, Rv2626c, and RpfD Mtb antigens. In some embodiments, the fusion protein comprises Ag85B, ESAT6, Rvl733c, Rv2626c, and RpfB Mtb antigens. In some embodiments, the fusion protein comprises PPE51, Rvl733c, Rv2628c, and RpfD Mtb antigens. In some embodiments, the fusion protein comprises PPE51, Rvl733c, Rv2628c, and RpfB Mtb antigens. In some embodiments, the fusion protein comprises Rv3407, Rvl733c, Rv2626c, and RpfB Mtb antigens. In some embodiments, the fusion protein comprises Rv3407, Rvl733c, Rv2626c, and RpfD Mtb antigens.

In any of the embodiments of fusion proteins set forth herein, the individual Mtb antigens can be present in any order. For example, for a fusion protein comprising ESAT6,

#28044985 vl Rvl733c, Rv2626c, and RpfD Mtb antigens, the first (or N-terminal) antigen may be ESAT6, Rvl733c, Rv2626c, or RpfD; the second antigen may be ESAT6, Rvl733c, Rv2626c, or RpfD; the third antigen may be ESAT6, Rvl733c, Rv2626c, or RpfD; and the fourth (or

C-terminal) antigen may be ESAT6, Rvl733c, Rv2626c, or RpfD. Likewise for every fusion protein disclosed herein.

Individual Mtb antigens may be linked together in a C-terminus to N-terminus manner without any linker (i.e., the C-terminus of ESAT6 linked directly to the N-terminus of Rvl733c). Alternately, a linker may be present between any two Mtb antigens within any of the fusion proteins disclosed herein. In some embodiments, the linker is a segment of DNA or RNA optionally containing one or more restrictions sites, wherein the linker is inserted between nucleic acid molecules encoding two Mtb antigens of any of the fusion proteins disclosed herein. Table 5 shows representative primers for particular Mtb antigens used to introduce restriction sites into a fusion protein construct.

In some embodiments, the fusion protein comprises ESAT6-Rvl733c-Rv2626c-RpfD (Construct A; nucleotide sequence is SEQ ID NO:51 (E. coli optimized; inserted EcoRI, Sacl, and Hindlll restriction sites, respectively, are bolded and underlined) and SEQ ID NO:52 (human optimized; inserted BstBI, Pvul, and Ascl restriction sites, respectively, are bolded and underlined); corresponding amino acid sequences are SEQ ID NO:53 (E. coli optimized) and SEQ ID NO:54 (human optimized); see Table 4).

In some embodiments, the fusion protein comprises ESAT6-Rvl733c-Rv2626c-RpfB

(Construct B; nucleotide sequence is SEQ ID NO:55, wherein inserted EcoRI, Sacl, and Hindlll restrictions sites, respectively, are bolded and underlined; amino acid sequence is SEQ ID NO:56; see Table 4).

In some embodiments, the fusion protein comprises RpfB-ESAT6-Rvl733c-Rv2626c (Construct C; nucleotide sequence is SEQ ID NO:57, wherein inserted BamHI, EcoRI, and Sacl restrictions sites, respectively, are bolded and underlined; amino acid sequence is SEQ ID NO:58; see Table 4).

In some embodiments, the fusion protein comprises Ag85B-ESAT6-Rvl733c-Rv2626c- RpfD (Construct D; nucleotide sequence is SEQ ID NO:59 (E. coli optimized; inserted BamHI, EcoRI, Sacl, and Hindlll restriction sites, respectively, are bolded and underlined) and SEQ ID NO:60 (human optimized; inserted Xmal, BstBI, Pvul, and Ascl restriction sites, respectively, are bolded and underlined); amino acid sequence is SEQ ID NO:61 (E. coli optimized) and SEQ ID NO:62 (human optimized); see Table 4).

#28044985 vl In some embodiments, the fusion protein comprises PPE51-Rvl733c-Rv2628c-Rp£D (Construct E; nucleotide sequence is SEQ ID NO:63, wherein inserted EcoRI, Sacl, and Hindlll restrictions sites, respectively, are bolded and underlined; amino acid sequence is SEQ ID NO:64; see Table 4).

In some embodiments, the fusion protein comprises PPE5 l-Rvl733c-Rv2628c-RpfB

(Construct F; nucleotide sequence is SEQ ID NO:65, wherein inserted EcoRI, Sail, and Hindlll restrictions sites, respectively, are bolded and underlined; amino acid sequence is SEQ ID NO:66; see Table 4).

In some embodiments, the fusion protein comprises Rv3407-Rvl733c-Rv2626c-RpfB (Construct G; nucleotide sequence is SEQ ID NO: 67, wherein inserted EcoRI, Sacl, and Hindlll restrictions sites, respectively, are bolded and underlined; amino acid sequence is SEQ ID NO:68; see Table 4).

In some embodiments, the fusion protein comprises Rv3407-Rvl733c-Rv2626c-RpfD (Construct H; nucleotide sequence is SEQ ID NO: 69, wherein inserted EcoRI, Sacl, and Hindlll restrictions sites, respectively, are bolded and underlined; amino acid sequence is SEQ ID NO:70; see Table 4).

In some embodiments, the fusion protein comprises PPE51-Rvl733c-Rv2626c-RpfD (Construct I; nucleotide sequence is SEQ ID NO:71, wherein inserted EcoRI, Sacl, and Hindlll restrictions sites, respectively, are bolded and underlined; amino acid sequence is SEQ ID NO:72; see Table 4).

In some embodiments, the fusion protein comprises PPE51-Rvl733c-Rv2626c-RpfB (Construct J; nucleotide sequence is SEQ ID NO:73, wherein inserted EcoRI, Sacl, and Hindlll restrictions sites, respectively, are bolded and underlined; amino acid sequence is SEQ ID NO:74; see Table 4).

Table 4

#28044985 vl cgtgagctcatgaccacggcgcgtgatatcatgaatgcgggtgtcacctgtgttggcgag cacgaaacgttg accgcagcagcacagtacatgcgcgaacatgatatcggcgcattgccgatttgcggcgac gatgatcgtctg cacggtatgctgaccgaccgcgatatcgttatcaagggtctggccgcaggcttggacccg aacaccgcgacc gccggtgaactggcacgtgacagcatctattacgtcgacgcgaacgccagcattcaagag atgctgaacgtg atggaagagcatcaggtgcgtcgtgtcccggttatcagcgaacatcgtctggttggtatc gttaccgaagccg acatcgcacgtcacctgccggagcacgcgattgttcagttcgtgaaagcgatttgcagcc cgatggcgttggc gtctaagcttttgctgggcctgagcaccattagcagcaaagcggatgacatcgactggga tgcgattgcgca gtgtgagagcggtggcaattgggcagcgaataccggcaatggcctgtacggcggtctgca gatctcccagg cgacgtgggacagcaatggtggcgtcggcagcccggctgccgcgtccccacaacaacaga tcgaggtggc agataacattatgaaaacgcagggtccgggtgcttggccaaaatgctccagctgcagcca gggtgacgcacc gctgggcagcctgacccacattctgacgttcctggcagcggaaaccggtggttgtagcgg tagccgcgatga c = (SEQ ID N0:51)

atgaccgagcagcagtggaacttcgccggcatcgaagctgccgctagcgccatccaa ggcaacgtgacca gcatccacagcctgctggacgagggcaagcagagcctgaccaagctggctgctgcttggg gcggatccgg aagcgaagcctaccagggcgtgcagcagaagtgggacgccacagccaccgagctgaacaa cgccctgca gaacctcgccagaaccatcagcgaggccggacaggctatggccagcacagagggcaatgt gaccggcat gttcgccttcgaaatcgccaccaccagggacagggaaggcgctaccatgatcaccttcag gctgaggctcc cctgcaggaccatcctgagggtgttcagcaggaaccccctggtgaggggcaccgacagac tggaagccgt gcaggacagcaggagccacgtgtatgcccaccaggctcagaccaggcaccctgctaccgc caccgtgatc gaccacgagggcgtgatcgactccaacaccaccgccaccagcgctcctcccagaaccaag atcacagtgc ccgccaggtgggtggtgaacggcatcgagaggagcggcgaggtgaacgccaagcctggaa ccaagagc ggcgacagggtgggcatttgggtcgatagcgccggccagctggtggatgaacctgctccc cctgccagagc catcgccgatagggccatcctgatcagggtgaggaacgccagctggcagcacgacatcga cagcctgttct gcacccaaaggcgatcgacaacagccagggacatcatgaacgccggcgtgacctgcgtgg gagagcatg aaaccctcaccgccgccgcccaatacatgagggagcacgacatcggcgccctgcccatct gtggagacga cgacaggctgcacggcatgctgaccgacagggacatcgtgatcaagggcctggctgccgg cctcgatccta acaccgctacagccggcgagctggccagagacagcatctactacgtggacgccaacgcca gcatccagga gatgctcaacgtgatggaggagcaccaggtgagaagggtgcctgtgatcagcgagcacag gctggtgggc atcgtgaccgaggccgatatcgctaggcacctgcccgagcacgccatcgtgcagttcgtg aaggccatctgc agccccatggctctggccagcggcgcgcccacccccggactcctcaccacagctggagct ggcaggccca gagacagatgcgccaggatcgtgtgcaccgtgttcatcgagaccgccgtggtggctacca tgttcgtggccct gctgggcctgagcaccatcagcagcaaggccgacgacatcgactgggacgccatcgccca gtgtgaatcc ggcggaaactgggccgccaataccggcaatggcctgtacggcggcctgcagatcagccag gctacctggg actccaacggaggagtgggaagccctgccgctgcttcccctcagcagcagatcgaggtgg ccgacaacatc atgaagacccaaggccctggcgcctggcctaagtgttccagctgtagccagggcgatgct cctctgggcagc ctgacccacatcctgacctttctcgccgccgagacaggcggatgtagcggaagcagggac gactaatgatag

(SEQ ID NO:52)

MTEQQW FAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGS

GSEAYQGVQQKWDATATEL ALQNLARTISEAGQAMASTEGNVT

GMFAEFMIATTRDREGATMITFRLRLPCRTILRVFSRNPLVRGTDRLE

APGVQDSRSHVYAHQAQTRHPATATVIDHEGVIDSNTTATSAPPRTKI

TVPARWVV GIERSGEVNAKPGTKSGDRVGIWVDSAGQLVDEPAPP

ARAIADSRRAILIRVRNASWQHDIDSLFCTQRELMTTARDIMNAGVT

CVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLA

AGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISE

HRLVGIVTEADIARHLPEHAIVQFVKAICSPMALASKLLLGLSTISSKA

DDIDWDAIAQCESGGNWAANTGNGLYGGLQISQATWDSNGGVGSP

AAASPQQQIEVADNIMKTQGPGAWPKCSSCSQGDAPLGSLTHILTFL

AAETGGCSGSRDD (SEQ ID NO:53) MTEQQW FAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGS

GSEAYQGVQQKWDATATEL ALNLARTISEAGQAMASTEGNVTG

MFAFEIATTRDREGATMITFRLRLPCRTILRVFSR PLVRGTDRLEAV

QD SRSHVYAHQ AQTRHP AT ATVIDHEGVID SNTT AT S APPRTKITVP A

RWVV GIERSGEV AKPGTKSGDRVGIWVDSAGQLVDEPAPPARAI

ADRAILIRVR ASWQHDIDSLFCTQRRSTTARDIMNAGVTCVGEHET

LTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPNT

ATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIV

TEADIARHLPEHAIVQFVKAICSPMALASGAPTPGLLTTAGAGRPRDR

CARIVCTVFIETAVVATMFVALLGLSTISSKADDIDWDAIAQCESGGN

WAANTGNGLYGGLQISQATWDSNGGVGSPAAASPQQQIEVADNIMK

TQGPGAWPKCSSCSQGDAPLGSLTHILTFLAAETGGCSGSRDD (SEQ

ID NO:54)

B atgacagagcagcagtggaatttcgcgggtatcgaggccgcggcaagcgcaatccaggga aatgtcacgtc cattcattccctccttgacgaggggaagcagtccctgaccaagctcgcagcggcctgggg cggtagcggttc ggaggcgtaccagggtgtccagcaaaaatgggacgccacggctaccgagctgaacaacgc gctgcagaa cctggcgcggacgatcagcgaagccggtcaggcaatggcttcgaccgaaggcaacgtcac tgggatgttcg casaattcatgatteceactaccceteatceteaeeececeaccatgatcacettccetc tecetcteccetet cgcaccattttgcgcgtgttttcgcgtaacccgctggtccgcggtaccgaccgtctggag gccgttgtcatgct gctggcggttaccgtgagcctgctgacgatcccattcgcagcggcagctggcacggccgt ccaagacagcc gtagccatgtgtatgctcaccaggctcaaacccgtcacccggctactgccactgttatcg atcacgaaggcgt gattgactccaataccacggcaacctccgcaccgcctcgcaccaagattacggttcctgc gcgttgggtggtg aatggtattgaacgcagcggcgaagttaatgccaaaccgggtaccaaaagcggtgaccgt gtgggcatctg ggtcgatagcgccggtcagctggtcgacgagccggcaccgccagcgcgtgcgatcgccga tgcggcgct ggctgccctgggtctgtggctgagcgtggcagcggtcgccggtgcgttgctggcgctgac gcgcgcaattct gatccgcgttcgcaatgcgagctggcagcacgatattgatagcctgttttgcacccaacg tsasctcatgacc acggcgcgtgatatcatgaatgcgggtgtcacctgtgttggcgagcacgaaacgttgacc gcagcagcaca gtacatgcgcgaacatgatatcggcgcattgccgatttgcggcgacgatgatcgtctgca cggtatgctgacc gaccgcgatatcgttatcaagggtctggccgcaggcttggacccgaacaccgcgaccgcc ggtgaactggc acgtgacagcatctattacgtcgacgcgaacgccagcattcaagagatgctgaacgtgat ggaagagcatca ggtgcgtcgtgtcccggttatcagcgaacatcgtctggttggtatcgttaccgaagccga catcgcacgtcacc tgccggagcacgcgattgttcagttcgtgaaagcgatttgcagcccgatggcgttggcgt ctcgtcaaaaggg cgacacaaaatttattctaaatgcaaagcttgcatgcaaaacggtgacgttgaccgtcga cggaaccgcgatg cgggtgaccacgatgaaatcgcgggtgatcgacatcgtcgaagagaacgggttctcagtc gacgaccgcga cgacctgtatcccgcggccggcgtgcaggtccatgacgccgacaccatcgtgctgcggcg tagccgtccgc tgcagatctcgctggatggtcacgacgctaagcaggtgtggacgaccgcgtcgacggtgg acgaggcgctg gcccaactcgcgatgaccgacacggcgccggccgcggcttctcgcgccagccgcgtcccg ctgtccggga tggcgctaccggtcgtcagcgccaagacggtgcagctcaacgacggcgggttggtgcgca cggtgcacttg ccggcccccaatgtcgcggggctgctgagtgcggccggcgtgccgctgttgcaaagcgac cacgtggtgc ccgccgcgacggccccgatcgtcgaaggcatgcagatccaggtgacccgcaatcggatca agaaggtcac cgagcggctgccgctgccgccgaacgcgcgtcgtgtcgaggacccggagatgaacatgag ccgggaggt cgtcgaagacccgggggttccggggacccaggatgtgacgttcgcggtagctgaggtcaa cggcgtcgag accggccgtttgcccgtcgccaacgtcgtggtgaccccggcccacgaagccgtggtgcgg gtgggcacca agcccggtaccgaggtgcccccggtgatcgacggaagcatctgggacgcgatcgccggct gtgaggccg gtggcaactgggcgatcaacaccggcaacgggtattacggtggtgtgcagtttgaccagg gcacctgggag gccaacggcgggctgcggtatgcaccccgcgctgacctcgccacccgcgaagagcagatc gccgttgccg aggtgacccgactgcgtcaaggttggggcgcctggccggtatgtgctgcacgagcgggtg cgcgctga

(SEQ ID NO:55)

MTEQQW FAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGS

#28044985 vl GSEAYQGVQQKWDATATEL ALQNLARTISEAGQAMASTEGNVT

GMFAEFMIATTRDREGATMITFRLRLPCRTILRVFSRNPLVRGTDRLE

AVVMLLAVTVSLLTIPFAAAAGTAVQDSRSHVYAHQAQTRHPATAT

VIDHEGVIDSNTTATSAPPRTKITVPARWVV GIERSGEV AKPGTKS

GDRVGIWVDSAGQLVDEPAPPARAIADAALAALGLWLSVAAVAGA

LLALTRAILIRVRNASWQHDIDSLFCTQRELMTTARDIMNAGVTCVG

EHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGL

DPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRL

VGIVTEADIARHLPEHAIVQFVKAICSPMALASRQKGDTKFILNAKLA

CKTVTLTVDGTAMRVTTMKSRVIDIVEENGFSVDDRDDLYPAAGVQ

VHDADTIVLRRSRPLQISLDGHDAKQVWTTASTVDEALAQLAMTDT

APAAASRASRVPLSGMALPVVSAKTVQLNDGGLVRTVHLPAPNVAG

LLSAAGVPLLQSDHVVPAATAPIVEGMQIQVTRNRIKKVTERLPLPPN

ARRVEDPEMNMSREVVEDPGVPGTQDVTFAVAEV GVETGRLPVA

NVVVTPAHEAVVRVGTKPGTEVPPVIDGSIWDAIAGCEAGGNWAINT

GNGYYGGVQFDQGTWEANGGLRYAPRADLATREEQIAVAEVTRLR

QGWGAWPVCAARAGAR (SEQ ID NO:56)

c atgaagcttgcatgcaaaacggtgacgttgaccgtcgacggaaccgcgatgcgggtgacc acgatgaaatc gcgggtgatcgacatcgtcgaagagaacgggttctcagtcgacgaccgcgacgacctgta tcccgcggccg gcgtgcaggtccatgacgccgacaccatcgtgctgcggcgtagccgtccgctgcagatct cgctggatggtc acgacgctaagcaggtgtggacgaccgcgtcgacggtggacgaggcgctggcccaactcg cgatgaccg acacggcgccggccgcggcttctcgcgccagccgcgtcccgctgtccgggatggcgctac cggtcgtcag cgccaagacggtgcagctcaacgacggcgggttggtgcgcacggtgcacttgccggcccc caatgtcgcg gggctgctgagtgcggccggcgtgccgctgttgcaaagcgaccacgtggtgcccgccgcg acggccccg atcgtcgaaggcatgcagatccaggtgacccgcaatcggatcaagaaggtcaccgagcgg ctgccgctgcc gccgaacgcgcgtcgtgtcgaggacccggagatgaacatgagccgggaggtcgtcgaaga cccgggggt tccggggacccaggatgtgacgttcgcggtagctgaggtcaacggcgtcgagaccggccg tttgcccgtcg ccaacgtcgtggtgaccccggcccacgaagccgtggtgcgggtgggcaccaagcccggta ccgaggtgc ccccggtgatcgacggaagcatctgggacgcgatcgccggctgtgaggccggtggcaact gggcgatcaa caccggcaacgggtattacggtggtgtgcagtttgaccagggcacctgggaggccaacgg cgggctgcgg tatgcaccccgcgctgacctcgccacccgcgaagagcagatcgccgttgccgaggtgacc cgactgcgtca aeetteeeececcteecceetatetectecaceaeceeetecececssatccateacaea ecaecaetee aatttcgcgggtatcgaggccgcggcaagcgcaatccagggaaatgtcacgtccattcat tccctccttgacg aggggaagcagtccctgaccaagctcgcagcggcctggggcggtagcggttcggaggcgt accagggtgt ccagcaaaaatgggacgccacggctaccgagctgaacaacgcgctgcagaacctggcgcg gacgatcag cgaagccggtcaggcaatggcttcgaccgaaggcaacgtcactgggatgttcgcagaatt catgattgcgac tacccgtgatcgtgagggcgcgaccatgatcacgttccgtctgcgtctgccgtgtcgcac cattttgcgcgtgtt ttcgcgtaacccgctggtccgcggtaccgaccgtctggaggccgttgtcatgctgctggc ggttaccgtgagc ctgctgacgatcccattcgcagcggcagctggcacggccgtccaagacagccgtagccat gtgtatgctcac caggctcaaacccgtcacccggctactgccactgttatcgatcacgaaggcgtgattgac tccaataccacgg caacctccgcaccgcctcgcaccaagattacggttcctgcgcgttgggtggtgaatggta ttgaacgcagcg gcgaagttaatgccaaaccgggtaccaaaagcggtgaccgtgtgggcatctgggtcgata gcgccggtcag ctggtcgacgagccggcaccgccagcgcgtgcgatcgccgatgcggcgctggctgccctg ggtctgtggct gagcgtggcagcggtcgccggtgcgttgctggcgctgacgcgcgcaattctgatccgcgt tcgcaatgcga gctggcagcacgatattgatagcctgttttgcacccaacgtgasctcatgaccacggcgc gtgatatcatgaat gcgggtgtcacctgtgttggcgagcacgaaacgttgaccgcagcagcacagtacatgcgc gaacatgatatc ggcgcattgccgatttgcggcgacgatgatcgtctgcacggtatgctgaccgaccgcgat atcgttatcaagg gtctggccgcaggcttggacccgaacaccgcgaccgccggtgaactggcacgtgacagca tctattacgtc gacgcgaacgccagcattcaagagatgctgaacgtgatggaagagcatcaggtgcgtcgt gtcccggttatc agcgaacatcgtctggttggtatcgttaccgaagccgacatcgcacgtcacctgccggag cacgcgattgttc

#28044985 vl agttcgtgaaagcgatttgcagcccgatggcgttggcgtctcgtcaaaagggcgacacaa aatttattctaaat gcatga (SEQ ID NO: 57)

MKLACKTVTLTVDGTAMRVTTMKSRVIDIVEENGFSVDDRDDLYPA

AGVQVHDADTIVLRRSRPLQISLDGHDAKQVWTTASTVDEALAQLA

MTDTAPAAASRASRVPLSGMALPVVSAKTVQLNDGGLVRTVHLPAP

NVAGLLSAAGVPLLQSDHVVPAATAPIVEGMQIQVTRNRIKKVTERL

PLPPNARRVEDPEMNMSREVVEDPGVPGTQDVTFAVAEVNGVETGR

LPVANVVVTPAHEAVVRVGTKPGTEVPPVIDGSIWDAIAGCEAGGN

WAINTGNGYYGGVQFDQGTWEANGGLRYAPRADLATREEQIAVAE

VTRLRQGWGAWPVCAARAGARGSMTEQQWNFAGIEAAASAIQGNV

TSIHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATELNNA

LQNLARTISEAGQAMASTEGNVTGMFAEFMIATTRDREGATMITFRL

RLPCRTILRVFSRNPLVRGTDRLEAVVMLLAVTVSLLTIPFAAAAGTA

VQDSRSHVYAHQAQTRHPATATVIDHEGVIDSNTTATSAPPRTKITVP

ARWVVNGIERSGEVNAKPGTKSGDRVGIWVDSAGQLVDEPAPPARA

IADAALAALGLWLSVAAVAGALLALTRAILIRVRNASWQHDIDSLFC

TQRELMTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGD

DDRLHGMLTDRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQ

EMLNVMEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAIC

SPMALASRQKGDTKFILNA (SEQ ID NO: 58)

D atgtttagccgtcctggcctgccagttgaatacctgcaagttccgagcccgtccatgggt cgtgacattaaggt gcagttccagagcggcggtaacaatagcccggctgtgtacctgctggacggtctgcgtgc gcaggatgatta caacggctgggacatcaataccccggcatttgagtggtattaccagtcgggtctgagcat tgtgatgccggttg gcggtcaaagcagcttctatagcgattggtacagcccggcatgcggcaaggctggttgcc aaacctacaagt gggaaactttcttgaccagcgagctgccgcaatggttgagcgccaaccgtgcggtcaaac cgaccggt agcgctgctattggcctgtccatggccggcagcagcgcgatgatcttggcggcataccat ccgcagcagttta tctacgccggtagcctgagcgcattgctggacccgagccaaggcatgggtccgagcctga ttggtctggcaa tgggtgacgcaggtggttacaaagcggccgatatgtggggcccatctagcgacccggcat gggagcgtaat gacccgacccagcaaattccgaaactggtggcgaataacacgcgcctgtgggtctactgt ggcaatggtacg ccgaacgagctgggtggcgcgaatatccctgcggagtttctggaaaactttgttcgcagc agcaacctgaaat tccaggacgcgtataacgcagccggtggtcacaatgcggttttcaatttcccgccaaatg gcactcatagctgg eaetacteeeetececaetteaacecaateaaaeeceatctecaatcctctcteeetece eecssatccate acagagcagcagtggaatttcgcgggtatcgaggccgcggcaagcgcaatccagggaaat gtcacgtccat tcattccctccttgacgaggggaagcagtccctgaccaagctcgcagcggcctggggcgg tagcggttcgg aggcgtaccagggtgtccagcaaaaatgggacgccacggctaccgagctgaacaacgcgc tgcagaacct ggcgcggacgatcagcgaagccggtcaggcaatggcttcgaccgaaggcaacgtcactgg gatgttcgca saattcatgattgcgactacccgtgatcgtgagggcgcgaccatgatcacgttccgtctg cgtctgccgtgtc gcaccattttgcgcgtgttttcgcgtaacccgctggtccgcggtaccgaccgtctggagg cccccggggtcca agacagccgtagccatgtgtatgctcaccaggctcaaacccgtcacccggctactgccac tgttatcgatcac gaaggcgtgattgactccaataccacggcaacctccgcaccgcctcgcaccaagattacg gttcctgcgcgtt gggtggtgaatggtattgaacgcagcggcgaagttaatgccaaaccgggtaccaaaagcg gtgaccgtgtg ggcatctgggtcgatagcgccggtcagctggtcgacgagccggcaccgccagcgcgtgcg atcgccgatt ctagacgcgcaattctgatccgcgttcgcaatgcgagctggcagcacgatattgatagcc tgttttgcacccaa cgtgasctcatgaccacggcgcgtgatatcatgaatgcgggtgtcacctgtgttggcgag cacgaaacgttg accgcagcagcacagtacatgcgcgaacatgatatcggcgcattgccgatttgcggcgac gatgatcgtctg cacggtatgctgaccgaccgcgatatcgttatcaagggtctggccgcaggcttggacccg aacaccgcgacc gccggtgaactggcacgtgacagcatctattacgtcgacgcgaacgccagcattcaagag atgctgaacgtg atggaagagcatcaggtgcgtcgtgtcccggttatcagcgaacatcgtctggttggtatc gttaccgaagccg acatcgcacgtcacctgccggagcacgcgattgttcagttcgtgaaagcgatttgcagcc cgatggcgttggc gtctaagcttttgctgggcctgagcaccattagcagcaaagcggatgacatcgactggga tgcgattgcgca

#28044985 vl gtgtgagagcggtggcaattgggcagcgaataccggcaatggcctgtacggcggtctgca gatctcccagg cgacgtgggacagcaatggtggcgtcggcagcccggctgccgcgtccccacaacaacaga tcgaggtggc agataacattatgaaaacgcagggtccgggtgcttggccaaaatgctccagctgcagcca gggtgacgcacc gctgggcagcctgacccacattctgacgttcctggcagcggaaaccggtggttgtagcgg tagccgcgatga c (SEQ ID NO:59)

atgttctccaggcccggcctgcctgtcgagtatctgcaggtcccctccccctccatg ggcagagacatcaagg tgcagttccaatccggaggcaacaacagccccgccgtgtatctcctcgacggcctgaggg ctcaggacgact acaacggctgggacatcaacacccccgccttcgagtggtactaccagtccggactgagca tcgtcatgcccg tgggcggccagagctccttctacagcgactggtatagccctgcctgcggcaaagccggat gccagacctaca agtgggagacctttctgaccagcgaactgccccagtggctgtccgccaatagggccgtca aacctaccggct ccgctgccatcggactcagcatggccggaagctccgctatgatcctggccgcctaccacc cccagcaatttat ctacgctggcagcctgtccgctctgctggatcctagccaaggcatgggccctagcctcat tggcctggccatg ggcgatgctggcggctataaggccgccgatatgtggggccctagctccgatcctgcctgg gagaggaatga ccccacccagcagatccccaagctggtggccaacaacacaaggctctgggtgtactgcgg caatggcaccc ccaacgaactgggcggagccaacattcccgccgagttcctggagaacttcgtcaggagca gcaacctgaag ttccaggacgcctacaatgccgccggaggccacaacgctgtgttcaacttccctcccaac ggcacccacagc tgggagtattggggcgctcagctgaacgccatgaaaggcgacctccagagctccctggga gctggacccg ggaccgagcagcagtggaacttcgccggcatcgaagctgccgctagcgccatccaaggca acgtgaccag catccacagcctgctggacgagggcaagcagagcctgaccaagctggctgctgcttgggg cggatccgga agcgaagcctaccagggcgtgcagcagaagtgggacgccacagccaccgagctgaacaac gccctgcag aacctcgccagaaccatcagcgaggccggacaggctatggccagcacagagggcaatgtg accggcatgt tcgccttcgaaatcgccaccaccagggacagggaaggcgctaccatgatcaccttcaggc tgaggctcccc tgcaggaccatcctgagggtgttcagcaggaaccccctggtgaggggcaccgacagactg gaagccgtgc aggacagcaggagccacgtgtatgcccaccaggctcagaccaggcaccctgctaccgcca ccgtgatcga ccacgagggcgtgatcgactccaacaccaccgccaccagcgctcctcccagaaccaagat cacagtgccc gccaggtgggtggtgaacggcatcgagaggagcggcgaggtgaacgccaagcctggaacc aagagcgg cgacagggtgggcatttgggtcgatagcgccggccagctggtggatgaacctgctccccc tgccagagcca tcgccgatagggccatcctgatcagggtgaggaacgccagctggcagcacgacatcgaca gcctgttctgc acccaaaggcgatcgacaacagccagggacatcatgaacgccggcgtgacctgcgtggga gagcatgaa accctcaccgccgccgcccaatacatgagggagcacgacatcggcgccctgcccatctgt ggagacgacg acaggctgcacggcatgctgaccgacagggacatcgtgatcaagggcctggctgccggcc tcgatcctaac accgctacagccggcgagctggccagagacagcatctactacgtggacgccaacgccagc atccaggaga tgctcaacgtgatggaggagcaccaggtgagaagggtgcctgtgatcagcgagcacaggc tggtgggcatc gtgaccgaggccgatatcgctaggcacctgcccgagcacgccatcgtgcagttcgtgaag gccatctgcag ccccatggctctggccagcggcgcgcccacccccggactcctcaccacagctggagctgg caggcccaga gacagatgcgccaggatcgtgtgcaccgtgttcatcgagaccgccgtggtggctaccatg ttcgtggccctgc tgggcctgagcaccatcagcagcaaggccgacgacatcgactgggacgccatcgcccagt gtgaatccgg cggaaactgggccgccaataccggcaatggcctgtacggcggcctgcagatcagccaggc tacctgggact ccaacggaggagtgggaagccctgccgctgcttcccctcagcagcagatcgaggtggccg acaacatcatg aagacccaaggccctggcgcctggcctaagtgttccagctgtagccagggcgatgctcct ctgggcagcctg acccacatcctgacctttctcgccgccgagacaggcggatgtagcggaagcagggacgac taatgatag

(SEQ ID NO:60)

MFSRPGLPVEYLQVPSPSMGRDIKVQFQSGG SPAVYLLDGLRAQD

DY GWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGC

QTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAY

HPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSS

DPAWER DPTQQIPKLVA TRLWVYCGNGTPNELGGANIPAEFLE

NFVRSSNLKFQDAY AAGGHNAVFNFPPNGTHSWEYWGAQLNAMK GDLQSSLGAGGSMTEQQW FAGIEAAASAIQGNVTSIHSLLDEGKQS

LTKLAAAWGGSGSEAYQGVQQKWDATATEL ALQNLARTISEAG

QAMASTEGNVTGMFAEFMIATTRDREGATMITFRLRLPCRTILRVFSR

NPLVRGTDRLEAPGVQDSRSHVYAHQAQTRHPATATVIDHEGVIDSN

TTATSAPPRTKITVPARWVV GIERSGEV AKPGTKSGDRVGIWVDS

AGQLVDEPAPPARAIADSRRAILIRVR ASWQHDIDSLFCTQRELMTT

ARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGML

TDRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEML VMEE

HQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALASK

LLLGLSTISSKADDIDWDAIAQCESGGNWAANTGNGLYGGLQISQAT

WDSNGGVGSPAAASPQQQIEVADNIMKTQGPGAWPKCSSCSQGDAP

LGSLTHILTFLAAETGGCSGSRDD (SEQ ID NO:61)

MFSRPGLPVEYLQVPSPSMGRDIKVQFQSGG SPAVYLLDGLRAQD

DY GWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGC

QTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAY

HPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSS

DPAWER DPTQQIPKLVA TRLWVYCGNGTPNELGGANIPAEFLE

NFVRSSNLKFQDAY AAGGHNAVFNFPPNGTHSWEYWGAQLNAMK

GDLQSSLGAGPGTEQQW FAGIEAAASAIQGNVTSIHSLLDEGKQSL

TKLAAAWGGSGSEAYQGVQQKWDATATEL ALQNLARTISEAGQ

AMASTEGNVTGMFAFEIATTRDREGATMITFRLRLPCRTILRVFSRNP

LVRGTDRLEAVQDSRSHVYAHQAQTRHPATATVIDHEGVIDSNTTAT

SAPPRTKITVPARWVV GIERSGEV AKPGTKSGDRVGIWVDSAGQL

VDEPAPPARAIADRAILIRVRNASWQHDIDSLFCTQRRSTTARDIMNA

GVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIK

GLAAGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVP

VISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALASGAPTPGLLT

TAGAGRPRDRCARIVCTVFIETAVVATMFVALLGLSTISSKADDIDW

DAIAQCESGGNWAANTGNGLYGGLQISQATWDSNGGVGSPAAASPQ

QQIEVADNIMKTQGPGAWPKCSSCSQGDAPLGSLTHILTFLAAETGG

CSGSRDD (SEQ ID NO:62)

atggattttgcgctgctgccgccggaagtgaacagcgcgcgcatgtataccggcccg ggcgcgggcagcct gctggcggcggcgggcggctgggatagcctggcggcggaactggcgaccaccgcggaagc gtatggca gcgtgctgagcggcctggcggcgctgcattggcgcggcccggcggcggaaagcatggcgg tgaccgcg gcgccgtatattggctggctgtataccaccgcggaaaaaacccagcagaccgcgattcag gcgcgcgcggc ggcgctggcgtttgaacaggcgtatgcgatgaccctgccgccgccggtggtggcggcgaa ccgcattcagc tgctggcgctgattgcgaccaacttttttggccagaacaccgcggcgattgcggcgaccg aagcgcagtatg cggaaatgtgggcgcaggatgcggcggcgatgtatggctatgcgaccgcgagcgcggcgg cggcgctgc tgaccccgtttagcccgccgcgccagaccaccaacccggcgggcctgaccgcgcaggcgg cggcggtga gccaggcgaccgatccgctgagcctgctgattgaaaccgtgacccaggcgctgcaggcgc tgaccattccg agctttattccggaagattttacctttctggatgcgatttttgcgggctatgcgaccgtg ggcgtgacccaggatg tggaaagctttgtggcgggcaccattggcgcggaaagcaacctgggcctgctgaacgtgg gcgatgaaaac ccggcggaagtgaccccgggcgattttggcattggcgaactggtgagcgcgaccagcccg ggcggcggc gtgagcgcgagcggcgcgggcggcgcggcgagcgtgggcaacaccgtgctggcgagcgtg ggccgcg cgaacagcattggccagctgagcgtgccgccgagctgggcggcgccgagcacccgcccgg tgagcgcgc tgagcccggcgggcctgaccaccctgccgggcaccgatgtggcggaacatggcatgccgg gcgtgccgg gcgtgccggtggcggcgggccgcgcgagcggcgtgctgccgcgctatggcgtgcgcctga ccgtgatgg cgcatccgccggcggcgggcsaattcatgattgcgactacccgtgatcgtgagggcgcga ccatgatcacg ttccgtctgcgtctgccgtgtcgcaccattttgcgcgtgttttcgcgtaacccgctggtc cgcggtaccgaccgt ctggaggccgttgtcatgctgctggcggttaccgtgagcctgctgacgatcccattcgca gcggcagctggc acggccgtccaagacagccgtagccatgtgtatgctcaccaggctcaaacccgtcacccg gctactgccact gttatcgatcacgaaggcgtgattgactccaataccacggcaacctccgcaccgcctcgc accaagattacgg ttcctgcgcgttgggtggtgaatggtattgaacgcagcggcgaagttaatgccaaaccgg gtaccaaaagcg gtgaccgtgtgggcatctgggtcgatagcgccggtcagctggtcgacgagccggcaccgc cagcgcgtgc gatcgccgatgcggcgctggctgccctgggtctgtggctgagcgtggcagcggtcgccgg tgcgttgctgg cgctgacgcgcgcaattctgatccgcgttcgcaatgcgagctggcagcacgatattgata gcctgttttgcacc caacgtsasctcatgtccacgcaacgaccgaggcactccggtattcgggctgttggcccc tacgcatgggcc ggccgatgtggtcggataggcaggtggggggtgcaccaggaggcgatgatgaatctagcg atatggcacc cgcgcaaggtgcaatccgccaccatctatcaggtgaccgatcgctcgcacgacgggcgca cagcacgggt gcctggtgacgagatcactagcaccgtgtccggttggttgtcggagttgggcacccaaag cccgttggccga tgagcttgcgcgtgcggtgcggatcggcgactggcccgctgcgtacgcaatcggtgagca cctgtccgttga gattgccgttgcggtcaagcttttgctgggcctgagcaccattagcagcaaagcggatga catcgactgggat gcgattgcgcagtgtgagagcggtggcaattgggcagcgaataccggcaatggcctgtac ggcggtctgca gatctcccaggcgacgtgggacagcaatggtggcgtcggcagcccggctgccgcgtcccc acaacaacag atcgaggtggcagataacattatgaaaacgcagggtccgggtgcttggccaaaatgctcc agctgcagccag ggtgacgcaccgctgggcagcctgacccacattctgacgttcctggcagcggaaaccggt ggttgtagcggt agccgcgatgactga (SEQ ID NO:63)

MDFALLPPEV SARMYTGPGAGSLLAAAGGWDSLAAELATTAEAY

GSVLSGLAALHWRGPAAESMAVTAAPYIGWLYTTAEKTQQTAIQAR

AAALAFEQAYAMTLPPPVVAANRIQLLALIATNFFGQNTAAIAATEA

QYAEMWAQDAAAMYGYATASAAAALLTPFSPPRQTTNPAGLTAQA

AAVSQATDPLSLLIETVTQALQALTIPSFIPEDFTFLDAIFAGYATVGV

TQDVESFVAGTIGAESNLGLLNVGDENPAEVTPGDFGIGELVSATSPG

GGVSASGAGGAASVGNTVLASVGRANSIGQLSVPPSWAAPSTRPVSA

LSPAGLTTLPGTDVAEHGMPGVPGVPVAAGRASGVLPRYGVRLTVM

AHPPAAGEFEFMIATTRDREGATMITFRLRLPCRTILRVFSRNPLVRGT

DRLEAVVMLLAVTVSLLTIPFAAAAGTAVQDSRSHVYAHQAQTRHP

ATATVIDHEGVIDSNTTATSAPPRTKITVPARWVV GIERSGEV AKP

GTKSGDRVGIWVDSAGQLVDEPAPPARAIADAALAALGLWLSVAAV

AGALLALTRAILIRVR ASWQHDIDSLFCTQRELMSTQRPRHSGIRAV

GPYAWAGRCGRIGRWGVHQEAMMNLAIWHPRKVQSATIYQVTDRS

HDGRTARVPGDEITSTVSGWLSELGTQSPLADELARAVRIGDWPAAY

AIGEHLSVEIAVAVKLLLGLSTISSKADDIDWDAIAQCESGGNWAAN

TGNGLYGGLQISQATWDSNGGVGSPAAASPQQQIEVADNIMKTQGP

GAWPKCSSCSQGDAPLGSLTHILTFLAAETGGCSGSRDD (SEQ ID

NO:64)

F atggattttgcgctgctgccgccggaagtgaacagcgcgcgcatgtataccggcccgggc gcgggcagcct gctggcggcggcgggcggctgggatagcctggcggcggaactggcgaccaccgcggaagc gtatggca gcgtgctgagcggcctggcggcgctgcattggcgcggcccggcggcggaaagcatggcgg tgaccgcg gcgccgtatattggctggctgtataccaccgcggaaaaaacccagcagaccgcgattcag gcgcgcgcggc ggcgctggcgtttgaacaggcgtatgcgatgaccctgccgccgccggtggtggcggcgaa ccgcattcagc tgctggcgctgattgcgaccaacttttttggccagaacaccgcggcgattgcggcgaccg aagcgcagtatg cggaaatgtgggcgcaggatgcggcggcgatgtatggctatgcgaccgcgagcgcggcgg cggcgctgc tgaccccgtttagcccgccgcgccagaccaccaacccggcgggcctgaccgcgcaggcgg cggcggtga gccaggcgaccgatccgctgagcctgctgattgaaaccgtgacccaggcgctgcaggcgc tgaccattccg agctttattccggaagattttacctttctggatgcgatttttgcgggctatgcgaccgtg ggcgtgacccaggatg tggaaagctttgtggcgggcaccattggcgcggaaagcaacctgggcctgctgaacgtgg gcgatgaaaac ccggcggaagtgaccccgggcgattttggcattggcgaactggtgagcgcgaccagcccg ggcggcggc gtgagcgcgagcggcgcgggcggcgcggcgagcgtgggcaacaccgtgctggcgagcgtg ggccgcg

#28044985 vl cgaacagcattggccagctgagcgtgccgccgagctgggcggcgccgagcacccgcccgg tgagcgcgc tgagcccggcgggcctgaccaccctgccgggcaccgatgtggcggaacatggcatgccgg gcgtgccgg gcgtgccggtggcggcgggccgcgcgagcggcgtgctgccgcgctatggcgtgcgcctga ccgtgatgg cgcatccgccggcggcgggcsaattcatgattgcgactacccgtgatcgtgagggcgcga ccatgatcacg ttccgtctgcgtctgccgtgtcgcaccattttgcgcgtgttttcgcgtaacccgctggtc cgcggtaccgaccgt ctggaggccgttgtcatgctgctggcggttaccgtgagcctgctgacgatcccattcgca gcggcagctggc acggccgtccaagacagccgtagccatgtgtatgctcaccaggctcaaacccgtcacccg gctactgccact gttatcgatcacgaaggcgtgattgactccaataccacggcaacctccgcaccgcctcgc accaagattacgg ttcctgcgcgttgggtggtgaatggtattgaacgcagcggcgaagttaatgccaaaccgg gtaccaaaagcg gtgaccgtgtgggcatctgggtcgatagcgccggtcagctggtcgacgagccggcaccgc cagcgcgtgc gatcgccgatgcggcgctggctgccctgggtctgtggctgagcgtggcagcggtcgccgg tgcgttgctgg cgctgacgcgcgcaattctgatccgcgttcgcaatgcgagctggcagcacgatattgata gcctgttttgcacc caacgtgasctcatgtccacgcaacgaccgaggcactccggtattcgggctgttggcccc tacgcatgggcc ggccgatgtggtcggataggcaggtggggggtgcaccaggaggcgatgatgaatctagcg atatggcacc cgcgcaaggtgcaatccgccaccatctatcaggtgaccgatcgctcgcacgacgggcgca cagcacgggt gcctggtgacgagatcactagcaccgtgtccggttggttgtcggagttgggcacccaaag cccgttggccga tgagcttgcgcgtgcggtgcggatcggcgactggcccgctgcgtacgcaatcggtgagca cctgtccgttga gattgccgttgcggtcaagcttgcatgcaaaacggtgacgttgaccgtcgacggaaccgc gatgcgggtga ccacgatgaaatcgcgggtgatcgacatcgtcgaagagaacgggttctcagtcgacgacc gcgacgacctg tatcccgcggccggcgtgcaggtccatgacgccgacaccatcgtgctgcggcgtagccgt ccgctgcagat ctcgctggatggtcacgacgctaagcaggtgtggacgaccgcgtcgacggtggacgaggc gctggcccaa ctcgcgatgaccgacacggcgccggccgcggcttctcgcgccagccgcgtcccgctgtcc gggatggcgc taccggtcgtcagcgccaagacggtgcagctcaacgacggcgggttggtgcgcacggtgc acttgccggc ccccaatgtcgcggggctgctgagtgcggccggcgtgccgctgttgcaaagcgaccacgt ggtgcccgcc gcgacggccccgatcgtcgaaggcatgcagatccaggtgacccgcaatcggatcaagaag gtcaccgagc ggctgccgctgccgccgaacgcgcgtcgtgtcgaggacccggagatgaacatgagccggg aggtcgtcg aagacccgggggttccggggacccaggatgtgacgttcgcggtagctgaggtcaacggcg tcgagaccgg ccgtttgcccgtcgccaacgtcgtggtgaccccggcccacgaagccgtggtgcgggtggg caccaagccc ggtaccgaggtgcccccggtgatcgacggaagcatctgggacgcgatcgccggctgtgag gccggtggca actgggcgatcaacaccggcaacgggtattacggtggtgtgcagtttgaccagggcacct gggaggccaac ggcgggctgcggtatgcaccccgcgctgacctcgccacccgcgaagagcagatcgccgtt gccgaggtga cccgactgcgtcaaggttggggcgcctggccggtatgtgctgcacgagcgggtgcgcgct ga (SEQ ID

NO:65)

MDFALLPPEV SARMYTGPGAGSLLAAAGGWDSLAAELATTAEAY

GSVLSGLAALHWRGPAAESMAVTAAPYIGWLYTTAEKTQQTAIQAR

AAALAFEQAYAMTLPPPVVAANRIQLLALIATNFFGQNTAAIAATEA

QYAEMWAQDAAAMYGYATASAAAALLTPFSPPRQTTNPAGLTAQA

AAVSQATDPLSLLIETVTQALQALTIPSFIPEDFTFLDAIFAGYATVGV

TQDVESFVAGTIGAESNLGLLNVGDENPAEVTPGDFGIGELVSATSPG

GGVSASGAGGAASVGNTVLASVGRANSIGQLSVPPSWAAPSTRPVSA

LSPAGLTTLPGTDVAEHGMPGVPGVPVAAGRASGVLPRYGVRLTVM

AHPPAAGEFMIATTRDREGATMITFRLRLPCRTILRVFSRNPLVRGTD

RLEAVVMLLAVTVSLLTIPFAAAAGTAVQDSRSHVYAHQAQTRHPA

TATVIDHEGVIDSNTTATSAPPRTKITVPARWVV GIERSGEV AKPG

TKSGDRVGIWVDSAGQLVDEPAPPARAIADAALAALGLWLSVAAVA

GALLALTRAILIRVRNASWQHDIDSLFCTQRELMSTQRPRHSGIRAVG

PYAWAGRCGRIGRWGVHQEAMMNLAIWHPRKVQSATIYQVTDRSH

DGRTARVPGDEITSTVSGWLSELGTQSPLADELARAVRIGDWPAAYA

IGEHLSVEIAVAVKLACKTVTLTVDGTAMRVTTMKSRVIDIVEENGF

SVDDRDDLYPAAGVQVHDADTIVLRRSRPLQISLDGHDAKQVWTTA STVDEALAQLAMTDTAPAAASRASRVPLSGMALPVVSAKTVQLNDG

GLVRTVHLPAPNVAGLLSAAGVPLLQSDHWPAATAPIVEGMQIQVT

RNRIKKVTERLPLPPNARRVEDPEMNMSREVVEDPGVPGTQDVTFAV

AEV GVETGRLPVANVVVTPAHEAVVRVGTKPGTEVPPVIDGSIWD

AIAGCEAGGNWAINTGNGYYGGVQFDQGTWEANGGLRYAPRADLA

TREEQIAVAEVTRLRQGWGAWPVCAARAGAR (SEQ ID NO: 66)

G atgcgtgcgactgtgggtctggttgaggcgattggcattcgcgagctgcgccaacatgcc agccgttacttgg ctcgtgtcgaggcgggtgaagaactgggcgtgacgaataagggtcgtctggtcgcccgtc tgattccggttca ggcagctgagcgttctcgcgaggcgctgattgaatccggcgtcctgatcccggctcgccg tccgcaaaacct gctggacgtgacggcggagccagctcgtggtcgcaaacgcacgctgtctgatgtcctgaa cgaaatgcgcg acgagcagsaattcatgattgcgactacccgtgatcgtgagggcgcgaccatgatcacgt tccgtctgcgtct gccgtgtcgcaccattttgcgcgtgttttcgcgtaacccgctggtccgcggtaccgaccg tctggaggccgttg tcatgctgctggcggttaccgtgagcctgctgacgatcccattcgcagcggcagctggca cggccgtccaag acagccgtagccatgtgtatgctcaccaggctcaaacccgtcacccggctactgccactg ttatcgatcacga aggcgtgattgactccaataccacggcaacctccgcaccgcctcgcaccaagattacggt tcctgcgcgttgg gtggtgaatggtattgaacgcagcggcgaagttaatgccaaaccgggtaccaaaagcggt gaccgtgtggg catctgggtcgatagcgccggtcagctggtcgacgagccggcaccgccagcgcgtgcgat cgccgatgcg gcgctggctgccctgggtctgtggctgagcgtggcagcggtcgccggtgcgttgctggcg ctgacgcgcgc aattctgatccgcgttcgcaatgcgagctggcagcacgatattgatagcctgttttgcac ccaacgtsasctcat gaccacggcgcgtgatatcatgaatgcgggtgtcacctgtgttggcgagcacgaaacgtt gaccgcagcag cacagtacatgcgcgaacatgatatcggcgcattgccgatttgcggcgacgatgatcgtc tgcacggtatgct gaccgaccgcgatatcgttatcaagggtctggccgcaggcttggacccgaacaccgcgac cgccggtgaac tggcacgtgacagcatctattacgtcgacgcgaacgccagcattcaagagatgctgaacg tgatggaagagc atcaggtgcgtcgtgtcccggttatcagcgaacatcgtctggttggtatcgttaccgaag ccgacatcgcacgt cacctgccggagcacgcgattgttcagttcgtgaaagcgatttgcagcccgatggcgttg gcgtctcgtcaaa agggcgacacaaaatttattctaaatgcaaagcttgcatgcaaaacggtgacgttgaccg tcgacggaaccg cgatgcgggtgaccacgatgaaatcgcgggtgatcgacatcgtcgaagagaacgggttct cagtcgacgac cgcgacgacctgtatcccgcggccggcgtgcaggtccatgacgccgacaccatcgtgctg cggcgtagcc gtccgctgcagatctcgctggatggtcacgacgctaagcaggtgtggacgaccgcgtcga cggtggacgag gcgctggcccaactcgcgatgaccgacacggcgccggccgcggcttctcgcgccagccgc gtcccgctgt ccgggatggcgctaccggtcgtcagcgccaagacggtgcagctcaacgacggcgggttgg tgcgcacggt gcacttgccggcccccaatgtcgcggggctgctgagtgcggccggcgtgccgctgttgca aagcgaccac gtggtgcccgccgcgacggccccgatcgtcgaaggcatgcagatccaggtgacccgcaat cggatcaaga aggtcaccgagcggctgccgctgccgccgaacgcgcgtcgtgtcgaggacccggagatga acatgagcc gggaggtcgtcgaagacccgggggttccggggacccaggatgtgacgttcgcggtagctg aggtcaacgg cgtcgagaccggccgtttgcccgtcgccaacgtcgtggtgaccccggcccacgaagccgt ggtgcgggtg ggcaccaagcccggtaccgaggtgcccccggtgatcgacggaagcatctgggacgcgatc gccggctgtg aggccggtggcaactgggcgatcaacaccggcaacgggtattacggtggtgtgcagtttg accagggcacc tgggaggccaacggcgggctgcggtatgcaccccgcgctgacctcgccacccgcgaagag cagatcgcc gttgccgaggtgacccgactgcgtcaaggttggggcgcctggccggtatgtgctgcacga gcgggtgcgcg ctga (SEQ ID NO: 67)

MRATVGLVEAIGIRELRQHASRYLARVEAGEELGVTNKGRLVARLIP

VQAAERSREALIESGVLIPARRPQNLLDVTAEPARGRKRTLSDVLNE

MRDEQEFMIATTRDREGATMITFRLRLPCRTILRVFSRNPLVRGTDRL

EAVVMLLAVTVSLLTIPFAAAAGTAVQDSRSHVYAHQAQTRHPATA

TVIDHEGVIDSNTTATSAPPRTKITVPARWVVNGIERSGEVNAKPGTK

SGDRVGIWVDSAGQLVDEPAPPARAIADAALAALGLWLSVAAVAGA

LLALTRAILIRVRNASWQHDIDSLFCTQRELMTTARDIMNAGVTCVG

EHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGL

DPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRL

#28044985 vl VGIVTEADIARHLPEHAIVQFVKAICSPMALASRQKGDTKFILNAKLA

CKTVTLTVDGTAMRVTTMKSRVIDIVEENGFSVDDRDDLYPAAGVQ

VHDADTIVLRRSRPLQISLDGHDAKQVWTTASTVDEALAQLAMTDT

APAAASRASRVPLSGMALPVVSAKTVQLNDGGLVRTVHLPAPNVAG

LLSAAGVPLLQSDHVVPAATAPIVEGMQIQVTRNRIKKVTERLPLPPN

ARRVEDPEMNMSREVVEDPGVPGTQDVTFAVAEV GVETGRLPVA

NVVVTPAHEAVVRVGTKPGTEVPPVIDGSIWDAIAGCEAGGNWAINT

GNGYYGGVQFDQGTWEANGGLRYAPRADLATREEQIAVAEVTRLR

QGWGAWPVCAARAGAR (SEQ ID NO: 68)

H atgcgtgcgactgtgggtctggttgaggcgattggcattcgcgagctgcgccaacatgcc agccgttacttgg ctcgtgtcgaggcgggtgaagaactgggcgtgacgaataagggtcgtctggtcgcccgtc tgattccggttca ggcagctgagcgttctcgcgaggcgctgattgaatccggcgtcctgatcccggctcgccg tccgcaaaacct gctggacgtgacggcggagccagctcgtggtcgcaaacgcacgctgtctgatgtcctgaa cgaaatgcgcg acgagcagsaattcatgattgcgactacccgtgatcgtgagggcgcgaccatgatcacgt tccgtctgcgtct gccgtgtcgcaccattttgcgcgtgttttcgcgtaacccgctggtccgcggtaccgaccg tctggaggccgttg tcatgctgctggcggttaccgtgagcctgctgacgatcccattcgcagcggcagctggca cggccgtccaag acagccgtagccatgtgtatgctcaccaggctcaaacccgtcacccggctactgccactg ttatcgatcacga aggcgtgattgactccaataccacggcaacctccgcaccgcctcgcaccaagattacggt tcctgcgcgttgg gtggtgaatggtattgaacgcagcggcgaagttaatgccaaaccgggtaccaaaagcggt gaccgtgtggg catctgggtcgatagcgccggtcagctggtcgacgagccggcaccgccagcgcgtgcgat cgccgatgcg gcgctggctgccctgggtctgtggctgagcgtggcagcggtcgccggtgcgttgctggcg ctgacgcgcgc aattctgatccgcgttcgcaatgcgagctggcagcacgatattgatagcctgttttgcac ccaacgtgasctcat gaccacggcgcgtgatatcatgaatgcgggtgtcacctgtgttggcgagcacgaaacgtt gaccgcagcag cacagtacatgcgcgaacatgatatcggcgcattgccgatttgcggcgacgatgatcgtc tgcacggtatgct gaccgaccgcgatatcgttatcaagggtctggccgcaggcttggacccgaacaccgcgac cgccggtgaac tggcacgtgacagcatctattacgtcgacgcgaacgccagcattcaagagatgctgaacg tgatggaagagc atcaggtgcgtcgtgtcccggttatcagcgaacatcgtctggttggtatcgttaccgaag ccgacatcgcacgt cacctgccggagcacgcgattgttcagttcgtgaaagcgatttgcagcccgatggcgttg gcgtctcgtcaaa agggcgacacaaaatttattctaaatgcaaascttttgctgggcctgagcaccattagca gcaaagcggatga catcgactgggatgcgattgcgcagtgtgagagcggtggcaattgggcagcgaataccgg caatggcctgt acggcggtctgcagatctcccaggcgacgtgggacagcaatggtggcgtcggcagcccgg ctgccgcgtc cccacaacaacagatcgaggtggcagataacattatgaaaacgcagggtccgggtgcttg gccaaaatgctc cagctgcagccagggtgacgcaccgctgggcagcctgacccacattctgacgttcctggc agcggaaaccg gtggttgtagcggtagccgcgatgactga (SEQ ID NO:69)

MRATVGLVEAIGIRELRQHASRYLARVEAGEELGVTNKGRLVARLIP

VQAAERSREALIESGVLIPARRPQNLLDVTAEPARGRKRTLSDVLNE

MRDEQEFMIATTRDREGATMITFRLRLPCRTILRVFSRNPLVRGTDRL

EAVVMLLAVTVSLLTIPFAAAAGTAVQDSRSHVYAHQAQTRHPATA

TVIDHEGVIDSNTTATSAPPRTKITVPARWVVNGIERSGEVNAKPGTK

SGDRVGIWVDSAGQLVDEPAPPARAIADAALAALGLWLSVAAVAGA

LLALTRAILIRVRNASWQHDIDSLFCTQRELMTTARDIMNAGVTCVG

EHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGL

DPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRL

VGIVTEADIARHLPEHAIVQFVKAICSPMALASRQKGDTKFILNAKLL

LGLSTISSKADDIDWDAIAQCESGGNWAANTGNGLYGGLQISQATW

DSNGGVGSPAAASPQQQIEVADNIMKTQGPGAWPKCSSCSQGDAPL

GSLTHILTFLAAETGGCSGSRDD (SEQ ID NO:70)

I atggattttgcgctgctgccgccggaagtgaacagcgcgcgcatgtataccggcccgggc gcgggcagcct gctggcggcggcgggcggctgggatagcctggcggcggaactggcgaccaccgcggaagc gtatggca gcgtgctgagcggcctggcggcgctgcattggcgcggcccggcggcggaaagcatggcgg tgaccgcg gcgccgtatattggctggctgtataccaccgcggaaaaaacccagcagaccgcgattcag gcgcgcgcggc ggcgctggcgtttgaacaggcgtatgcgatgaccctgccgccgccggtggtggcggcgaa ccgcattcagc tgctggcgctgattgcgaccaacttttttggccagaacaccgcggcgattgcggcgaccg aagcgcagtatg cggaaatgtgggcgcaggatgcggcggcgatgtatggctatgcgaccgcgagcgcggcgg cggcgctgc tgaccccgtttagcccgccgcgccagaccaccaacccggcgggcctgaccgcgcaggcgg cggcggtga gccaggcgaccgatccgctgagcctgctgattgaaaccgtgacccaggcgctgcaggcgc tgaccattccg agctttattccggaagattttacctttctggatgcgatttttgcgggctatgcgaccgtg ggcgtgacccaggatg tggaaagctttgtggcgggcaccattggcgcggaaagcaacctgggcctgctgaacgtgg gcgatgaaaac ccggcggaagtgaccccgggcgattttggcattggcgaactggtgagcgcgaccagcccg ggcggcggc gtgagcgcgagcggcgcgggcggcgcggcgagcgtgggcaacaccgtgctggcgagcgtg ggccgcg cgaacagcattggccagctgagcgtgccgccgagctgggcggcgccgagcacccgcccgg tgagcgcgc tgagcccggcgggcctgaccaccctgccgggcaccgatgtggcggaacatggcatgccgg gcgtgccgg gcgtgccggtggcggcgggccgcgcgagcggcgtgctgccgcgctatggcgtgcgcctga ccgtgatgg cgcatccgccggcggcgggcgaatttatgacagagcagcagtggaatttcgcgggtatcg aggccgcggc aagcgcaatccagggaaatgtcacgtccattcattccctccttgacgaggggaagcagtc cctgaccaagctc gcagcggcctggggcggtagcggttcggaggcgtaccagggtgtccagcaaaaatgggac gccacggct accgagctgaacaacgcgctgcagaacctggcgcggacgatcagcgaagccggtcaggca atggcttcga ccgaaggcaacgtcactgggatgttcgcasaattcatgattgcgactacccgtgatcgtg agggcgcgacca tgatcacgttccgtctgcgtctgccgtgtcgcaccattttgcgcgtgttttcgcgtaacc cgctggtccgcggtac cgaccgtctggaggccgttgtcatgctgctggcggttaccgtgagcctgctgacgatccc attcgcagcggca gctggcacggccgtccaagacagccgtagccatgtgtatgctcaccaggctcaaacccgt cacccggctact gccactgttatcgatcacgaaggcgtgattgactccaataccacggcaacctccgcaccg cctcgcaccaag attacggttcctgcgcgttgggtggtgaatggtattgaacgcagcggcgaagttaatgcc aaaccgggtacca aaagcggtgaccgtgtgggcatctgggtcgatagcgccggtcagctggtcgacgagccgg caccgccagc gcgtgcgatcgccgatgcggcgctggctgccctgggtctgtggctgagcgtggcagcggt cgccggtgcgt tgctggcgctgacgcgcgcaattctgatccgcgttcgcaatgcgagctggcagcacgata ttgatagcctgttt tgcacccaacgtgasctcatgaccacggcgcgtgatatcatgaatgcgggtgtcacctgt gttggcgagcac gaaacgttgaccgcagcagcacagtacatgcgcgaacatgatatcggcgcattgccgatt tgcggcgacgat gatcgtctgcacggtatgctgaccgaccgcgatatcgttatcaagggtctggccgcaggc ttggacccgaac accgcgaccgccggtgaactggcacgtgacagcatctattacgtcgacgcgaacgccagc attcaagagat gctgaacgtgatggaagagcatcaggtgcgtcgtgtcccggttatcagcgaacatcgtct ggttggtatcgtta ccgaagccgacatcgcacgtcacctgccggagcacgcgattgttcagttcgtgaaagcga tttgcagcccga tggcgttggcgtctcgtcaaaagggcgacacaaaatttattctaaatgcaaagcttttgc tgggcctgagcacc attagcagcaaagcggatgacatcgactgggatgcgattgcgcagtgtgagagcggtggc aattgggcagc gaataccggcaatggcctgtacggcggtctgcagatctcccaggcgacgtgggacagcaa tggtggcgtcg gcagcccggctgccgcgtccccacaacaacagatcgaggtggcagataacattatgaaaa cgcagggtccg ggtgcttggccaaaatgctccagctgcagccagggtgacgcaccgctgggcagcctgacc cacattctgac gttcctggcagcggaaaccggtggttgtagcggtagccgcgatgactga (SEQ ID N0:71)

MDFALLPPEV SARMYTGPGAGSLLAAAGGWDSLAAELATTAEAY

GSVLSGLAALHWRGPAAESMAVTAAPYIGWLYTTAEKTQQTAIQAR

AAALAFEQAYAMTLPPPVVAANRIQLLALIATNFFGQNTAAIAATEA

QYAEMWAQDAAAMYGYATASAAAALLTPFSPPRQTTNPAGLTAQA

AAVSQATDPLSLLIETVTQALQALTIPSFIPEDFTFLDAIFAGYATVGV

TQDVESFVAGTIGAESNLGLLNVGDENPAEVTPGDFGIGELVSATSPG

GGVSASGAGGAASVGNTVLASVGRANSIGQLSVPPSWAAPSTRPVSA

LSPAGLTTLPGTDVAEHGMPGVPGVPVAAGRASGVLPRYGVRLTVM

AHPPAAGEFMIATTRDREGATMITFRLRLPCRTILRVFSRNPLVRGTD

RLEAVVMLLAVTVSLLTIPFAAAAGTAVQDSRSHVYAHQAQTRHPA

TATVIDHEGVIDSNTTATSAPPRTKITVPARWVV GIERSGEV AKPG

TKSGDRVGIWVDSAGQLVDEPAPPARAIADAALAALGLWLSVAAVA GALLALTRAILIRVRNASWQHDIDSLFCTQRELMTTARDIMNAGVTC

VGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAA

GLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEH

RLVGIVTEADIARHLPEHAIVQFVKAICSPMALASRQKGDTKFILNAK

LLLGLSTISSKADDIDWDAIAQCESGGNWAANTGNGLYGGLQISQAT

WDSNGGVGSPAAASPQQQIEVADNIMKTQGPGAWPKCSSCSQGDAP

LGSLTHILTFLAAETGGCSGSRDDKMK (SEQ ID NO: 72)

J atggattttgcgctgctgccgccggaagtgaacagcgcgcgcatgtataccggcccgggc gcgggcagcct gctggcggcggcgggcggctgggatagcctggcggcggaactggcgaccaccgcggaagc gtatggca gcgtgctgagcggcctggcggcgctgcattggcgcggcccggcggcggaaagcatggcgg tgaccgcg gcgccgtatattggctggctgtataccaccgcggaaaaaacccagcagaccgcgattcag gcgcgcgcggc ggcgctggcgtttgaacaggcgtatgcgatgaccctgccgccgccggtggtggcggcgaa ccgcattcagc tgctggcgctgattgcgaccaacttttttggccagaacaccgcggcgattgcggcgaccg aagcgcagtatg cggaaatgtgggcgcaggatgcggcggcgatgtatggctatgcgaccgcgagcgcggcgg cggcgctgc tgaccccgtttagcccgccgcgccagaccaccaacccggcgggcctgaccgcgcaggcgg cggcggtga gccaggcgaccgatccgctgagcctgctgattgaaaccgtgacccaggcgctgcaggcgc tgaccattccg agctttattccggaagattttacctttctggatgcgatttttgcgggctatgcgaccgtg ggcgtgacccaggatg tggaaagctttgtggcgggcaccattggcgcggaaagcaacctgggcctgctgaacgtgg gcgatgaaaac ccggcggaagtgaccccgggcgattttggcattggcgaactggtgagcgcgaccagcccg ggcggcggc gtgagcgcgagcggcgcgggcggcgcggcgagcgtgggcaacaccgtgctggcgagcgtg ggccgcg cgaacagcattggccagctgagcgtgccgccgagctgggcggcgccgagcacccgcccgg tgagcgcgc tgagcccggcgggcctgaccaccctgccgggcaccgatgtggcggaacatggcatgccgg gcgtgccgg gcgtgccggtggcggcgggccgcgcgagcggcgtgctgccgcgctatggcgtgcgcctga ccgtgatgg cgcatccgccggcggcgggcgaatttatgacagagcagcagtggaatttcgcgggtatcg aggccgcggc aagcgcaatccagggaaatgtcacgtccattcattccctccttgacgaggggaagcagtc cctgaccaagctc gcagcggcctggggcggtagcggttcggaggcgtaccagggtgtccagcaaaaatgggac gccacggct accgagctgaacaacgcgctgcagaacctggcgcggacgatcagcgaagccggtcaggca atggcttcga ccgaaggcaacgtcactgggatgttcgcasaattcatgattgcgactacccgtgatcgtg agggcgcgacca tgatcacgttccgtctgcgtctgccgtgtcgcaccattttgcgcgtgttttcgcgtaacc cgctggtccgcggtac cgaccgtctggaggccgttgtcatgctgctggcggttaccgtgagcctgctgacgatccc attcgcagcggca gctggcacggccgtccaagacagccgtagccatgtgtatgctcaccaggctcaaacccgt cacccggctact gccactgttatcgatcacgaaggcgtgattgactccaataccacggcaacctccgcaccg cctcgcaccaag attacggttcctgcgcgttgggtggtgaatggtattgaacgcagcggcgaagttaatgcc aaaccgggtacca aaagcggtgaccgtgtgggcatctgggtcgatagcgccggtcagctggtcgacgagccgg caccgccagc gcgtgcgatcgccgatgcggcgctggctgccctgggtctgtggctgagcgtggcagcggt cgccggtgcgt tgctggcgctgacgcgcgcaattctgatccgcgttcgcaatgcgagctggcagcacgata ttgatagcctgttt tgcacccaacgtgasctcatgaccacggcgcgtgatatcatgaatgcgggtgtcacctgt gttggcgagcac gaaacgttgaccgcagcagcacagtacatgcgcgaacatgatatcggcgcattgccgatt tgcggcgacgat gatcgtctgcacggtatgctgaccgaccgcgatatcgttatcaagggtctggccgcaggc ttggacccgaac accgcgaccgccggtgaactggcacgtgacagcatctattacgtcgacgcgaacgccagc attcaagagat gctgaacgtgatggaagagcatcaggtgcgtcgtgtcccggttatcagcgaacatcgtct ggttggtatcgtta ccgaagccgacatcgcacgtcacctgccggagcacgcgattgttcagttcgtgaaagcga tttgcagcccga tggcgttggcgtctcgtcaaaagggcgacacaaaatttattctaaatgcaaagcttgcat gcaaaacggtgac gttgaccgtcgacggaaccgcgatgcgggtgaccacgatgaaatcgcgggtgatcgacat cgtcgaagaga acgggttctcagtcgacgaccgcgacgacctgtatcccgcggccggcgtgcaggtccatg acgccgacacc atcgtgctgcggcgtagccgtccgctgcagatctcgctggatggtcacgacgctaagcag gtgtggacgacc gcgtcgacggtggacgaggcgctggcccaactcgcgatgaccgacacggcgccggccgcg gcttctcgc gccagccgcgtcccgctgtccgggatggcgctaccggtcgtcagcgccaagacggtgcag ctcaacgacg gcgggttggtgcgcacggtgcacttgccggcccccaatgtcgcggggctgctgagtgcgg ccggcgtgcc gctgttgcaaagcgaccacgtggtgcccgccgcgacggccccgatcgtcgaaggcatgca gatccaggtg

#28044985 vl acccgcaatcggatcaagaaggtcaccgagcggctgccgctgccgccgaacgcgcgtcgt gtcgaggacc cggagatgaacatgagccgggaggtcgtcgaagacccgggggttccggggacccaggatg tgacgttcgc ggtagctgaggtcaacggcgtcgagaccggccgtttgcccgtcgccaacgtcgtggtgac cccggcccacg aagccgtggtgcgggtgggcaccaagcccggtaccgaggtgcccccggtgatcgacggaa gcatctggg acgcgatcgccggctgtgaggccggtggcaactgggcgatcaacaccggcaacgggtatt acggtggtgtg cagtttgaccagggcacctgggaggccaacggcgggctgcggtatgcaccccgcgctgac ctcgccaccc gcgaagagcagatcgccgttgccgaggtgacccgactgcgtcaaggttggggcgcctggc cggtatgtgct gcacgagcgggtgcgcgctga (SEQ ID NO:73)

MDFALLPPEV SARMYTGPGAGSLLAAAGGWDSLAAELATTAEAY

GSVLSGLAALHWRGPAAESMAVTAAPYIGWLYTTAEKTQQTAIQAR

AAALAFEQAYAMTLPPPVVAANRIQLLALIATNFFGQNTAAIAATEA

QYAEMWAQDAAAMYGYATASAAAALLTPFSPPRQTTNPAGLTAQA

AAVSQATDPLSLLIETVTQALQALTIPSFIPEDFTFLDAIFAGYATVGV

TQDVESFVAGTIGAESNLGLLNVGDENPAEVTPGDFGIGELVSATSPG

GGVSASGAGGAASVGNTVLASVGRANSIGQLSVPPSWAAPSTRPVSA

LSPAGLTTLPGTDVAEHGMPGVPGVPVAAGRASGVLPRYGVRLTVM

AHPPAAGEFMIATTRDREGATMITFRLRLPCRTILRVFSRNPLVRGTD

RLEAVVMLLAVTVSLLTIPFAAAAGTAVQDSRSHVYAHQAQTRHPA

TATVIDHEGVIDSNTTATSAPPRTKITVPARWVV GIERSGEV AKPG

TKSGDRVGIWVDSAGQLVDEPAPPARAIADAALAALGLWLSVAAVA

GALLALTRAILIRVR ASWQHDIDSLFCTQRELMTTARDIMNAGVTC

VGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDrVIKGLAA

GLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEH

RLVGrVTEADIARHLPEHAIVQFVKAICSPMALASRQKGDTKFILNAK

LACKTVTLTVDGTAMRVTTMKSRVIDIVEENGFSVDDRDDLYPAAG

VQVHDADTIVLRRSRPLQISLDGHDAKQVWTTASTVDEALAQLAMT

DTAPAAASRASRVPLSGMALPVVSAKTVQLNDGGLVRTVHLPAPNV

AGLLSAAGVPLLQSDHVVPAATAPIVEGMQIQVTRNRIKKVTERLPLP

PNARRVEDPEMNMSREVVEDPGVPGTQDVTFAVAEV GVETGRLPV

ANVVVTPAHEAVVRVGTKPGTEVPPVIDGSIWDAIAGCEAGGNWAI

NTGNGYYGGVQFDQGTWEANGGLRYAPRADLATREEQIAVAEVTR

LRQGWGAWPVCAARAGAR (SEQ ID NO: 74)

Any Mtb antigen, including any Mtb antigen within any of the fusion proteins described herein, can have an amino acid sequence that is 100%, or from 70% to 99.9%, identical to the particular amino acid sequence listed in Tables 1-4. The amino acid sequence of any individual Mtb antigen, including any Mtb antigen within any of the fusion proteins described herein, can be at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the particular amino acid sequence listed in Tables 1-4. Identity or similarity with respect to an amino acid or nucleotide sequence is defined herein as the percentage of amino acid residues (or nucleotide residues as the case may be) in the particular Mtb antigen that are identical (i.e., same residue) with the amino acid or nucleotide sequence for the Mtb antigen shown in Tables 1-4, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. Percent sequence identity can be determined by, for example, the Gap program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, Madison WI), using default settings, which uses the algorithm of Smith and Waterman (Adv. Appl. Math., 1981, 2, 482-489). Any amino acid number calculated as a % identity can be rounded up or down, as the case may be, to the closest whole number.

Any Mtb antigen, including any Mtb antigen within any of the fusion proteins described herein, can be fragments of the particular amino acid sequence listed in Tables 1-3. The amino acid sequence of any individual Mtb antigen, including any Mtb antigen within any of the fusion proteins described herein, can be missing consecutive amino acids constituting at least 20%, at least 15%, at least 10%, at least 5%, at least 4%, at least 3%, at least 2%, or at least 1%, of the particular amino acid sequence listed in Tables 1-3. The omitted consecutive amino acids may be from the C-terminus or N-terminus portion of the antigen. Alternately, the omitted consecutive amino acids may be from the internal portion of the antigen, thus retaining at least its C-terminus and N-terminus amino acids of the antigen.

Any Mtb antigen, including any Mtb antigen within any of the fusion proteins described herein, can have one or more amino acid additions, deletions, or substitutions compared to the particular amino acid sequence listed in Tables 1 -3. Any individual Mtb antigen, including any Mtb antigen within any of the fusion proteins described herein, can have at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, at least eleven, or at least twelve amino acid additions, deletions, or substitutions compared to the particular amino acid sequence listed in Tables 1-3. The amino acid additions, deletions, or substitutions can take place at any amino acid position within the Mtb antigen.

Where a particular Mtb antigen, including any Mtb antigen within any of the fusion proteins described herein, comprises at least one or more substitutions, the substituted amino acid(s) can each be, independently, any naturally occurring amino acid or any non-naturally occurring amino acid. Thus, a particular Mtb antigen may comprise one or more amino acid substitutions that are naturally occurring amino acids and/or one or more amino acid

substitutions that are non-naturally occurring amino acids. Individual amino acid substitutions are selected from any one of the following: 1) the set of amino acids with nonpolar sidechains, for example, Ala, Cys, He, Leu, Met, Phe, Pro, Val; 2) the set of amino acids with negatively charged side chains, for example, Asp, Glu; 3) the set of amino acids with positively charged sidechains, for example, Arg, His, Lys; and 4) the set of amino acids with uncharged polar sidechains, for example, Asn, Cys, Gin, Gly, His, Met, Phe, Ser, Thr, Trp, Tyr, to which are

#28044985 vl added Cys, Gly, Met and Phe. Substitutions of a member of one class with another member of the same class are contemplated herein. Naturally occurring amino acids include, for example, alanine (Ala), arginine (Arg), asparagine (Asn), aspartic acid (Asp), cysteine (Cys), glutamine (Gin), glutamic acid (Glu), glycine (Gly), histidine (His), isoleucine (He), leucine (Leu), lysine (Lys), methionine (Met), phenylalanine (Phe), proline (Pro), serine (Ser), threonine (Thr), tryptophan (Trp), tyrosine (Tyr), and valine (Val). Non-naturally occurring amino acids include, for example, norleucine, ornithine, norvaline, homoserine, and other amino acid residue analogues such as those described in Ellman et al, Meth. Enzym., 1991, 202, 301-336. To generate such non-naturally occurring amino acid residues, the procedures of Noren et al, Science, 1989, 244, 182 and Ellman et al, supra, can be used. Briefly, these procedures involve chemically activating a suppressor tRNA with a non-naturally occurring amino acid residue followed by in vitro transcription and translation of the RNA.

The Mtb antigens, including any Mtb antigen within any of the fusion proteins described herein, which are modified as described herein retain their ability to elicit an immune response against Mycobacterium tuberculosis. That is, modification of a particular Mtb antigen, including any Mtb antigen within any of the fusion proteins described herein, will still allow the resultant Mtb antigen, or fusion protein comprising the same, to elicit an immune response against Mycobacterium tuberculosis.

The present disclosure also provides nucleic acid molecules encoding any of the fusion proteins described herein that comprise at least three Mycobacterium tuberculosis (Mtb) antigens. In some embodiments, the fusion protein comprises at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen. In some embodiments, the fusion protein comprises at least two latent Mtb antigens and at least one resuscitation Mtb antigen.

The nucleic acid molecules described herein and in Tables 1-4 are representative. That is, the specific sequences recited in Tables 1-4 are simply one example of a nucleic acid molecule that can encode a particular Mtb antigen within a fusion protein. One skilled in the art having knowledge of the genetic code can routinely prepare and design a plethora of nucleic acid molecules encoding the same Mtb antigen. The length and nucleotide content of any particular nucleic acid molecule is dictated by the desired amino acid sequence of the encoded Mtb antigen. The nucleic acid molecule sequences shown in Tables 1-4 are DNA, although RNA nucleic acid molecules are also contemplated.

#28044985 vl Table 5

Primer name Sequence

85B For del ata gat cat atg ttt age cgt cct ggc ctg c (SEQ ID NO:75)

85B Rev EcoRI nostop tta aga gaa ttc gec cgc acc cag aga gga t (SEQ ID NO: 76)

ESAT-6 For BamHI aac gtt gga tec atg aca gag cag cag tgg aa (SEQ ID NO:77)

ESAT-6 Rev EcoRI ns ata eta gaa ttc tgc gaa cat ccc agt gac gt (SEQ ID NO:78)

1733 For EcoRI aac tta gaa ttc atg att gcg act acc cgt gat (SEQ ID NO:79)

1733 In 1 Rev Xma gat ata ccc ggg ggc etc cag acg gtc ggt (SEQ ID NO: 80)

1733 Out For Xma aac gaa ccc ggg gtc caa gac age cgt age c (SEQ ID NO: 81)

1733 Out Rev Xba taa gta tct aga ate ggc gat cgc acg cgc t (SEQ ID NO: 82)

1733 In2 For Xba ata gaa tct aga cgc gca att ctg ate cgc gt (SEQ ID NO:83)

1733 Rev ns Sad aga taa gag etc acg ttg ggt gca aaa cag gc (SEQ ID NO: 84)

2626 For Sad ata gaa gag etc atg acc acg gcg cgt gat a (SEQ ID NO:85)

2626 Rev Hindlll ns taa aga aag ctt tgc att tag aat aaa ttt tgt gtc (SEQ ID NO:86)

RpfD For Hindlll taa eta aag ctt ttg ctg ggc ctg age acc (SEQ ID NO: 87)

RpfD Rev Xhol stop ate taa etc gag eta gtc ate gcg get acc get (SEQ ID NO:88)

ESAT6 For Ndel taa gat cat atg aca gag cag cag tgg aat ttc (SEQ ID NO:89)

ESAT-6 Rev EcoRI ns ata eta gaa ttc tgc gaa cat ccc agt gac gt (SEQ ID NO: 90)

The present disclosure also provides vectors encoding any of the Mtb antigens, including Mtb antigens within any of the fusion proteins described herein, including any of the modified versions described herein. The vector can be capable of expressing an Mtb antigen in the cell of a mammal in a quantity effective to elicit an immune response in the mammal. The vector can be recombinant. The vector can comprise heterologous nucleic acid encoding the antigen. The vector can be a plasmid. The vector can be useful for transfecting cells with nucleic acid encoding an Mtb antigen, which the transformed host cell is cultured and maintained under conditions wherein expression of the antigen takes place.

In some embodiments, coding sequences can be optimized for stability and high levels of expression. In some instances, codons are selected to reduce secondary structure formation of the RNA such as that formed due to intramolecular bonding.

In some embodiments, the vectors can comprise regulatory elements for gene expression of the coding sequences of the nucleic acid. The regulatory elements can be a promoter, an enhancer an initiation codon, a stop codon, or a polyadenylation signal. In some

#28044985 vl embodiments, the vector can comprise heterologous nucleic acid encoding an Mtb antigen and can further comprise an initiation codon, which is upstream of the antigen coding sequence, and a stop codon, which is downstream of the antigen coding sequence. The initiation and termination codon are in frame with the antigen coding sequence.

The vector can also comprise a promoter that is operably linked to the antigen coding sequence. The promoter operably linked to the Mtb antigen coding sequence can be a promoter from simian virus 40 (SV40), a mouse mammary tumor virus (MMTV) promoter, a human immunodeficiency virus (HIV) promoter such as the bovine immunodeficiency virus (BIV) long terminal repeat (LTR) promoter, a Moloney virus promoter, an avian leukosis virus (ALV) promoter, a cytomegalovirus (CMV) promoter such as the CMV immediate early promoter, Epstein Barr virus (EBV) promoter, or a Rous sarcoma virus (RSV) promoter, or the like. The promoter can also be a promoter from a human gene such as human actin, human myosin, human hemoglobin, human muscle creatine, or human metalothionein. The promoter can also be a tissue specific promoter, such as a muscle or skin specific promoter, natural or synthetic.

Representative examples of promoters include the bacteriophage T7 promoter, bacteriophage T3 promoter, SP6 promoter, lac operator-promoter, tac promoter, mycobacterial Hsp60 promoter, SV40 late promoter, SV40 early promoter, RSV-LTR promoter, CMV IE promoter, SV40 early promoter or SV40 late promoter and the CMV IE promoter.

The vector can also comprise a polyadenylation signal, which can be downstream of the antigen coding sequence. The polyadenylation signal can be a SV40 polyadenylation signal, LTR polyadenylation signal, CMV polyadeylation signal, bovine growth hormone (bGH) polyadenylation signal, human growth hormone (hGH) polyadenylation signal, or human β- globin polyadenylation signal. The SV40 polyadenylation signal can be a polyadenylation signal from a pCEP4 vector (Invitrogen, San Diego, CA).

The vector can also comprise an enhancer upstream of the consensus BoNT-A, BoNT-

B, BoNT-E, and BoNT-F antigen sequences. The enhancer can be necessary for DNA expression. The enhancer can be human actin, human myosin, human hemoglobin, human muscle creatine or a viral enhancer such as one from CMV, HA, RSV or EBV. Polynucleotide function enhances are described in U.S. Patent Nos. 5,593,972, 5,962,428, and WO94/016737, the contents of each are fully incorporated by reference.

The vector can also comprise a mammalian origin of replication in order to maintain the vector extrachromosomally and produce multiple copies of the vector in a cell. The vector can be pVAXl, pCEP4 or pREP4 from Invitrogen (San Diego, CA), which can comprise the Epstein Barr virus origin of replication and nuclear antigen EBNA-1 coding region, which can produce

#28044985 vl high copy episomal replication without integration. The vector can be pVAXl or a pVaxl variant with changes such as the variant plasmid described herein. The variant pVaxl plasmid is a 2998 basepair variant of the backbone vector plasmid pVAXl (Invitrogen, Carlsbad CA). The CMV promoter is located at bases 137-724. The T7 promoter/priming site is at bases 664-683. Multiple cloning sites are at bases 696-811. Bovine GH polyadenylation signal is at bases 829- 1053. The Kanamycin resistance gene is at bases 1226-2020. The pUC origin is at bases 2320- 2993.

The vector can also comprise a regulatory sequence, which can be well suited for gene expression in a mammalian or human cell into which the vector is administered. The consensus coding sequence can comprise a codon, which can allow more efficient transcription of the coding sequence in the host cell.

The vector can be pSE420 (Invitrogen, San Diego, Calif.) or pET28b (EMD Millipore, Billerca, Mass.), which can be used for protein production in Escherichia coli (E. coll). The vector can also be pYES2 (Invitrogen, San Diego, Calif), which can be used for protein production in Saccharomyces cerevisiae strains of yeast. The vector can also be of the

MAXBAC™ complete baculovirus expression system (Invitrogen, San Diego, Calif), which can be used for protein production in insect cells. The vector can also be pcDNA I or pcDNA3 (Invitrogen, San Diego, Calif), which may be used for protein production in mammalian cells such as Chinese hamster ovary (CHO) cells. The vector can be expression vectors or systems to produce protein by routine techniques and readily available starting materials including

Sambrook et al, Molecular Cloning and Laboratory Manual, Second Ed., Cold Spring Harbor (1989),which is incorporated fully by reference.

In some embodiments, the vector is a viral vector. Suitable viral vectors include, but are not limited to, an adenovirus vector, vaccinia virus vector, and paramyxovirus vector. Suitable adenovirus vectors include, but are not limited to, adenovirus 4, adenovirus 5, chimpanzee adenovirus 3, chimpanzee adenovirus 63, and chimpanzee adenovirus 68. A suitable vaccinia virus vector includes, but is not limited to, modified vaccinia Ankara (MVA). Suitable paramyxovirus vectors include, but are not limited to, modified parainfluenza virus (PIV2) and recombinant human parainfluenza virus (rHPIV2). In some embodiments, the vector is present within a composition comprising a pharmaceutically acceptable carrier. One skilled in the art is readily familiar with numerous vectors, many of which are commercially available.

The present disclosure also provides host cells comprising any of the nucleic acid molecules or vectors disclosed herein. The host cells can be used, for example, to express the Mtb antigens, or fragments of thereof. The Mtb antigens, or fragments thereof, can also be

#28044985 vl expressed in cells in vivo. The host cell that is transformed (for example, transfected) to produce the Mtb antigens, or fragments of thereof can be an immortalised mammalian cell line, such as those of lymphoid origin (for example, a myeloma, hybridoma, trioma or quadroma cell line). The host cell can also include normal lymphoid cells, such as B-cells, that have been

immortalized by transformation with a virus (for example, the Epstein-Barr virus).

In some embodiments, the host cells include, but are not limited to: bacterial cells, such as E. coii, Caulobacter crescentus, Streptomyces species, and Salmonella typhimurium; yeast cells, such as Saccharomyces cerevisiae, Schizosaccharomyces pombe, Pichia pastoris, Pichia methanolica; insect cell lines, such as those from Spodoptera frugiperda (for example, Sf9 and Sf21 cell lines, and expresSF™ cells (Protein Sciences Corp., Meriden, CT, USA)), Drosophila S2 cells, and Trichoplusia in High Five® Cells (Invitrogen, Carlsbad, CA, USA); and mammalian cells, such as COS1 and COS7 cells, Chinese hamster ovary (CHO) cells, NSO myeloma cells, NIH 3T3 cells, 293 cells, Procell92S, perC6, HEPG2 cells, HeLa cells, L cells, HeLa, MDCK, HEK293, WI38, murine ES cell lines (for example, from strains 129/SV, C57/BL6, DBA-1, 129/SVJ), K562, Jurkat cells, and BW5147. Other useful mammalian cell lines are well known and readily available from the American Type Culture Collection

("ATCC") (Manassas, VA, USA) and the National Institute of General Medical Sciences (NIGMS) Human Genetic Cell Repository at the Coriell Cell Repositories (Camden, NJ, USA). In some embodiments, the cell is a recombinant BCG. These cell types are only representative and are not meant to be an exhaustive list.

Among other considerations, some of which are described above, a host cell strain may be chosen for its ability to process the expressed Mtb antigens, or fragment thereof, in the desired fashion. Post-translational modifications of the polypeptide include, but are not limited to, glycosylation, acetylation, carboxylation, phosphorylation, lipidation, and acylation, and it is an aspect of the present disclosure to provide Mtb antigens thereof with one or more of these post-translational modifications.

In some embodiments, the recombinant BCG has been genetically engineered to express a functional endosomalytic protein that is bioactive at pH values near neutrality (e.g. about pH 6- 8 or about 6.5 to 7.5). The endosomalytic protein is active within Mycobacteria-containing endosomes, which typically have an internal pH near neutrality. The activity of the

endosomalytic protein produced by the rBCG results in disruption of the endosome, permitting the rBCG to escape from the endosome and into the cytoplasm of the cell.

In some embodiments, the endosomalytic protein that is introduced into the rBCG by genetic

#28044985 vl engineering is Perfringolysin O (PfoA) from Clostridium perfringens or a mutant thereof, such as PfoA _G i37Q, as described in WO 2007/058663, which is incorporated herein by reference in its entirety.

In some embodiments, the Mycobacteria are attenuated, as exemplified by

BCG. However, those of skill in the art will recognize that other attenuated and nonattenuated Mycobacteria exist which would also be suitable for use herein. Examples of additional types of Mycobacteria include, but are not limited to, M. tuberculosis strain CDC 1551, M. tuberculosis strain Beijing, M. tuberculosis strain H37Ra (ATCC#:25177), M. tuberculosis strain H37Rv (ATCC#:25618), M. bovis (ATCC#: 1921 1 and 27291), M. fortuitum (ATCC#: 15073), M.

smegmatis (ATCC#: 12051 and 12549), M. intracellular (ATCC#:35772 and 13209), M.

kansasii (ATCC#:21982 and 35775) M. avium (ATCC#: 19421 and 25291), M. gallinarum (ATCC#: 19711), M. vaccae (ATCC#: 15483 and 23024), M. leprae (ATCC#:), M. marinarum (ATCC#: 1 1566 and 1 1567), and M. microtti

(ATCC#: 1 1152).

Examples of attenuated Mycobacterium strains include, but are not restricted

To, M. tuberculosis pantothenate auxotroph strain, M. tuberculosis rpoV mutant strain, M.

tuberculosis leucine auxotroph strain, BCG Danish strain (ATCC # 35733), BCG Japanese strain (ATCC # 35737), BCG Chicago strain (ATCC # 27289), BCG Copenhagen strain (ATCC #: 27290), BCG Pasteur strain (ATCC #: 35734), BCG Glaxo strain (ATCC #: 35741), BCG Connaught strain (ATCC # 35745), BCG Montreal (ATCC # 35746), BCG1331 strain, BCG Tokyo strain, BCG Moreau strain, BCG-Pasteur Aeras, and BCG Moscow strain.

In some embodiments, the cell comprising the one or more vector(s) is present within a composition comprising a pharmaceutically acceptable carrier.

In some embodiments, the Mtb antigen, or fragment thereof, is labeled with a detectable marker. Detectable markers include, but are not limited to, radioactive isotopes (such as P ³² and S ³⁵ ), enzymes (such as horseradish peroxidase, chloramphenicol acetyltransferase (CAT), β- galactosidase (β-gal), and the like), fluorochromes, chromophores, colloidal gold, dyes, and biotin. The labeled Mtb antigens, or fragments thereof, can be used to carry out diagnostic procedures in a variety of cell or tissue types. For imaging procedures, in vitro or in vivo, the Mtb antigens can be labeled with additional agents, such as NMR contrasting agents, X-ray contrasting agents, or quantum dots. Methods for attaching a detectable agent to polypeptides are known in the art. The Mtb antigens can also be attached to an insoluble support (such as a bead, a glass or plastic slide, or the like).

#28044985 vl In some embodiments, the Mtb antigens, or fragment thereof, can be conjugated to a therapeutic agent including, but not limited to, radioisotopes (such as ^{U 1} ln or ⁹⁰ Y), toxins (such as tetanus toxoid or ricin), toxoids, and chemotherapeutic agents.

In some embodiments, the Mtb antigens, or fragments thereof, can be conjugated to an imaging agent. Imaging agents include, for example, a labeling moiety (such as biotin, fluorescent moieties, radioactive moieties, histidine tag or other peptide tags) for easy isolation or detection.

The present disclosure also provides compositions comprising at least three

Mycobacterium tuberculosis (Mtb) antigens, wherein the composition comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen. In some

embodiments, the at least three Mtb antigens are not present in a fusion protein. In some embodiments, the at least three Mtb antigens are in the form of a protein and not nucleic acid molecules encoding the Mtb antigens.

In some embodiments, the acute Mtb antigen is Ag85B, ESAT6, MPT64, PPE15,

PPE51, or Rv3615c. In some embodiments, the latent Mtb antigen is Rvl733c, Rv2626c, Rv3407, or Rv2628c. In some embodiments, the first and/or second transmembrane region of Rvl733c is deleted (Rvl733cATM). In some embodiments, the resuscitation Mtb antigen is RpfB, RpfD, or RpfE. In some embodiments, the composition comprises at least four Mtb antigens. In some embodiments, the composition comprises: ESAT6, Rvl733c, Rv2626c, and RpfD Mtb antigens; ESAT6, Rvl733c, Rv2626c, and RpfB Mtb antigens; RpfB, ESAT6, Rvl733c, and Rv2626c Mtb antigens; Ag85B, ESAT6, Rvl733c, Rv2626c, and RpfD Mtb antigens; Ag85B, ESAT6, Rvl733c, Rv2626c, and RpfB Mtb antigens; PPE51, Rvl733c, Rv2628c, and RpfD Mtb antigens; PPE51, Rvl733c, Rv2628c, and RpfB Mtb antigens; Rv3407, Rvl733c, Rv2626c, and RpfB Mtb antigens; or Rv3407, Rvl733c, Rv2626c, and RpfD Mtb antigens. In some embodiments, the composition further comprises a pharmaceutically acceptable carrier.

The present disclosure also provides compositions comprising at least three

Mycobacterium tuberculosis (Mtb) antigens, wherein the composition comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen; wherein the composition comprises at least one nucleic acid molecule encoding at least one of the Mtb antigens. In some embodiments, the composition comprises one Mtb antigen in protein form and one or two nucleic acid molecules encoding two Mtb antigens. In some embodiments, the

#28044985 vl composition comprises two Mtb antigens in protein form, optionally as a fusion protein, and one nucleic acid molecule encoding one Mtb antigen. Thus, the present composition is a mixture of a protein Mtb antigen(s) and nucleic acid molecule(s) encoding an Mtb antigen(s).

In some embodiments, at least two Mtb antigens are encoded by one or more nucleic acid molecules within one or more vectors. In some embodiments, the one or more vectors is one or more viral vectors. In some embodiments, the one or more viral vectors are any one or more of adenovirus vector, vaccinia virus vector, or paramyxovirus vector. In some embodiments, the adenovirus vector is adenovirus 4, adenovirus 5, chimpanzee adenovirus 3, chimpanzee adenovirus 63, or chimpanzee adenovirus 68. In some embodiments, the one or more vaccinia virus vector is modified vaccinia Ankara (MVA). In some embodiments, the one or more paramyxovirus vectors are any one or more of modified parainfluenza virus (PIV2 or PIV3) or recombinant human parainfluenza virus (rHPIV2). In some embodiments, the at least two Mtb antigens are encoded by a single nucleic acid molecule within the same expression vector as a fusion protein.

In some embodiments, the acute Mtb antigen is Ag85B, ESAT6, MPT64, PPE15,

PPE51, or Pvv3615c. In some embodiments, the latent Mtb antigen is Rvl733c, Rv2626c, Rv3407, or Rv2628c. In some embodiments, the first and/or second transmembrane region of Rvl733c is deleted. In some embodiments, the resuscitation Mtb antigen is RpfB, RpfD, or RpfE. In some embodiments, the composition comprises at least four Mtb antigens. In some embodiments, the composition comprises: ESAT6, Rvl733c, Rv2626c, and RpfD Mtb antigens; ESAT6, Rvl733c, Rv2626c, and RpfB Mtb antigens; RpfB, ESAT6, Rvl733c, and Rv2626c Mtb antigens; Ag85B, ESAT6, Rvl733c, Rv2626c, and RpfD Mtb antigens; Ag85B, ESAT6, Rvl733c, Rv2626c, and RpfB Mtb antigens; PPE51, Rvl733c, Rv2628c, and RpfD Mtb antigens; PPE51, Rvl733c, Rv2628c, and RpfB Mtb antigens; Rv3407, Rvl733c, Rv2626c, and RpfB Mtb antigens; or Rv3407, Rvl733c, Rv2626c, and RpfD Mtb antigens; wherein any two or more Mtb antigens can be within a fusion protein. In some embodiments, the composition comprises at least four Mtb antigens. In some embodiments, the composition further comprises a pharmaceutically acceptable carrier.

In some embodiments, where a rBCG is used as the vehicle to deliver the Mtb antigens, or fusion proteins, or nucleic acids and or vectors comprising or encoding the same, expression of all or part of the Dos R regulon is not up-regulated in the rBCG. In some embodiments, one or more of the following Dos R regulon antigens are not up-regulated in the rBCG: Rvl738, Rv2623, Rv2031c, Rv2032, Rv2626c, Rv2005c, Rv3127, Rvl733c, Rvl996, Rv2628c, Rv0079, Rv3130c, Rv3131, Rvl 813c, Rv2006, Rv2029c, Rv2627c, Rv2030c, Rv3132c, and Rv2629. In

#28044985 vl some embodiments, the rBCG does not comprise up-regulation of: 1) one or more Mtb antigens, including "classical" Mtb antigens such as 85A,

85B and TB 10.4; and 2) at least one Mtb resuscitation antigen selected from Rv0867c, Rvl009, Rvl 884c, Rv2389c, Rv2450c, Rv0288, Rvl009, Rv0685, Rv0824c, Rvl349, Rv2744c,

Rv3347c, Rvl 130, and Rvl 169c. In some embodiments, the rBCG does not include the expression of the following combinations: classical antigens Rvl886c, Rv3804c;

resuscitation antigens Rv0867c, Rvl 884c, Rv2389c; and Mtb-specific antigen Rv3407. In some embodiments, the rBCG does not include the expression of the following combination: Rv3804c, Rvl 886c, and Rv3407, or in addition with Rv3133c, and with the combination of Rv0867c, Rvl 884c, and Rv2389c. In some embodiments, the rBCG does not include the expression of the following combination: TB10.4, Ag85B, Ag85A, and Rv3407. In some embodiments, the cell is not a rBCG.

The present disclosure also provides compositions comprising any one or more of the fusion proteins, Mtb antigens, nucleic acid molecules encoding Mtb antigens, including fusion proteins thereof, cells, and/or vectors and a pharmaceutically acceptable carrier. Compositions include, for example, pharmaceutical compositions. A pharmaceutically acceptable carrier refers to at least one component of a pharmaceutical preparation that is normally used for

administration of active ingredients. As such, a carrier can contain any pharmaceutical excipient used in the art and any form of vehicle for administration. Carriers include, but are not limited to, phosphate buffered saline, physiological saline, water, citrate/sucrose/Tween formulations and emulsions such as, for example, oil/water emulsions.

The compositions can also include an active therapeutic agent and a variety of other pharmaceutically acceptable components. See Remington's Pharmaceutical Science (15th ed., Mack Publishing Company, Easton, Pennsylvania (1980)). The desired form depends on the intended mode of administration and therapeutic application. The compositions can also include, depending on the formulation desired, pharmaceutically acceptable, non-toxic carriers or diluents, which are defined as vehicles commonly used to formulate pharmaceutical

compositions for animal or human administration. The diluent is selected so as not to affect the biological activity of the combination. Examples of such diluents include, but are not limited to, distilled water, physiological phosphate-buffered saline, Ringer's solutions, dextrose solution, and Hank's solution. In addition, the pharmaceutical composition or formulation may also include other carriers, adjuvants, or nontoxic, nontherapeutic, nonimmunogenic stabilizers and the like.

#28044985 vl Solid formulations of the compositions for oral administration can contain suitable carriers or excipients, such as corn starch, gelatin, lactose, acacia, sucrose, microcrystalline cellulose, kaolin, mannitol, dicalcium phosphate, calcium carbonate, sodium chloride, or alginic acid. Disintegrators that can be used include, without limitation, microcrystalline cellulose, corn starch, sodium starch glycolate, and alginic acid. Tablet binders that can be used include acacia, methylcellulose, sodium carboxymethylcellulose, polyvinylpyrrolidone (Povidone™), hydroxypropyl methylcellulose, sucrose, starch, and ethylcellulose. Lubricants that can be used include magnesium stearates, stearic acid, silicone fluid, talc, waxes, oils, and colloidal silica. Additional excipients include, for example, colorants, taste-masking agents, solubility aids, suspension agents, compressing agents, enteric coatings, sustained release aids, and the like.

In some embodiments, the compositions can be administered in the form of a depot injection or implant preparation, which can be formulated in such a manner as to permit a sustained release. An exemplary composition comprises any one or more of the compositions described herein formulated in aqueous buffer.

In some embodiments, liquid formulations of a pharmaceutical composition for oral administration prepared in water or other aqueous vehicles can contain various suspending agents such as methylcellulose, alginates, tragacanth, pectin, kelgin, carrageenan, acacia, polyvinylpyrrolidone, and polyvinyl alcohol. Liquid formulations of pharmaceutical compositions can also include solutions, emulsions, syrups and elixirs containing, together with the active compound(s), wetting agents, sweeteners, and coloring and flavoring agents. Various liquid and powder formulations of the pharmaceutical compositions can be prepared by conventional methods for inhalation into the lungs of the mammal to be treated.

In some embodiments, liquid formulations of a pharmaceutical composition for injection can comprise various carriers such as vegetable oils, dimethylacetamide,

dimethylformamide, ethyl lactate, ethyl carbonate, isopropyl myristate, ethanol, polyols such as, for example, glycerol, propylene glycol, liquid polyethylene glycol, and the like. In some embodiments, the composition includes a citrate/sucrose/tween carrier. For intravenous injections, water soluble versions of the compositions can be administered by the drip method, whereby a pharmaceutical formulation containing the antifungal agent and a physiologically acceptable excipient is infused. Physiologically acceptable excipients can include, for example, 5% dextrose, 0.9% saline, Ringer's solution or other suitable excipients. A suitable insoluble form of the composition can be prepared and administered as a suspension in an aqueous base or a pharmaceutically acceptable oil base, such as an ester of a long chain fatty acid such as, for example, ethyl oleate.

#28044985 vl The compositions can be, for example, injectable solutions, aqueous suspensions or solutions, non-aqueous suspensions or solutions, solid and liquid oral formulations, salves, gels, ointments, intradermal patches, creams, lotions, tablets, capsules, sustained release formulations, and the like. In some embodiments, for topical applications, the pharmaceutical compositions can be formulated in a suitable ointment. In some embodiments, a topical semi-solid ointment formulation typically comprises a concentration of the active ingredient from about 1 to 20%, or from 5 to 10%, in a carrier, such as a pharmaceutical cream base. Some examples of

formulations of a composition for topical use include, but are not limited to, drops, tinctures, lotions, creams, solutions, and ointments containing the active ingredient and various supports and vehicles.

Typically, compositions are prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection can also be prepared. The preparation also can be emulsified or encapsulated in liposomes or microparticles such as polylactide, polyglycolide, or copolymer for enhanced adjuvant effect (see Langer, Science, 1990, 249, 1527 and Hanes, Advanced Drug Delivery Reviews, 1997, 28, 97). A sterile injectable preparation such as, for example, a sterile injectable aqueous or oleaginous suspension can also be prepared. This suspension may be formulated according to techniques known in the art using suitable dispersing, wetting, and suspending agents. In some embodiments, the pharmaceutical composition can be delivered in a

microencapsulation device so as to reduce or prevent a host immune response against the protein.

Effective doses of the compositions of the present disclosure, for the treatment of a condition vary depending upon many different factors, including means of administration, target site, physiological state of the subject, whether the subject is human or an animal, other medications administered, and whether treatment is prophylactic or therapeutic. Usually, the subject is a human but non-human mammals including transgenic mammals can also be treated.

In some embodiments, the compositions can be administered to a subject by injection intravenously, subcutaneously, intraperitoneally, intramuscularly, intramedullarily,

intraventricularly, intraepidurally, intraarterially, intravascularly, intraarticularly, intrasynovially, intrasternally, intrathecally, intrahepatically, intraspinally, intratumorly, intracranially, enteral, intrapulmonary, transmucosal, intrauterine, sublingual, or locally at sites of inflammation or tumor growth by using standard methods. Alternately, the compositions can be administered to a subject by routes including oral, nasal, ophthalmic, rectal, or topical. The most typical route of administration is intravascular, subcutaneous, or intramuscular, although other routes can be effective. In some embodiments, compositions are administered as a sustained release

#28044985 vl composition or device, such as a Medipad™ device. The composition can also be administered via the respiratory tract, for example, using a dry powder inhalation device, nebulizer, or a metered dose inhaler. The composition can also be administered by traditional syringes, needleless injection devices, "microprojectile bombardment gone guns," or other physical methods such as electroporation ("EP"), "hydrodynamic method", or ultrasound.

In some embodiments, the composition can be administered to a subject by sustained release administration, by such means as depot injections of erodible implants directly applied during surgery or by implantation of an infusion pump or a biocompatible sustained release implant into the subject. Alternately, the composition can be administered to a subject by injectable depot routes of administration, such as by using 1-, 3-, or 6-month depot injectable or biodegradable materials and methods, or by applying to the skin of the subject a transdermal patch containing the composition, and leaving the patch in contact with the subject's skin, generally for 1 to 5 hours per patch.

In some embodiments, the compositions comprise about 1 nanogram to about 10 mg of nucleic acid. In some embodiments, the compositions comprise: 1) at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 100 nanograms, or at least 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95,100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, 195, 200, 205, 210, 215, 220, 225, 230, 235, 240, 245, 250, 255, 260, 265, 270, 275, 280, 285, 290, 295, 300, 305, 310, 315, 320, 325, 330, 335, 340, 345, 350, 355, 360, 365, 370, 375, 380, 385, 390, 395, 400, 405, 410, 415, 420, 425, 430, 435, 440, 445, 450, 455, 460, 465, 470, 475, 480, 485, 490, 495, 500, 605, 610, 615, 620, 625, 630, 635, 640, 645, 650, 655, 660, 665, 670, 675, 680, 685, 690, 695, 700, 705, 710, 715, 720, 725, 730, 735, 740, 745, 750, 755, 760, 765, 770, 775, 780, 785, 790, 795, 800, 805, 810, 815, 820, 825, 830, 835, 840, 845, 850, 855, 860, 865, 870, 875, 880, 885, 890, 895. 900, 905, 910, 915, 920, 925, 930, 935, 940, 945, 950, 955, 960, 965, 970, 975, 980, 985, 990, 995 or 1000 micrograms, or at least 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5 or 10 mg or more; and 2) up to and including 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 100 nanograms, or up to and including 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95,100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, 195, 200, 205, 210, 215, 220, 225, 230, 235, 240, 245, 250, 255, 260, 265, 270, 275, 280, 285, 290, 295, 300, 305, 310, 315, 320, 325, 330, 335, 340, 345, 350, 355, 360, 365, 370, 375, 380, 385, 390, 395, 400, 405, 410, 415, 420, 425, 430, 435, 440, 445, 450, 455, 460, 465, 470, 475, 480, 485, 490, 495, 500, 605, 610, 615, 620, 625, 630, 635, 640, 645, 650, 655, 660, 665, 670, 675, 680, 685, 690, 695, 700, 705, 710, 715, 720, 725, 730, 735, 740, 745,

#28044985 vl 750, 755, 760, 765, 770, 775, 780, 785, 790, 795, 800, 805, 810, 815, 820, 825, 830, 835, 840, 845, 850, 855, 860, 865, 870, 875, 880, 885, 890, 895. 900, 905, 910, 915, 920, 925, 930, 935, 940, 945, 950, 955, 960, 965, 970, 975, 980, 985, 990, 995, or 1000 micrograms, or up to and including 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5 or 10 mg.

In some embodiments, the compositions comprise about 5 nanograms to about 10 mg of nucleic acid molecule. In some embodiments, the compositions comprise about 25 nanograms to about 5 mg of nucleic acid molecule. In some embodiments, the compositions contain about 50 nanograms to about 1 mg of nucleic acid molecule. In some embodiments, the compositions contain about 0.1 to about 500 micrograms of nucleic acid molecule. In some embodiments, the compositions contain about 1 to about 350 micrograms of nucleic acid molecule. In some embodiments, the compositions contain about 5 to about 250 micrograms of nucleic acid molecule. In some embodiments, the compositions contain about 10 to about 200 micrograms of nucleic acid molecule. In some embodiments, the compositions contain about 15 to about 150 micrograms of nucleic acid molecule. In some embodiments, the compositions contain about 20 to about 100 micrograms of nucleic acid molecule. In some embodiments, the compositions contain about 25 to about 75 micrograms of nucleic acid molecule. In some embodiments, the compositions contain about 30 to about 50 micrograms of nucleic acid molecule. In some embodiments, the compositions contain about 35 to about 40 micrograms of nucleic acid molecule. In some embodiments, the compositions contain about 100 to about 200 micrograms of nucleic acid molecule. In some embodiments, the compositions comprise about 10 to about 100 micrograms of nucleic acid molecule. In some embodiments, the compositions comprise about 20 to about 80 micrograms of nucleic acid molecule. In some embodiments, the compositions comprise about 25 to about 60 micrograms of nucleic acid molecule. In some embodiments, the compositions comprise about 30 nanograms to about 50 micrograms of nucleic acid molecule. In some embodiments, the compositions comprise about 35 nanograms to about 45 micrograms of nucleic acid molecule. In some embodiments, the compositions contain about 0.1 to about 500 micrograms of nucleic acid molecule. In some embodiments, the compositions contain about 1 to about 350 micrograms of nucleic acid molecule. In some embodiments, the compositions contain about 25 to about 250 micrograms of nucleic acid molecule. In some embodiments, the compositions contain about 100 to about 200 micrograms of nucleic acid molecule.

The compositions can be formulated according to the mode of administration to be used. In cases where compositions are injectable pharmaceutical compositions, they are sterile, pyrogen free and particulate free. An isotonic formulation can be used. Generally, additives for

#28044985 vl isotonicity can include sodium chloride, dextrose, mannitol, sorbitol and lactose. In some cases, isotonic solutions such as phosphate buffered saline are suitable. Stabilizers include gelatin and albumin. In some embodiments, a vasoconstriction agent is added to the formulation.

The compositions can further comprise a pharmaceutically acceptable excipient. The pharmaceutically acceptable excipient can be functional molecules as vehicles, adjuvants, carriers, or diluents. The pharmaceutically acceptable excipient can be a transfection facilitating agent, which can include surface active agents, such as immune-stimulating complexes

(ISCOMS), Freund's incomplete adjuvant, LPS analog including monophosphoryl lipid A, muramyl peptides, quinone analogs, vesicles such as squalene and squalane, hyaluronic acid, lipids, liposomes, calcium ions, viral proteins, polyanions, polycations, or nanoparticles, or other known transfection facilitating agents.

The transfection facilitating agent is a polyanion, polycation, including poly-L-glutamate (LGS), or lipid. The transfection facilitating agent is poly-L-glutamate, and more suitably, the poly-L- glutamate is present in the composition at a concentration less than 6 mg/ml. The transfection facilitating agent can also include surface active agents such as immune-stimulating complexes (ISCOMS), Freunds incomplete adjuvant, LPS analog including monophosphoryl lipid A, muramyl peptides, quinone analogs and vesicles such as squalene and squalane, and hyaluronic acid can also be used administered in conjunction with the genetic construct. In some embodiments, the plasmid compositions can also include a transfection facilitating agent such as lipids, liposomes, including lecithin liposomes or other liposomes known in the art, as a DNA- liposome mixture (see for example W09324640), calcium ions, viral proteins, polyanions, polycations, or nanoparticles, or other known transfection facilitating agents. In some embodiments, the transfection facilitating agent is a polyanion, polycation, including poly-L- glutamate (LGS), or lipid. Concentration of the transfection agent in the composition is less than 4 mg/ml, less than 2 mg/ml, less than 1 mg/ml, less than 0.750 mg/ml, less than 0.500 mg/ml, less than 0.250 mg/ml, less than 0.100 mg/ml, less than 0.050 mg/ml, or less than 0.010 mg/ml.

The pharmaceutically acceptable excipient may be an adjuvant. The adjuvant may be other genes that are expressed in alternative plasmid or are delivered as proteins in combination with the plasmid above. The adjuvant may be selected from the group consisting of: a- interferon(IFN-a), β-interferon (IFN-β), γ-interferon, platelet derived growth factor (PDGF), TNFa, TNF , GM-CSF, epidermal growth factor (EGF), cutaneous T cell-attracting chemokine (CTACK), epithelial thymus-expressed chemokine (TECK), mucosae-associated epithelial chemokine (MEC), IL-12, IL-15, MHC, CD80,CD86 including IL-15 having the signal sequence deleted and optionally including the signal peptide from IgE. The adjuvant may be IL-12, IL-15,

#28044985 vl IL-28, CTACK, TECK, platelet derived growth factor (PDGF), TNFa, TNF , GM-CSF, epidermal growth factor (EGF), IL-1, IL-2, IL-4, IL-5, IL-6, IL-10, IL-12, IL-18, or a combination thereof.

Other genes which may be useful adjuvants include those encoding: MCP-1, MIP-la, MIP-lp, IL-8, L-selectin, P-selectin, E-selectin, CD34, GlyCAM-1, MadCAM-1, LFA-1, VLA- 1, Mac-1, pl50.95, PECAM, ICAM-1, ICAM-2, ICAM-3, CD2, LFA-3, M-CSF, G-CSF, IL-4, mutant forms of IL-18, CD40, CD40L, vascular growth factor, fibroblast growth factor, IL-7, nerve growth factor, vascular endothelial growth factor, Fas, TNF receptor, Fit, Apo-1, p55, WSL-1, DR3, TRAMP, Apo-3, AIR, LARD, NGRF, DR4, DR5, KILLER, TRAIL-R2, TRICK2, DR6, Caspase ICE, Fos, c-jun, Sp-1, Ap-1, Ap-2, p38, p65Rel, MyD88, IRAK, TRAF6, IkB, Inactive NIK, SAP K, SAP-1, JNK, interferon response genes, NFkB, Bax, TRAIL, TRAILrec, TRAILrecDRC5, TRAIL-R3, TRAIL-R4, RANK, RANK LIGAND, Ox40, Ox40 LIGAND, NKG2D, MICA, MICB, NKG2A, NKG2B, NKG2C, NKG2E, NKG2F, TAP1, TAP2 and functional fragments thereof.

The plasmid compositions can further comprise a genetic vaccine facilitator agent as described in U.S. Serial No. 021,579 filed April 1, 1994, which is fully incorporated by reference.

The present disclosure also provides kits comprising any of the Mtb antigens, fragments thereof, fusion proteins, nucleic acid molecules, vectors, or cells, described herein. The kit can include, for example, container(s), package(s) or dispenser(s) along with labels and instructions for administration or use.

The present disclosure also provides methods of eliciting an immune response against Mycobacterium tuberculosis in a mammal comprising administering to the mammal an immunologically sufficient amount of one or more fusion proteins comprising at least three Mycobacterium tuberculosis (Mtb) antigens, wherein at least one fusion protein comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen. Any of the fusion proteins described herein can be administered. In some embodiments, the fusion protein comprises at least four Mtb antigens.

The present disclosure also provides methods of eliciting an immune response against

Mycobacterium tuberculosis in a mammal comprising administering to the mammal an immunologically sufficient amount of a composition comprising at least three Mycobacterium tuberculosis (Mtb) antigens, wherein the composition comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent

#28044985 vl Mtb antigens, and at least one resuscitation Mtb antigen; and a pharmaceutically acceptable carrier. Any of the compositions comprising three or more Mtb antigens can be administered. In some embodiments, the composition comprises at least four Mtb antigens.

The present disclosure also provides methods of eliciting an immune response against Mycobacterium tuberculosis in a mammal comprising administering to the mammal an immunologically sufficient amount of a composition comprising at least three Mycobacterium tuberculosis (Mtb) antigens, wherein the composition comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen; and a pharmaceutically acceptable carrier; wherein the composition comprises at least one nucleic acid molecule encoding at least one of the Mtb antigens. Any of the compositions comprising a mixture of one or more Mtb antigen proteins and one of more nucleic acid molecules encoding one or more Mtb antigens described herein can be administered.

The fusion proteins and compositions described herein can be used to treat or prevent tuberculosis. In some embodiments, the method comprises administering to a human a therapeutically- or prophylactically-effective amount of any of the fusion proteins or

compositions described herein such that the tuberculosis infection is diminished or prevented.

In some embodiments, the subject being treated will have been previously diagnosed as having tuberculosis. Such subjects will, thus, have been diagnosed as being in need of such treatment. Alternately, the treatment may be intended to prevent a tuberculosis infection in a subject that does not yet have tuberculosis or to a subject that is travelling to an area where tuberculosis is prevalent.

Treatment of a subject suffering from tuberculosis can be monitored using standard methods. Some methods entail determining a baseline value, for example, of an antibody level or profile in a subject, before administering a dosage of agent, and comparing this with a value for the profile or level after treatment. A significant increase such as, for example, greater than the typical margin of experimental error in repeat measurements of the same sample, expressed as one standard deviation from the mean of such measurements in value of the level or profile signals a positive treatment outcome (i.e., that administration of the agent has achieved a desired response). If the value for immune response does not change significantly, or decreases, a negative treatment outcome is indicated.

In other embodiments, a control value such as a mean and standard deviation, of level or profile is determined for a control population. Typically the individuals in the control population have not received prior treatment. Measured values of the level or profile in a subject after

#28044985 vl administering a therapeutic agent are then compared with the control value. A significant increase relative to the control value, such as greater than one standard deviation from the mean, signals a positive or sufficient treatment outcome. A lack of significant increase or a decrease signals a negative or insufficient treatment outcome. Administration of the therapeutic is generally continued while the level is increasing relative to the control value. As before, attainment of a plateau relative to control values is an indicator that the administration of treatment can be discontinued or reduced in dosage and/or frequency.

In other embodiments, a control value of the level or profile, such as a mean and standard deviation, is determined from a control population of individuals who have undergone treatment with a therapeutic agent and whose levels or profiles have plateaued in response to treatment. Measured values of levels or profiles in a subject are compared with the control value. If the measured level in a subject is not significantly different, such as by more than one standard deviation, from the control value, treatment can be discontinued. If the level in a subject is significantly below the control value, continued administration of agent is warranted. If the level in the subject persists below the control value, then a change in treatment may be indicated.

In other embodiments, a subject who is not presently receiving treatment but has undergone a previous course of treatment is monitored for antibody levels or profiles to determine whether a resumption of treatment is required. The measured level or profile in the subject can be compared with a value previously achieved in the subject after a previous course of treatment. A significant decrease relative to the previous measurement, such as greater than a typical margin of error in repeat measurements of the same sample, is an indication that treatment can be resumed. Alternately, the value measured in a subject can be compared with a control value (mean plus standard deviation) determined in a population of subjects after undergoing a course of treatment. Alternately, the measured value in a subject can be compared with a control value in populations of prophylactically treated subjects who remain free of symptoms of disease, or populations of therapeutically treated subjects who show amelioration of disease characteristics. In all of these cases, a significant decrease relative to the control level, such as more than a standard deviation, is an indicator that treatment should be resumed in a subject.

In some methods, a baseline measurement of antibody to a given antigen in the subject is made before administration, a second measurement is made soon thereafter to determine the peak antibody level, and one or more further measurements are made at intervals to monitor decay of antibody levels. When the level of antibody has declined to baseline or a predetermined percentage of the peak less baseline, such as 50%, 25% or 10%, administration of a further

#28044985 vl dosage of antigen is administered. In some embodiments, peak or subsequent measured levels less background are compared with reference levels previously determined to constitute a beneficial prophylactic or therapeutic treatment regime in other subjects. If the measured antibody level is significantly less than a reference level, such as less than the mean minus one standard deviation of the reference value in population of subjects benefiting from treatment, administration of an additional dosage of antigen is indicated.

In some embodiments, the subject(s) that can be treated by the above-described methods is an animal, such as a mammal, including, but are not limited to, humans, non-human primates, rodents (including rats, mice, hamsters and guinea pigs) cow, horse, sheep, goat, pig, dog and cat. In most instances, the mammal is a human.

The present disclosure also provides fusion proteins for use in the preparation of a medicament for treating or preventing a Mycobacterium tuberculosis infection, wherein the fusion protein comprises at least three Mycobacterium tuberculosis (Mtb) antigens, and wherein the fusion protein comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen.

The present disclosure also provides fusion proteins for use in treating or preventing a Mycobacterium tuberculosis infection, wherein the fusion protein comprises at least three Mycobacterium tuberculosis (Mtb) antigens, and wherein the fusion protein comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen.

The present disclosure also provides uses of a fusion protein in the preparation of a medicament for treating or preventing a Mycobacterium tuberculosis infection, wherein the fusion protein comprises at least three Mycobacterium tuberculosis (Mtb) antigens, and wherein the fusion protein comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen.

The present disclosure also provides uses of a fusion protein in treating or preventing a Mycobacterium tuberculosis infection, wherein the fusion protein comprises at least three Mycobacterium tuberculosis (Mtb) antigens, and wherein the fusion protein comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen.

The present disclosure also provides compositions for use in the preparation of a medicament for treating or preventing a Mycobacterium tuberculosis infection, wherein the

#28044985 vl composition comprises at least three Mycobacterium tuberculosis (Mtb) antigens, and wherein the composition comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen; and a pharmaceutically acceptable carrier.

The present disclosure also provides compositions for use in treating or preventing a

Mycobacterium tuberculosis infection, wherein the composition comprises at least three

Mycobacterium tuberculosis (Mtb) antigens, and wherein the composition comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen; and a

pharmaceutically acceptable carrier.

The present disclosure also provides uses of a composition in the preparation of a medicament for treating or preventing a Mycobacterium tuberculosis infection, wherein the composition comprises at least three Mycobacterium tuberculosis (Mtb) antigens, and wherein the composition comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen; and a pharmaceutically acceptable carrier.

The present disclosure also provides uses of a composition in treating or preventing a Mycobacterium tuberculosis infection, wherein the composition comprises at least three

Mycobacterium tuberculosis (Mtb) antigens, and wherein the composition comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen; and a

pharmaceutically acceptable carrier.

The present disclosure also provides compositions for use in the preparation of a medicament for treating or preventing a Mycobacterium tuberculosis infection, wherein the composition comprises at least three Mycobacterium tuberculosis (Mtb) antigens, and wherein the composition comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen; and a pharmaceutically acceptable carrier; wherein the composition comprises at least one nucleic acid molecule encoding at least one of the Mtb antigens.

The present disclosure also provides compositions for use in treating or preventing a

Mycobacterium tuberculosis infection, wherein the composition comprises at least three

Mycobacterium tuberculosis (Mtb) antigens, and wherein the composition comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen; and a

#28044985 vl pharmaceutically acceptable carrier; wherein the composition comprises at least one nucleic acid molecule encoding at least one of the Mtb antigens.

The present disclosure also provides uses of a composition in the preparation of a medicament for treating or preventing a Mycobacterium tuberculosis infection, wherein the composition comprises at least three Mycobacterium tuberculosis (Mtb) antigens, and wherein the composition comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen; and a pharmaceutically acceptable carrier; wherein the composition comprises at least one nucleic acid molecule encoding at least one of the Mtb antigens.

The present disclosure also provides uses of a composition in treating or preventing a

Mycobacterium tuberculosis infection, wherein the composition comprises at least three

Mycobacterium tuberculosis (Mtb) antigens, and wherein the composition comprises: at least one acute Mtb antigen, at least one latent Mtb antigen, and at least one resuscitation Mtb antigen; or at least two latent Mtb antigens, and at least one resuscitation Mtb antigen; and a

pharmaceutically acceptable carrier; wherein the composition comprises at least one nucleic acid molecule encoding at least one of the Mtb antigens.

The present disclosure also provides any of the fusion proteins described herein, or any of the compositions described herein, or any of the cells described herein, or any of the vectors described herein, or any of the methods described herein, or any of the uses described herein, substantially as described with reference to the accompanying examples and/or figures.

In order that the subject matter disclosed herein may be more efficiently understood, examples are provided below. It should be understood that these examples are for illustrative purposes only and are not to be construed as limiting the claimed subject matter in any manner. Throughout these examples, molecular cloning reactions, and other standard recombinant DNA techniques, were carried out according to methods described in Maniatis et al, Molecular

Cloning - A Laboratory Manual, 2nd ed., Cold Spring Harbor Press (1989), using commercially available reagents, except where otherwise noted.

Examples

Example 1: Construction of the Antigen Cassette as the Basic Tool for Subsequent

Platform Insertion

The 5 antigen cassette (Construct D), which was human codon optimized, was synthesized commercially by Aldevron and cloned into pVAX-1. For use in MVA vectors, antigen 85B was synthesized with its native leader sequence. For viral vectors other than MVA,

#28044985 vl antigen 85B was replaced with genes either containing or not containing the leader sequence, this being achieved using the unique EcoRI and Xmal nuclease target sequences. To clone the 5 antigen cassette into adenoviral or CMV vectors, primers with homology arms were used to PCR amplify the cassette, and this PCR product was recombined into the appropriate region of the BAC.

For recombinant protein expression of Construct D, the 85B, Rvl733, Rv2626, and RpfD genes were synthesized by DNA2.0 and codon optimized for E. coli expression. Antigen 85B and RpfD were synthesized without the native leader sequences. Each gene was PCR amplified from the respective DNA2.0 vector with appropriate restriction sites added and cloned into pET28b sequentially. ESAT-6 was PCR amplified from H37Rv DNA.

More specifically, the genes encoding the protein antigens were PCR amplified using the primers in Table 5 and cloned into the pET28b vector (Novagen) via the indicated restriction enzyme sites. ESAT6 was PCR amplified from Mtb and first cloned into the pET23b vector (Novagen). It was subsequently PCR amplified and cloned into pET28b. The genes for antigen 85B, Rvl733c, Rv2626c, and RpfD were all synthesized with their codons optimized for expression in E. coli (DNA2.0). Antigen Ag85B and rpfD were synthesized without the bases encoding the N-terminal signal sequence, and rpfB was PCR amplified from Mtb without the N- terminal signal sequence. The codon optimized genes were PCR amplified and cloned into pET28b creating N-terminal 6xHis-tagged fusion proteins. The genes were cloned with no spacer sequences, only the restriction enzyme sites between each gene. To remove the 2 transmembrane regions of Rvl733c, it was PCR amplified in 3 pieces which were ligated together.

In another embodiment the 4 Ag and 5 Ag proteins were constructed with wild type Rvl733c including the transmembrane regions. The pET28b constructs were cloned in E. coli cloning strains, screened by restriction digest and sequenced to verify each construct.

Example 2: Construction of recombinant BCG (rBCG) strains

rBCG strains over-expressing antigens involved with active infection, latency, and resuscitation were constructed. The genes of interest were first cloned in a plasmid which allows for their insertion in the chromosome of BCG at the attB integration site (pJFiNT-RIAR). Since this plasmid has three different cloning sites, the 5 genes were not fused together but rather split into three groups. Ag85B was fused to ESAT-6 (Ag85B-ESAT6; SEQ ID NO:91 (nucleotide) and SEQ ID NO:92 (amino acid) with Ag85B signal sequence; SEQ ID NO:93 (nucleotide) and SEQ ID NO:94 (amino acid) with 19 kDa lipoprotein signal sequence) and placed in the first cloning site, Rvl733c was cloned by itself, and Rv2626c was fused with RpfD (Rv2626c-RpfD;

#28044985 vl SEQ ID NO:95 and SEQ ID NO:96 with Ag85B signal sequence; SEQ ID NO:97 and SEQ ID NO:98 with 19 kDa lipoprotein signal sequence) then placed into the third site to create the following construct: Ag85B-ESAT6 + Rvl733c + Rv2626c-RpfD. Each insert was placed under the control of the Hsp60 promoter and a signal sequence was added to both fusions, except Rvl733c since it is already a mycobacterial membrane protein. Constructs with two different signal sequences were made; the Ag85B signal sequence which allows for secretion of the fusions, and the 19 kDa lipoprotein signal sequence which anchors them into the membrane to examine which one would allow better expression and/or immunogenicity of the antigens. Both replicating and non-replicating versions of those rBCG strains were constructed. The maps of the plasmids that were used to construct the rBCG strains are shown in Figure 1A (fusions with the Ag85B signal sequence) and IB (fusions with the 19 kDa signal sequence).

After the rBCG strains were constructed by integration of the shuttle plasmids in the chromosome of BCG SSI, BCG SSIAPanCD or other BCG strains, cell lysates and supematants were prepared to evaluate the relative expression of the different antigens as well as their localization in the rBCG cells. Western blot data using a monoclonal antibody against ESAT-6 as a probe showed the following: the BCG SSI control, which does not have the gene for ESAT- 6, showed no reactivity with the monoclonal antibody in either the cell lysate or the culture supernatant; for rBCG expressing the Ag85B-ESAT6 fusion linked to the 19 kDa signal sequence, low levels of the fusion were detected, but only in the cell lysates and not in the culture supernatant of both the replicating and non-replicating rBCG strains, showing that this signal sequence does not result in secretion of the fusion, as expected; the rBCG strain expressing the Ag85B-ESAT6 fusion linked to the Ag85B signal sequence showed a very high level of expression both in the cell lysate and the culture supernatant confirming that this signal sequence does result in the secretion of this fusion (data not shown).

Following the antigen expression studies, a preliminary immunogenicity experiment was carried out in C57/BL6 mice comparing the BCG SSI control and the rBCG strains expressing the fusions with the two different signal sequences. Mice were immunized once sc with either 10 ⁵ or 10 ⁶ CFUs of the different BCG strains and were sacrificed 6 weeks later. The splenocytes were stimulated for 72 hours with recombinant Ag85B or ESAT-6 proteins and the levels of antigen specific IFNy released in the culture supematants were measured using an ELISA assay. The following results were obtained with the Ag85B-ESAT6 fusions (see, Figure 2): the BCG SSI control given at the lowest dose showed background levels of IFNy, similar to what was obtained with the naive mice, whereas the mice given the highest dose showed higher levels of Ag85B specific IFNy, but no ESAT6 specific response which was expected since the

#28044985 vl BCG SSI control does not have the gene for ESAT-6; in contrast, the rBCG strain expressing the Ag85B-ESAT6 fusion linked to the Ag85B signal sequence gave a much stronger Ag85B specific response at both doses, but an ESAT-6 response above background only at the higher dose; similar results were obtained with the rBCG strain expressing the fusion linked to the 19 kDa signal sequence, but only at the higher dose, which is not surprising considering the expression levels were much lower in that strain (data not shown).

DNA sequence of the Ag85B-ESAT6 fusion with the Ag85B signal sequence:

atgacagacgtgagccgaaagattcgagcttggggacgccgattgatgatcggcacg gcagcggctgtagtccttccgggcctggtggg gcttgccggcggagcggcaaccgcgggcgcgttctcccggccggggctgccggtcgagta cctgcaggtgccgtcgccgtcgatgggc cgcgacatcaaggttcagttccagagcggtgggaacaactcacctgcggtttatctgctc gacggcctgcgcgcccaagacgactacaac ggctgggatatcaacaccccggcgttcgagtggtactaccagtcgggactgtcgatagtc atgccggtcggcgggcagtccagcttctaca gcgactggtacagcccggcctgcggtaaggctggctgccagacttacaagtgggaaacct tcctgaccagcgagctgccgcaatggttgt ccgccaacagggccgtgaagcccaccggcagcgctgcaatcggcttgtcgatggccggct cgtcggcaatgatcttggccgcctaccac ccccagcagttcatctacgccggctcgctgtcggccctgctggacccctctcaggggatg gggcctagcctgatcggcctcgcgatgggt gacgccggcggttacaaggccgcagacatgtggggtccctcgagtgacccggcatgggag cgcaacgaccctacgcagcagatcccc aagctggtcgcaaacaacacccggctatgggtttattgcgggaacggcaccccgaacgag ttgggcggtgccaacatacccgccgagttc ttggagaacttcgttcgtagcagcaacctgaagttccaggatgcgtacaacgccgcgggc gggcacaacgccgtgttcaacttcccgccca acggcacgcacagctgggagtactggggcgctcagctcaacgccatgaagggtgacctgc agagttcgttaggcgccggcatgacaga gcagcagtggaatttcgcgggtatcgaggccgcggcaagcgcaatccagggaaatgtcac gtccattcattccctccttgacgaggggaa gcagtccctgaccaagctcgcagcggcctggggcggtagcggttcggaggcgtaccaggg tgtccagcaaaaatgggacgccacggct accgagctgaacaacgcgctgcagaacctggcgcggacgatcagcgaagccggtcaggca atggcttcgaccgaaggcaacgtcactg ggatgttcgcatga (SEQ ID NO:91). Amino acid sequence of the Ag85B-ESAT6 fusion with the Ag85B signal sequence:

MTDVSRKIRAWGRRLMIGTAAAVVLPGLVGLAGGAATAGAFSRPGLPVEYLQVPSPSM GRDIKVQFQSGG SPAVYLLDGLRAQDDY GWDI TPAFEWYYQSGLSIVMPVGGQS SFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMI LAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERN DPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGG HNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAGMTEQQWNFAGIEAAASAIQG NVTSIHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATEL ALQNLARTISE AGQAMASTEGNVTGMFA (SEQ ID NO: 92).

#28044985 vl DNA sequence of the Ag85B-ESAT6 fusion with the 19 kDa signal sequence: atgaagcgtggactgacggtcgcggtagccggagccgccattctggtcgcaggtctttcc ggatgttcaagcaacaagtcgactacagga agcggtgagaccacgaccgcggcaggtaccacggcaagccccggccggccggggctgccg gtcgagtacctgcaggtgccgtcgcc gtcgatgggccgcgacatcaaggttcagttccagagcggtgggaacaactcacctgcggt ttatctgctcgacggcctgcgcgcccaaga cgactacaacggctgggatatcaacaccccggcgttcgagtggtactaccagtcgggact gtcgatagtcatgccggtcggcgggcagtc cagcttctacagcgactggtacagcccggcctgcggtaaggctggctgccagacttacaa gtgggaaaccttcctgaccagcgagctgcc gcaatggttgtccgccaacagggccgtgaagcccaccggcagcgctgcaatcggcttgtc gatggccggctcgtcggcaatgatcttggc cgcctaccacccccagcagttcatctacgccggctcgctgtcggccctgctggacccctc tcaggggatggggcctagcctgatcggcctc gcgatgggtgacgccggcggttacaaggccgcagacatgtggggtccctcgagtgacccg gcatgggagcgcaacgaccctacgcag cagatccccaagctggtcgcaaacaacacccggctatgggtttattgcgggaacggcacc ccgaacgagttgggcggtgccaacatacc cgccgagttcttggagaacttcgttcgtagcagcaacctgaagttccaggatgcgtacaa cgccgcgggcgggcacaacgccgtgttcaa cttcccgcccaacggcacgcacagctgggagtactggggcgctcagctcaacgccatgaa gggtgacctgcagagttcgttaggcgccg gcatgacagagcagcagtggaatttcgcgggtatcgaggccgcggcaagcgcaatccagg gaaatgtcacgtccattcattccctccttga cgaggggaagcagtccctgaccaagctcgcagcggcctggggcggtagcggttcggaggc gtaccagggtgtccagcaaaaatggga cgccacggctaccgagctgaacaacgcgctgcagaacctggcgcggacgatcagcgaagc cggtcaggcaatggcttcgaccgaagg caacgtcactgggatgttcgcatga (SEQ ID NO:93).

Amino acid sequence of the Ag85B-ESAT6 fusion with the 19 kDa signal sequence:

MKRGLT VA VAGAAILVAGLS GC S SNKSTTGSGETTTA AGTT ASP GRP GLP VEYLQ VP SP SMGRDIKVQFQSGG SPAVYLLDGLRAQDDY GWDINTPAFEWYYQSGLSIVMPVG GQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSS AMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAW ER DPTQQIPKLVA TRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNA AGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAGMTEQQWNFAGIEAAASA IQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATEL ALQNLAR TISEAGQAMASTEGNVTGMFA (SEQ ID NO: 94).

DNA sequence of Rv2626c-RpfD fusion with the Ag85B signal sequence:

atgacagacgtgagccgaaagattcgagcttggggacgccgattgatgatcggcacg gcagcggctgtagtccttccgggcctggtggg gcttgccggcggagcggcaaccgcgggcgcgttctccatgaccaccgcacgcgacatcat gaacgcaggtgtgacctgtgttggcgaac acgagacgctaaccgctgccgctcaatacatgcgtgagcacgacatcggcgcgttgccga tctgcggggacgacgaccggctgcacgg catgctcaccgaccgcgacattgtgatcaaaggcctggctgcgggcctagacccgaatac cgccacggctggcgagttggcccgggaca gcatctactacgtcgatgcgaacgcaagcatccaggagatgctcaacgtcatggaagaac atcaggtccgccgtgttccggtcatctcaga

#28044985 vl gcaccgcttggtcggaatcgtcaccgaagccgacatcgcccgacacctgcccgagcacgc cattgtgcagttcgtcaaggcaatctgctc gcccatggccctcgccagcatgacaccgggtttgcttactactgcgggtgctggccgacc acgt

gacaggtgcgccaggatcgtatgcacggtgttcatcgaaaccgccgttgtcgcgacc atgtttgtcgcgttgttgggtctgtccaccatcagc tcgaaagccgacgacatcgattgggacgccatcgcgcaatgcgaatccggcggcaattgg gcggccaacaccggtaacgggttatacgg tggtctgcagatcagccaggcgacgtgggattccaacggtggtgtcgggtcgccggcggc cgcgagtccccagcaacagatcgaggtc gcagacaacattatgaaaacccaaggcccgggtgcgtggccgaaatgtagttcttgtagt cagggagacgcaccgctgggctcgctcacc cacatcctgacgttcctcgcggccgagactggaggttgttcggggagcagggacgattag (SEQ ID NO:95).

Amino acid sequence of the Rv2626c-RpfD fusion with the Ag85B signal sequence:

MTDVSRKIRAWGRRLMIGTAAAVVLPGLVGLAGGAATAGAFSMTTARDIMNAGVTCV GEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPNTATAGEL ARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVK AICSPMALASMTPGLLTTAGAGRPRDRCARIVCTVFIETAVVATMFVALLGLSTISSKAD DIDWDAIAQCESGGNWAANTGNGLYGGLQISQATWDSNGGVGSPAAASPQQQIEVAD NIMKTQGPGAWPKCSSCSQGDAPLGSLTHILTFLAAETGGCSGSRDD (SEQ ID NO:96).

DNA sequence of the Rv2626c-RpfD fusion with the 19 kDa signal sequence:

Atgaagcgtggactgacggtcgcggtagccggagccgccattctggtcgcaggtctttcc ggatgttcaagcaacaagtcgactacagga agcggtgagaccacgaccgcggcaggtaccacggcaagccccggcatgaccaccgcacgc gacatcatgaacgcaggtgtgacctgt gttggcgaacacgagacgctaaccgctgccgctcaatacatgcgtgagcacgacatcggc gcgttgccgatctgcggggacgacgaccg gctgcacggcatgctcaccgaccgcgacattgtgatcaaaggcctggctgcgggcctaga cccgaataccgccacggctggcgagttgg cccgggacagcatctactacgtcgatgcgaacgcaagcatccaggagatgctcaacgtca tggaagaacatcaggtccgccgtgttccgg tcatctcagagcaccgcttggtcggaatcgtcaccgaagccgacatcgcccgacacctgc ccgagcacgccattgtgcagttcgtcaagg caatctgctcgcccatggccctcgccagcatgacaccgggtttgcttactactgcgggtg ctggccgaccacgtgacaggtgcgccaggat cgtatgcacggtgttcatcgaaaccgccgttgtcgcgaccatgtttgtcgcgttgttggg tctgtccaccatcagctcgaaagccgacgacat cgattgggacgccatcgcgcaatgcgaatccggcggcaattgggcggccaacaccggtaa cgggttatacggtggtctgcagatcagcc aggcgacgtgggattccaacggtggtgtcgggtcgccggcggccgcgagtccccagcaac agatcgaggtcgcagacaacattatgaa aacccaaggcccgggtgcgtggccgaaatgtagttcttgtagtcagggagacgcaccgct gggctcgctcacccacatcctgacgttcctc gcggccgagactggaggttgttcggggagcagggacgattag (SEQ ID NO:97).

Amino acid sequence of the Rv2626c-RpfD fusion with the 19 kDa signal sequence:

MKRGLTVAVAGAAILVAGLSGCSSNKSTTGSGETTTAAGTTASPGMTTARDIMNAGV T CVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPNTATAG ELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQF

#28044985 vl VKAICSPMALASMTPGLLTTAGAGRPRDRCARIVCTVFIETAVVATMFVALLGLSTISSK ADDIDWDAIAQCESGGNWAANTGNGLYGGLQISQATWDSNGGVGSPAAASPQQQIEV ADNIMKTQGPGAWPKCSSCSQGDAPLGSLTHILTFLAAETGGCSGSRDD (SEQ ID NO:98).

Example 3: Cloning and overexpression of fusion proteins of the Cassette and Variants

Preparation of the Antigen Cassette and its Variants as fusion protein required a modified strategy outline below:

Cloning: Multiple recombinant fusion proteins were created, of which two are exemplified here: one with four Mtb antigens (ESAT6-Rvl733c-Rv2626c-RpfD), and one with five antigens (Ag85B-ESAT6-Rvl733c-Rv2626c-RpfD). The genes encoding the protein antigens were PCR amplified using the primers in Table 5 and cloned into the pET28b vector (Novagen) via the indicated restriction enzyme sites. ESAT6 was PCR amplified from Mtb and first cloned into the pET23b vector (Novagen). It was subsequently PCR amplified and cloned into pET28b. The genes for antigen 85B, Rvl733c, Rv2626c, and RpfD were all synthesized with their codons optimized for expression in E. coli (DNA2.0). Ag85B, and rpfD were synthesized without the bases encoding the N-terminal signal sequence, and rpfB was PCR amplified from Mtb without the N-terminal signal sequence. The codon optimized genes were PCR amplified and cloned into pET28b creating N-terminal 6xHis-tagged fusion proteins. The genes were cloned with no spacer sequences, only the restriction enzyme sites between each gene. To remove the 2 transmembrane regions of Rvl733c, it was PCR amplified in 3 pieces which were ligated together. In another embodiment the 4 Ag and 5 Ag proteins were constructed with wild type Rvl733c including the transmembrane regions. The pET28b constructs were cloned in E. coli cloning strains, screened by restriction digest and sequenced to verify each construct. The DNA and amino acid sequences of the 4 Ag and 5 Ag fusions were prepared without the transmembrane regions of Rvl733c. Later versions of these fusions replaced RpfD with RpfB in the 4 Ag fusion, with RpfB placed either at the 5' or the 3 ' end of the fusion.

Expression: The plasmids encoding Construct D and its variant fusion proteins were transformed into E. coli T7 express (NEB) or E. coli BL21 DE3 (Novagen). Multiple colonies of each fusion construct were picked and grown overnight shaking at 37°C in Tryptic Soy Broth (TSB) (Sigma). Overnight cultures were diluted 1 : 100 in TSB and grown shaking at 37°C to OD600 = 0.6. Cultures were induced with 1 mM IPTG and grown shaking at 37°C for 3 hours. Induced and uninduced aliquots of each culture were run on 4-12 % Bis/Tris SDS-PAGE gels to

#28044985 vl verify induction of the fusion proteins. Colonies expressing each of the fusion proteins were frozen in TSB + 20% glycerol at -80°C as research stocks.

Purification of fusion proteins

10 ml cultures were inoculated from glycerol stocks of the BE1726D and its variant fusion constructs and grown overnight shaking at 37°C. The overnight cultures were diluted 1 : 100 in 250 ml TSB and grown shaking at 37°C to OD600 = 0.6. Cultures were induced with 1 mM IPTG and grown shaking at 37°C for 3 hours. An aliquot of the induced sample was run on a 4-12% Bis/Tris SDS-PAGE gel to confirm induction of the protein. The induced culture was centrifuged at 6,000 x g for 10 m and pellets were frozen at -80°C. Pellets were thawed and resuspended in 10 ml BPER buffer (Thermo Scientific), and an aliquot was taken for testing (lysate). Lysozyme (20 u/ml) and DNase I (25 U/ml) was added to help complete cell lysis. The lysed cells were centrifuged at 12,000 x g for 10 minutes and the supernatant was collected (soluble fraction). The insoluble pellet was resuspended in 10 ml BPER buffer and a 100 μΐ aliquot was removed (insoluble fraction). The cells in the resuspended pellet were diluted with 10 ml 10% BPER buffer and the suspension was centrifuged at 12,000 x g for 10 minutes. The supernatant was discarded and the pellet was washed again with 10 ml 10% BPER buffer 3 more times. The lysate, soluble and insoluble fractions and washes were run on a 4-12% Bis/Tris SDS- PAGE gel to confirm expression and determine the subcellular localization of the protein. The fusion proteins were found localized to the insoluble pellet in inclusion bodies. The insoluble pellet was resuspended in 10 ml denaturing binding buffer (DBB) (8 M urea, 92 mM Na ₂ HP0 ₄ , 7 mM NaH ₂ P0 ₄ , 10 mM Tris) pH 7.8. The inclusion bodies were lysed by sonication, and the lysate was cleared of debris by centrifugation at 12,000 x g for 20 minutes.

Proteins with the transmembrane regions of Rvl733c deleted were purified by column purification. Five (5) ml of HisPur Cobalt resin (Thermo Scientific) was equilibrated with DBB and incubated with 5 ml of cleared lysate. The mixture was rocked at room temperature for 90 minutes. The lysate/resin mixture was then loaded on a 30 ml column and washed with 25 volumes of denaturing wash buffer (8 M urea, 25 mM Na ₂ HP0 ₄ , 75 mM NaH ₂ P0 ₄ , 10 mM Tris, 12 mM sodium deoxycholate, pH 7.8). His-tagged protein was eluted from the Co+ column by eluting with elution buffer (8 M urea, 10 mM Tris, 5% glycerol) pH 8.0 with 50, 100, 350, 500, and 1000 mM imidazole. Eluted proteins were run on a 4-12% Bis/Tris SDS-PAGE gel and clean fractions were dialyzed stepwise from 8M urea, lOmM Tris, 5% glycerol to lOmM Tris, 5% glycerol. Dialyzed protein was analyzed by SDS-PAGE for purity, western blot for the

#28044985 vl presence of each antigen, and was assayed for the presence of residual endotoxin. Pure samples with < 0.25 U endotoxin/ml were aliquoted and frozen at

-80° C.

Proteins which have wild type Rvl733c were purified using an AKTA purifier (GE Healthcare). After the inclusion bodies were separated by BPER washes as above, the insoluble pellet was resuspended in 10 ml denaturing binding buffer (DBB) + 20mM imidazole. The inclusion bodies were lysed by sonication, and the lysate was cleared of debris by centrifugation at 12,000 x g for 20 minutes. Five (5) ml of Ni Sepharose High Performance (GE Healthcare) resin was equilibrated with DBB and incubated with 10 ml of cleared lysate. The mixture was rocked at room temperature for 2 hours. The mixture was then loaded on the AKTA purifier. All the lines used on AKTA purifier were equilibrated with DBB + 20 mM imidazole, denaturing wash buffer (8 M urea, 25 mM Na ₂ HP0 ₄ , 75 mM NaH ₂ P0 ₄ , 10 mM Tris, 12 mM sodium deoxycholate, 20mM imidazole) pH 7.8, or elution buffer (8 M urea, 10 mM Tris, 5% glycerol, 20 mM imidazole), as needed. Proteins were eluted by gradient elution (elution buffer 1 : 8 M urea, 10 mM Tris, 5% glycerol, 20 mM imidazole, run from 100% to 0; elution buffer 2: 8 M urea, 10 mM Tris, 5% glycerol, 500 mM imidazole, fun from 0 to 100%) and fractions were collected. The positive fractions were run on a 4-12% Bis-Tris SDS-PAGE gel and were dialyzed stepwise from 8 M urea, 10 mM Tris, 5% glycerol to 10 mM Tris, 5% glycerol.

Dialyzed protein was analyzed by SDS-PAGE for purity, western blot for the presence of each antigen, and was assayed for the presence of residual endotoxin. Pure samples with < 0.25 U endotoxin/ml were aliquoted and frozen at

-80° C.

The foregoing describes the purification of the 4 Ag and 5 Ag proteins that were expressed with 6xHis tags. The proteins can also be expressed without tags. The untagged proteins can be purified by combining chromatographic methods including ion exchange and size exclusion chromatography and filtration methods such as tangential flow.

Example 4: Immunogenicity of the 5 Ag and 4 Ag fusion proteins in mice

The 5 Ag fusion protein was tested for immunogenicity in CB6F 1 mice, adjuvanted with a synthetic poly I:C TLR3 agonist. Multiple other adjuvants, such as TLR4 agonists, were tested and shown to be immunogenic, and thus the embodiment is independent of the adjuvant used, and applicable to many classes of adjuvants. Mice were immunized subcutaneously twice, two weeks apart, with 1 or 10 μg of adjuvanted fusion protein. Two (2) weeks after the second immunization, the mice were sacrificed and splenocytes were isolated. The splenocytes were

#28044985 vl incubated with recombinant protein antigens for in vitro stimulation and recombinant protein or overlapping peptides for ELISpot analysis. The 5 Ag fusion protein induced significant IFN-γ responses to each antigen that were measureable by both in vitro stimulation and ELISpot (see, Figures 3A and 3B). The response to Ag85B, the most immunogenic and first antigen of the fusion protein, was much stronger to the responses to the other antigens.

The 4 Ag and 5 Ag proteins were then both tested for immunogenicity in CB6F 1 mice, adjuvanted with a synthetic MPL TLR4 agonist. Mice were immunized subcutaneous ly twice, two weeks apart, with 3 μg adjuvanted fusion protein. Splenocytes were isolated for in vitro stimulation and ELISpot. Splenocytes were stimulated with individual antigens or fusion proteins. Immunization with either the 4 Ag or 5 Ag fusion proteins induced IFN-γ responses to all antigens. Responses to ESAT6, Rvl733c, Rv2626c, and RpfD were all higher in the 4 Ag fusion protein, which lacks Ag85B, than the 5 Ag fusion protein (see, Figures 4A and 4B).

Immunogenicity studies were also performed on the fusion proteins with the wild-type Rvl733c (85B-ESAT6-Rvl733cwt-Rv2626c-RpfD and ESAT6-Rvl733cwt-Rv2626c-RpfD) and the 4 Ag fusions where RpfD was replaced by RpfB (ESAT6-Rvl733c-Rv2626c-RpfB and RpfB-ESAT6-Rvl733c-Rv2626c). These studies compared the immunogenicity of fusion proteins containing the modified Rvl733c with that of fusions containing the wild-type Rvl733c, and also the immunogenicity of fusion proteins containing RpfD with that of fusions containing RpfB. The studies showed that while replacing the modified Rvl733c with the wild- type 1733c did not affect overall immunogenicity, RpfB is significantly more immunogenic than RpfD in these fusions (see, Figures 5A and 5B).

Example 5: Ongoing Protective Efficacy

The 5 Ag and 4 Ag fusion proteins (BE1726D, E1726D) were used in a prime boost protection experiment in mice. Mice were primed with BCG SSI and recombinant BCG SSI overexpressing the 5 Mtb antigens that make up the 5 Ag fusion protein. Six (6) and 8 weeks later, the mice were boosted with either the 5 Ag or the 4 Ag protein plus a poly I:C adjuvant.

Four (4) weeks after the second boost mice received an aerosol Mtb challenge of 50-100 CFU.

Mice were then sacrificed at 4 and 12 weeks post challenge to determine viable bacteria in the lungs (see, Figure 6A) and spleen (see, Figure 6B). This experiment determined whether the large response to Ag85B is more protective in mice than the more broad response to the other 4 antigens in the 4 Ag fusion protein.

#28044985 vl Various modifications of the described subject matter, in addition to those described herein, will be apparent to those skilled in the art from the foregoing description. Such modifications are also intended to fall within the scope of the appended claims. Each reference (including, but not limited to, journal articles, U.S. and non-U.S. patents, patent application publications, international patent application publications, gene bank accession numbers, and the like) cited in the present application is incorporated herein by reference in its entirety.

#28044985 vl