BACTERICIDAL PEPTIDES AND USES THEREOF CROSS REFERENCE TO RELATED APPLICATIONS

[0001] This application claims priority under 35 U.S.C. § 119(e) to U.S. Provisional

Patent Application Number 62/314,608, filed March 29, 2016, which is expressly

incorporated by reference herein.

SEQUENCE LISTING

[0002] The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. The ASCII copy, created on March 29, 2017, is named 29920-262875_SL.txt and is 14,774 bytes.

BACKGROUND

[0003] Foodborne illness is a significant problem worldwide. The Center for Disease

Control and Prevention (CDC) estimates that 1 in 6 Americans get sick by consuming contaminated foods or beverages. In a large part due to the use of antibiotics in

nontherapeutic growth of food animals, antibiotic-resistant bacteria that contaminate food are an increasing concern.

[0004] Vibrios are Gram-negative bacteria that occur naturally in marine

environments. Among various foodborne pathogens, Vibrios are recognized as a potential fish pathogen that are capable of spreading quickly when fish are in close contact to one another. Upon infection by Vibrios, the infected fish may display lethargy, loss of appetite, and/or have necrotic sores. To date, a common method for preventing a Vibrios infection and for treating fish infected by Vibrios is to provide antibiotics in the water.

[0005] According to the Center for Disease Control (CDC), Vibrio bacteria live in saltwater. As such, consuming raw or undercooked shellfish, particularly oysters, can lead to vibriosis. It is documented that Vibrios are associated with uncooked shellfish and fish, which has had particularly significant consequences on foodborne illness. For example, several species of Vibrio, including Vibrio parahaemolyticus, are known to cause illness. Other potential human pathogens include V. vulnificus and V. cholera that can cause gastrointestinal illness. Symptoms consist of mild to moderate diarrhea, but can sometimes be severe, especially if the bacteria enter the bloodstream.

[0006] In view of the infection risks, safe shellfish preparation is necessary to avoid illness, especially among high risk people. High risk groups include people with weakened immune systems and people with chronic liver disease. Therefore, proper preparation, for example sterilization, of related food products that are sensitive to Vibrios infections is a desired development for control such bacteria mediated foodborne diseases.

[0007] Resistance to antimicrobial drugs is a natural phenomenon. As bacteria and other microbes are exposed to antibiotics, they will eventually develop resistance through random mutations and by transferring resistance genes among themselves. Therefore, continually developing new drugs and judicious use of the available drugs is required.

[0008] Antibiotic resistance can arise through the overuse, or improper use, of antibiotics in both humans and animals. On the animal side, the concern centers on antibiotics provided to entire herds to either prevent disease or promote growth. In half of the countries in the world, including the United States and Canada, antibiotics are still used as growth promoters.

[0009] Resistance that arises in animals could affect humans in two ways. Food- borne pathogens could develop their resistance in animals before going on to infect people via the food supply. Or resistance genes could be transferred from animal bacteria to human pathogens through a process known as horizontal gene transfer, where genetic material is swapped between neighboring bacteria. In either scenario food production safety and human health will be jeopardized by antibiotic resistant bacteria.

[0010] In order to effectively contain the foodborne diseases caused by marine food products, there are needs to develop novel effective alternatives to inhibit bacteria's growth and spread, hence prevent their potential harm to human health. This application provides one of such alternative.

SUMMARY

[0011] This disclosure provides compositions of antimicrobial peptides. In some embodiments, the antimicrobial peptides effectively kill various Gram-negative bacteria, particularly Vibrios bacteria strains within the genus.

[0012] In some embodiments, an antimicrobial peptide comprises an amino acid sequence of XiX ₂ X ₃ X ₄ X ₅ X6RKKX ₇ KKLX ₈ KKLSPVIPLLX ₉ XioXii (SEQ ID NO: 20), wherein Xi is a non-polar amino acid or absent, X ₂ is a basic amino acid or absent, X ₃ is a non-polar amino acid or absent, X ₄ is a basic amino acid or absent, X5 is a basic amino acid or absent, X ₆ is a non-polar amino acid, X ₇ is a non-polar amino acid, X ₈ is a non-polar amino acid, X9 is a basic amino acid or absent, X ₁₀ is a non-polar amino acid or absent, and X ₁₁ is a non-polar amino acid or absent; or a pharmaceutically acceptable salt thereof. [0013] In some embodiments, an antimicrobial peptide comprises an amino acid sequence of RGLRRLGRKIAHG VKKX 1 ₂ GPT VLRIIRIAGX 13 (SEQ ID NO: 21), wherein Xi ₂ is a polar amino acid or a non-polar amino acid and X13 is a polar amino acid or absent; or a pharmaceutically acceptable salt thereof.

[0014] This disclosure identifies effective compositions for killing foodborne bacteria found in seafood. These compositions are selected from the peptides group consisting of SEQ ID NOs: 11- 13 (BMAP-27A, BMAP-27B and BMAP-27C), SEQ ID NOs: 15-17 (SMAP-29B, SMAP-29C and SMAP-29D), and SEQ ID NOs. 18-19 (BMAP-24 and B22).

[0015] In one preferred embodiment, the aforementioned peptide is BMAP-27A.

[0016] In one preferred embodiment, the aforementioned peptide is BMAP-27B.

[0017] In one preferred embodiment, the aforementioned peptide is BMAP-27C.

[0018] In another preferred embodiment, the aforementioned peptide is SMAP-29B.

[0019] In another preferred embodiment, the aforementioned peptide is SMAP-29C.

[0020] In another preferred embodiment, the aforementioned peptide is SMAP-29D.

[0021] In another preferred embodiment, the aforementioned peptide is BMAP-24.

[0022] In another preferred embodiment, the aforementioned peptide is B22.

[0023] This disclosure further provides a method of sterilizing raw seafood. The method comprises the steps of:

identifying a seafood source that is infected by Gram-negative bacteria;

providing the aforementioned seafood source with effective amount of at least one peptide selected from the group consisting of SEQ ID NOs: 11-13 (BMAP-27A, BMAP- 27B and BMAP-27C) SEQ ID NOs: 15-17 (SMAP-29B, SMAP-29C and SMAP-29D), and SEQ ID NOs. 18-19 (BMAP-24 and B22), wherein the selected peptide kills aforementioned Gram-negative bacteria in the food source.

[0024] In one preferred embodiment, the aforementioned Gram-negative bacteria are

Vibrios.

[0025] The make and use of these peptides to sterilize raw fish and shellfish for food consumption are within the scope of the protection.

[0026] In one preferred embodiment, the aforementioned Gram-negative bacteria are a species in the Vibrios genus, an Escherichia coli, a Klebsiella pneumoniae, a Pseudomonas aeruginosa, a Serratia marcescens, or a mixture thereof.

[0027] In one preferred embodiment, the aforementioned Gram-negative bacteria are selected from the group consisting of V. cholerae (the causative agent of cholera), V. parahaemolyticus, V. vulnificus, and V. fischeri. In one preferred embodiment, the aforementioned Gram-negative bacteria are V. fischeri.

[0028] In one preferred embodiment, the aforementioned seafood is a fish or shellfish.

[0029] In one preferred embodiment, the aforementioned at least one peptide is degradable to amino acids along with said seafood consumption.

[0030] In one preferred embodiment, the aforementioned peptide is BMAP-27A.

[0031] In one preferred embodiment, the aforementioned peptide is BMAP-27B.

[0032] In one preferred embodiment, the aforementioned peptide is BMAP-27C.

[0033] In another preferred embodiment, the aforementioned peptide is SMAP-29B.

[0034] In another preferred embodiment, the aforementioned peptide is SMAP-29C.

[0035] In another preferred embodiment, the aforementioned peptide is SMAP-29D.

[0036] In another preferred embodiment, the aforementioned peptide is BMAP-24.

[0037] In another preferred embodiment, the aforementioned peptide is B22.

[0038] This disclosure further provides a method of treating Gram-negative bacteria infected animals in aquaculture. The method comprises providing the infected animals effective amount of at least one peptide selected from the group consisting of SEQ ID NOs: 11-13 (BMAP-27A, BMAP-27B and BMAP-27C), SEQ ID NOs: 15-17 (SMAP-29B, SMAP-29C and SMAP-29D), and SEQ ID NOs: 18-19 (BMAP-24 and B22).

[0039] In one preferred embodiment, the aforementioned infected animals are grown from fresh water aquaculture.

[0040] In one preferred embodiment, the aforementioned Gram-negative bacteria are

V. fischeri.

[0041] In another embodiment in accordance with the present disclosure, a method of killing Gram-negative bacteria, the method comprises contacting a Gram-negative bacteria with an antimicrobial peptide in accordance with the present disclosure; or a

pharmaceutically acceptable salt thereof.

[0042] In another embodiment in accordance with the present disclosure, a method of treating a Gram-negative bacterial infection in a subject in need thereof, the method comprises administering to the subject an effective amount of an antimicrobial peptide according to the present disclosure; or a pharmaceutically acceptable salt thereof.

[0043] The following numbered embodiments are contemplated and are non-limiting:

[0044] 1. An antimicrobial peptide comprising an amino acid sequence of

[0045] (SEQ ID NO: 20) [0046] XiX ₂ X3X ₄ X5X6R KX7KKLX ₈ KKLSPVIPLLX ₉ XioXi i

[0047] wherein X ₁ is a non-polar amino acid or absent, X ₂ is a basic amino acid or absent, X ₃ is a non-polar amino acid or absent, X ₄ is a basic amino acid or absent, X5 is a basic amino acid or absent, X ₆ is a non-polar amino acid, X ₇ is a non-polar amino acid, X ₈ is a non-polar amino acid, X9 is a basic amino acid or absent, X ₁₀ is a non-polar amino acid or absent, Xn is a non-polar amino acid or absent; or a pharmaceutically acceptable salt thereof.

[0048] 2. The antimicrobial peptide of clause 1, wherein the antimicrobial peptide comprises an amino acid sequence of

[0049] (SEQ ID NO: 24)

[0050] XiX ₂ X ₃ X ₄ X ₅ X6RKKX ₇ KKLX ₈ KKLSPVIPLLX ₉ XioXi 1

[0051] wherein

[0052] Xi is G or absent, X ₂ is R or absent, X ₃ is F, A, or absent, X ₄ is K or absent,

X5 is R or absent, X ₆ is F or L, X ₇ is F or L, X ₈ is F or A, X9 is H, K, or absent, X ₁₀ is L or absent, Xn is G or absent, provided that when X ₇ is F, X ₆ is L; or a pharmaceutically salt thereof.

[0053] 3. The antimicrobial peptide of clause 1, wherein the antimicrobial peptide comprises an amino acid sequence of

[0054] (SEQ ID NO: 22)

[0055] X ₆ RKKX ₇ KKLX ₈ KKLSPVIPLLX9XioXii

[0056] wherein X ₆ is a non-polar amino acid, X ₇ is a non-polar amino acid, X ₈ is a non-polar amino acid, X9 is a basic amino acid, X ₁₀ is a non-polar amino acid, and Xn is a non-polar amino acid; or a pharmaceutically acceptable salt thereof.

[0057] 4. The antimicrobial peptide of clause 3, wherein the antimicrobial peptide comprises an amino acid sequence of

[0058] (SEQ ID NO: 25)

[0059] X ₆ RKKX ₇ KKLX ₈ KKLSPVIPLLX9XioXii

[0060] wherein X ₆ is F or L, X ₇ is F or L, X ₈ is F or A, X9 is H or K, X ₁₀ is L, Xn is

G, provided that when X ₇ is F, X ₆ is L; or a pharmaceutically salt thereof.

[0061] 5. The antimicrobial peptide of clause 1, wherein the antimicrobial peptide comprises an amino acid sequence of

[0062] (SEQ ID NO: 23)

[0063] XiX ₂ X ₃ X ₄ X ₅ X ₆ RKKX ₇ KKLX ₈ KKLSPVIPLL

[0064] wherein Xi is a non-polar amino acid, X ₂ is a basic amino acid, X ₃ is a non- polar amino acid, X ₄ is a basic amino acid, X5 is a basic amino acid, X ₆ is a non-polar amino acid, X ₇ is a non-polar amino acid, and X ₈ is a non-polar amino acid; or a pharmaceutically acceptable salt thereof.

[0065] 6. The antimicrobial peptide of clause 5, wherein the antimicrobial peptide comprises an amino acid sequence of

[0066] (SEQ ID NO: 26)

[0067] XiX ₂ X ₃ X ₄ X ₅ X ₆ R KX ₇ KKLX ₈ KKLSPVIPLL

[0068] wherein Xi is G, X ₂ is R, X ₃ is F or A, X ₄ is K, X5 is R, X ₆ is F or L, X ₇ is F or

L, X ₈ is F or A, provided that when X ₇ is F, X ₆ is L; or a pharmaceutically salt thereof.

[0069] 7. The antimicrobial peptide of any one of clauses 1-6, wherein X ₇ is L; or a pharmaceutically acceptable salt thereof.

[0070] 8. The antimicrobial peptide of clause 1 or 2, wherein the antimicrobial peptide comprises a sequence that is at least 90%, at least 93%, or at least 95% identical to a sequence selected from the group consisting of SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 18, and SEQ ID NO: 19; or a pharmaceutically acceptable salt thereof.

[0071] 9. The antimicrobial peptide of clause 1 or 2, wherein the antimicrobial peptide comprises a sequence that is at least 90%, at least 93%, or at least 95% identical to a sequence selected from the group consisting of SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 18, and SEQ ID NO: 19; or a pharmaceutically acceptable salt thereof.

[0072] 10. The antimicrobial peptide of any one of clauses 1-8, wherein the antimicrobial peptide comprises SEQ ID NO: 11; or a pharmaceutically acceptable salt thereof.

[0073] 11. The antimicrobial peptide of any one of clauses 1-8 or 10, wherein the antimicrobial peptide consists of the amino acid sequence of SEQ ID NO: l 1; or a

pharmaceutically acceptable salt thereof.

[0074] 12. The antimicrobial peptide of any one of clauses 1-9, wherein the antimicrobial peptide comprises SEQ ID NO: 12; or a pharmaceutically acceptable salt thereof.

[0075] 13. The antimicrobial peptide of any one of clauses 1-9 or 12, wherein the antimicrobial peptide consists of the amino acid sequence of SEQ ID NO: 12; or a

pharmaceutically acceptable salt thereof.

[0076] 14. The antimicrobial peptide of any one of clauses 1-9, wherein the antimicrobial peptide comprises SEQ ID NO: 13; or a pharmaceutically acceptable salt thereof. [0077] 15. The antimicrobial peptide of any one of clauses 1-9 or 14, wherein the antimicrobial peptide consists of the amino acid sequence of SEQ ID NO: 13.

[0078] 16. The antimicrobial peptide of any one of clauses 1-2 or 5-9, wherein the antimicrobial peptide comprises SEQ ID NO: 18; or a pharmaceutically acceptable salt thereof.

[0079] 17. The antimicrobial peptide of any one of clauses 1-2, 5-9, or 16, wherein the antimicrobial peptide consists of the amino acid sequence of SEQ ID NO: 18; or a pharmaceutically acceptable salt thereof.

[0080] 18. The antimicrobial peptide of any one of clauses 1-2 or 7-9, wherein the antimicrobial peptide comprises SEQ ID NO: 19; or a pharmaceutically acceptable salt thereof.

[0081] 19. The antimicrobial peptide of any one of clauses 1-4, 7-9, or 18, wherein the antimicrobial peptide consists of the amino acid sequence of SEQ ID NO: 19; or a pharmaceutically acceptable salt thereof.

[0082] 20. The antimicrobial peptide of any one of clauses 1-19 further comprising a reporter; or a pharmaceutically acceptable salt thereof.

[0083] 21. The antimicrobial peptide of clause 20, wherein the reporter is a fluorophore; or a pharmaceutically acceptable salt thereof.

[0084] 22. A pharmaceutically acceptable salt of any one of clauses 1-21.

[0085] 23. An antimicrobial peptide comprising an amino acid sequence of

[0086] (SEQ ID NO: 21)

[0087] RGLRRLGRKIAHGVKKX 12GPTVLRIIRIAGX 13

[0088] wherein X 12 is a polar amino acid or a non-polar amino acid and X13 is a polar amino acid or absent; or a pharmaceutically acceptable salt thereof.

[0089] 24. The antimicrobial peptide of clause 19, wherein the antimicrobial peptide comprises an amino acid sequence of

[0090] (SEQ ID NO: 27)

[0091] RGLRRLGRKIAHGVKKX 1 ₂ GPT VLRIIRIAGX 13

[0092] wherein Xi ₂ is Y, C, or L and X13 is C or absent, provided that when Xi ₂ is Y,

Xi3 is C; or a pharmaceutically acceptable salt thereof.

[0093] 25. The antimicrobial peptide of clause 23 or 24, wherein Xi ₂ is C or L; or a pharmaceutically acceptable salt thereof.

[0094] 26. The antimicrobial peptide of any one of clauses 23-25, wherein the antimicrobial peptide comprises a sequence that is at least 90%, at least 93%, or at least 95% identical to a sequence selected from the group consisting of SEQ ID NO: 15, SEQ ID NO: 16, and SEQ ID NO: 17; or a pharmaceutically acceptable salt thereof.

[0095] 27. The antimicrobial peptide of any one of clauses 23-26, wherein the antimicrobial peptide comprises SEQ ID NO: 15; or a pharmaceutically acceptable salt thereof.

[0096] 28. The antimicrobial peptide of any one of clauses 23-27, wherein the antimicrobial peptide consists of the amino acid sequence of SEQ ID NO: 15; or a

pharmaceutically acceptable salt thereof.

[0097] 29. The antimicrobial peptide of any one of clauses 23-26, wherein the antimicrobial peptide comprises SEQ ID NO: 16; or a pharmaceutically acceptable salt thereof.

[0098] 30. The antimicrobial peptide of any one of clauses 23-26 or 29, wherein the antimicrobial peptide consists of the amino acid sequence of SEQ ID NO: 16; or a pharmaceutically acceptable salt thereof.

[0099] 31. The antimicrobial peptide of any one of clauses 23-26, wherein the antimicrobial peptide comprises SEQ ID NO: 17; or a pharmaceutically acceptable salt thereof.

[00100] 32. The antimicrobial peptide of any one of clauses 23-26 or 31, wherein the antimicrobial peptide consists of the amino acid sequence of SEQ ID NO: 17; or a pharmaceutically acceptable salt thereof.

[00101] 33. The antimicrobial peptide of any one of clauses 23-32 further comprising a reporter; or a pharmaceutically acceptable salt thereof.

[00102] 34. The antimicrobial peptide of clause 33, wherein the reporter is a fluorophore; or a pharmaceutically acceptable salt thereof.

[00103] 35. A pharmaceutically acceptable salt of any one of clauses 23-34.

[00104] 36. A method of killing Gram-negative bacteria, the method comprising

[00105] contacting Gram-negative bacteria with an antimicrobial peptide comprising an amino acid according to any one of clauses 1-35; or a pharmaceutically acceptable salt thereof.

[00106] 37. The method of clause 36, wherein the Gram-negative bacteria are a foodborne bacteria.

[00107] 38. The method of clause 36 or 37, wherein the Gram-negative bacteria are a species in the Vibrios genus, an Escherichia coli, a Klebsiella pneumoniae, a Pseudomonas aeruginosa, a Serratia marcescens, or a mixture thereof. [00108] 39. The method of any one of clauses 36-38, wherein the Gram-negative bacteria are found in seafood.

[00109] 40. The method of clause 39 wherein the seafood is a fish or shellfish.

[00110] 41. The method of any one of clauses 36-38, wherein the antimicrobial peptide is degraded to amino acids along with seafood consumption.

[00111] 42. The method of any one of clauses 36-41, wherein the Gram-negative bacteria are selected from the group consisting of V. cholerae (the causative agent of cholera), V. parahaemolyticus, V. vulnificus, and V. fischeri.

[00112] 43. The method of any one of clauses 36-42, wherein the Gram-negative bacteria are resistant to antibiotics.

[00113] 44. The method of any one of clauses 36-43, wherein the Gram-negative bacteria are resistant to polymyxins.

[00114] 45. The method of any one of clauses 36-44, wherein the Gram-negative bacteria are resistant to colistin.

[00115] 46. A method of treating a Gram-negative bacterial infection in a subject in need thereof, the method comprising

[00116] administering to the subject an effective amount of an antimicrobial peptide according to any one of clauses 1-35; or a pharmaceutically acceptable salt thereof.

[00117] 47. The method of clause 46, wherein the subject is an animal from an aquaculture.

[00118] 48. The method of clause 46 or 47, wherein the animal from an aquaculture is a fish or a shellfish.

[00119] 49. The method of clause 46, wherein the subject is a mammal.

[00120] 50. The method of clause 46 or 49, wherein the subject is a mouse or a human.

[00121] 51. The method of any one of clauses 46-50, 38 wherein the Gram- negative bacteria are a species in the Vibrios genus, an Escherichia coli, a Klebsiella pneumoniae, a Pseudomonas aeruginosa, a Serratia marcescens, or a mixture thereof.

[00122] 52. The method of any one of clauses 46-51, wherein the Gram-negative bacteria are selected from the group consisting of V. cholerae (the causative agent of cholera), V. parahaemolyticus, V. vulnificus, and V. fischeri.

[00123] 53. An antimicrobial peptide according to any one of clauses 1-35, or a pharmaceutically acceptable salt thereof, for use in a method of treating a Gram-negative bacterial infection in a subject. [00124] 54. Use of an antimicrobial peptide according to any one of clauses 1-35 in the manufacture of a medicament for treating a Gram-negative bacterial infection.

[00125] 55. A method of providing sterilization to raw seafood, the method comprising

[00126] contacting a seafood source with effective amount of at least one antimicrobial peptide of any one of clauses 1-35.

BRIEF DESCRIPTIONS OF THE DRAWINGS

[00127] The detailed description particularly refers to the accompanying figures in which:

[00128] Figures 1A-C show a general illustration of antimicrobial peptides. Figure 1A shows a general illustration showing how antimicrobial peptides may prevent infections (selected from Zasloff, Nature Medicine 2006). Figure IB shows a space-filling model of an antimicrobial peptide. Figure 1C shows a pictorial representation of an antimicrobial peptide (selected from Wang et al., J. Biol. Chem. 2008).

[00129] Figures 2A-D show a proposed mechanism of bacterial killing by an antimicrobial peptide (adapted from Nguyen et al. 2011. Trends in Biotechnology 29, 464). Figure 2A shows antimicrobial peptides undergo a conformational change near a bacterial membrane. Figure 2B shows a toroidal pore formed in the bacterial membrane. Figure 2C shows a disordered toroidal pore formed in a bacterial membrane. Figure 2D shows non-lytic membrane depolarization in a bacterial membrane.

[00130] Figure 3A-B show cathelicidin peptides produced by different animals. Figure

3A shows a phylogenetic relationship of cathelicidin peptides from mammals. The Figure is derived from results of Zanetti et al (J. Leuk. Biol. 2004). Figure 3B shows the names, lengths, and sequences of antimicrobial peptides with the residues predicted to form an alpha- helix underlined (SEQ ID NOS 1-9, respectively, in order of appearance).

[00131] Figures 4A-D show SMAP-29 and variants thereof kill bacteria and have reduced cytotoxicity. Figure 4A shows SMAP-29 and variants thereof effectively kill bacteria (SEQ ID NOS 14, 15 and 17, respectively, in order of appearance). The bacterial strains tested are: Klebsiella pneumoniae (K. p.), Serratia marcescens (S. m.), Enterobacter cloacae (E. cl.), Escherichia coli (E. co.), and Pseudomonas aeruginosa (P. a.). Figure 4B shows RBC lysis does not correlate with antibacterial activity. LL-37, SMAP-29, SMAP- 29B, and SMAP- 29D all had bacterial killing effects but showed decreased RBC lysis compared to the control H ₂ 0. Figure 4C shows the effective antibacterial activity does not correlate with higher mammalian cytotoxicity. Cultured human cells were tested with antimicrobial peptides LL-37, SMAP-29, SMAP-29B, and SMAP-29D. MTT assays indicated no increased cytotoxicity compared to the controls. Figure 4D shows the ability of SMAP-29 and variants thereof to enhance signal transduction by TLR3 and to suppress signal transduction by TLR4. IL-6 levels secreted by the cells were quantified using an ELISA assay. Figure 4E shows the ability of the SMAP29 series of peptides for enhancement of signal transduction by TLR3 and to suppress signal transduction by TLR4. IL-6 levels secreted by the cells were quantified using an ELISA assay.

[00132] Figures 5A-E show BMAP-27 variants thereof kill bacteria and have reduced cytotoxicity. Figure 5A shows BMAP-27 and variants thereof effectively kill bacteria (SEQ ID NOS 10-13, respectively, in order of appearance). The bacterial strains tested are:

Klebsiella pneumonia (K. p.), Serratia marcescens (S. m.), Enterobacter cloacae (E. cl.), Escherichia coli (E. co.), and Pseudomonas aeruginosa (P. a.). Figure 5B shows RBC lysis does not correlate with antibacterial activity. LL-37, BMAP-27, BMAP-27A, BMAP-27B and BMAP- 27C all had bacterial killing effects but showed decreased RBC lysis compared to the control H ₂ 0. Figure 5C shows the effective antibacterial activity does not correlate with higher mammalian cytotoxicity. Cultured human cells were tested with the

antimicrobial peptides BMAP-27, BMAP-27A, BMAP-27B, and BMAP- 27C. MTT assays indicated no increased cytotoxicity compared to the controls. Figure 5D shows the ability of BMAP-27 and variants thereof enhance signal transduction by TLR3 and suppress signal transduction by TLR4. IL-6 levels secreted by the cells were quantified using an ELISA assay. Figure 5E shows the ability of BMAP27 and variants thereof enhance signal transduction by TLR3 and suppress signal transduction by TLR4. IL-6 levels secreted by the cells were quantified using an ELISA assay.

[00133] Figures 6A-B shows the rate of bacterial killing by the antimicrobial peptides.

Figure 6A shows a comparison of SMAP-29D and BMAP-27B bacterial killing effect as compared the antibiotic Kanamycin. Figure 6B shows SMAP-29D and BMAP-27B at 2 μΜ concentration had exponentially reduced bacterial colony forming units within 5 min, measured on the bacteria strains.

[00134] Figure 7 shows multiple Vibrio species are highly sensitive to SMAP-29C.

[00135] Figure 8 shows SMAP-29D and BMAP-27B killing of V. angustum.

[00136] Figure 9 shows SMAP-29D and BMAP-27B killing of V. fischeri.

[00137] Figures 10A-B show V. vulnificus YJ016 growth curve in the absence and presence of antimicrobial peptides. Figure 10A shows the growth curve in the presence of different concentrations of BMAP-27B. Figure 10B shows the growth curve in the presence of different concentrations of SMAP-29D.

[00138] Figure 11 shows the mechanism of action of the antimicrobial peptides. Phase contrast micrographs shows three representative V. vulnificus cells that were treated for 5 min with 4 μΜ FAM-labeled SMAP-29D. The DAPI stain is colored blue and the FAM-SMAP- 29D green.

[00139] Figures 12A-B show BMAP-27B and SMAP-29D can kill colistin-resistant E. coli. Fig 12A shows colony growth of five Gram-negative bacteria treated with increasing concentrations of BMAP-27B, SMAP-29D, and colistin. lxlO ⁵ CFUs of the bacteria were incubated for 30 min with the concentration of the peptides or colistin shown.

Approximately 500 CFUs were then added as a droplet onto nonselective media for 18 h. Fig. 12B shows a quantitative analysis of the viable colonies formed by colistin-resistant bacteria. E. coli Top 10/ pHNSHP45 or the parental strain Top 10 were incubated for 5 with either colistin, BMAP-27B, or SMAP-29D prior to plating to enumerate CFUs on MH agar. The numbers are the means of three independent assays and those in parenthesis are the range for one standard deviation.

[00140] Figure 13 shows an analysis of truncated variants of BMAP-27B for bactericidal activity against E. coli harboring the mcr-1 resistance gene on a plasmid (SEQ ID NOS 12, 18 and 19, respectively, in order of appearance). Each antimicrobial peptide was assayed at a final concentration of 2 μΜ. The number of viable bacterial colonies were determined by plating on a non-selective media and enumerated. Each result is the average of three independent assays. The fold reduction in the colony forming units (CFU) was calculated by dividing the number of CFUs in the mock-treated sample with the number in the peptide-treated samples.

[00141] Figures 14A-B show that the antimicrobial peptides B22 and BMAP-24 do not enhance the activation of the production of proinflammatory cytokine IL-6 (Figure 14A) and the proinflammatory cytokine IL-8 (Figure 14B) through the Toll-like receptor 3 signaling pathway. Lung epithelial BEAS-2B cells were induced with poly(LC) at 0.1 μg/ml and the amount of IL-6 secreted into the media 20 h later was assessed by ELISA. Where present, the antimicrobial peptide was at a final concentration of 2 μΜ. Each result represents the mean and standard error of three independent assays.

[00142] Figure 15 shows the antimicrobial peptide B22 lyses fewer human red blood cells (hRBCs) and has limited cytotoxicity. The amount of hemoglobin released was measured by the absorbance at 435 nM after a 60-minute incubation with the antimicrobial peptide. The percentage of hRBC lysis was normalized to the amount hemoglobin released by the suspension of the hRBCs in deionized water. The background amount of hRBC lysis was determined by adding phosphate buffered saline (PBS) at the same volume as 8 μΜ of the peptide to the hRBC for 1 h.

[00143] Figure 16 shows the antimicrobial peptide B22 can reduce the lethal sepsis by

Vibrio vulnificus. The number of symptom-less mice in cages of 5 mice were recorded as a function of time. About 50 colony forming units of V. vulnificus were introduced into a surgical incision. The antimicrobial peptide B22 was introduced into the incision at 5 μΜ 1 h after the introduction of V. vulnificus to the surgical incision.

BRIEF DESCRIPTIONS OF THE SEQUENCES

[00144] SEQ ID NO: 1 LL-37

LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

[00145] SEQ ID NO: 2 RL-37

RLGNFFRKVKEKIGGGLKKVGQKIKDFLGNLVPRTAS

[00146] SEQ ID NO: 3 CAP-18

GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY

[00147] SEQ ID NO: 4 CRAMP

GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ

[00148] SEQ ID NO: 5 CAP- 11

GLRKKFRKTRKRIQKLGRKIGKTGRKVWKAWREYGQIPYPCRI

[00149] SEQ ID NO: 6 SMAP-34

GLFGRLRDSLQRGGQKILEKAERIWCKIKDIFR

[00150] SEQ ID NO: 7 BMAP-34

GLFRRLRDSIRRGQQKILEKARRIGERIKDIFRG

[00151] SEQ ID NO: 8 PMAP-37

GLLS RLRDFLS DRGRRLGEKIERIGQKIKDLS EFFQS

[00152] SEQ ID NO: 9 eCATH-3

KRFHS VGS LIQRHQQMIRDKS E ATRHGIRIITRPKLLLAS

[00153] SEQ ID NO: 10 BMAP-27

GRFKRFRKKFKKLFKKLS P VIPLLHLG

[00154] SEQ ID NO: 11 BMAP-27 A

GRFKRLRKKFKKLFKKLS P VIPLLHLG

[00155] SEQ ID NO: 12 BMAP-27B GRFKRLRKKLKKLFKKLS P VIPLLHLG

[00156] SEQ ID NO: 13 BMAP-27C

GRAKRLRKKLKKLAKKLS P VIPLLHLG

[00157] SEQ ID NO: 14 SMAP-29

RGLRRLGRKIAHGVKKYGPTVLRIIRIAG

[00158] SEQ ID NO: 15 SMAP-29B

RGLRRLGRKIAHGVKKCGPTVLRIIRIAG

[00159] SEQ ID NO: 16 SMAP-29C

RGLRRLGRKIAHGVKKCGPTVLRIIRIAGC

[00160] SEQ ID NO: 17 SMAP-29D

RGLRRLGRKIAHGVKKLGPTVLRIIRIAG

[00161] SEQ ID NO: 18 BMAP-24

GRFKRFRKKLKKLFKKLS P VIPLL

[00162] SEQ ID NO: 19 B22

FRKKLKKLFKKLS P VIPLLKLG

[00163] SEQ ID NO: 20

XiX ₂ X3X ₄ X5 6RKKX7KKLX ₈ KKLSPVIPLLX ₉ XioXii

[00164] SEQ ID NO: 21

RGLRRLGRKIAHGVKKX12GPTVLRIIRIAGX13

[00165] SEQ ID NO: 22

X ₆ RKKX ₇ KKLX ₈ KKLSPVIPLLX9XioXii

[00166] SEQ ID NO: 23

XiX ₂ X ₃ X ₄ X ₅ X ₆ RKKX ₇ KKLX ₈ KKLSPVIPLL

[00167] SEQ ID NO: 24

XiX ₂ X3X ₄ X5X6RKKX ₇ KKLX ₈ KKLSPVIPLLX ₉ XioXii

[00168] SEQ ID NO: 25

X ₆ RKKX ₇ KKLX ₈ KKLSPVIPLLX9XioXii

[00169] SEQ ID NO: 26

XiX ₂ X ₃ X ₄ X ₅ X ₆ RKKX ₇ KKLX ₈ KKLSPVIPLL

[00170] SEQ ID NO: 27

RGLRRLGRKIAHG VKKX ₁₂ GPT VLRIIRIAGX ₁ 3 DETAILED DESCRIPTION

[00171] Unless defined otherwise, the scientific and technology nomenclatures have the same meaning as commonly understood by a person of ordinary skill in the art pertaining to this disclosure.

[00172] In some embodiments, an antimicrobial peptide comprises an amino acid sequence of XiX ₂ X ₃ X ₄ X ₅ X ₆ RKKX ₇ KKLX ₈ KKLSPVIPLLX ₉ XioXii (SEQ ID NO: 20), wherein Xi is a non-polar amino acid or absent, X ₂ is a basic amino acid or absent, X ₃ is a non-polar amino acid or absent, X ₄ is a basic amino acid or absent, X5 is a basic amino acid or absent, X ₆ is a non-polar amino acid, X ₇ is a non-polar amino acid, X ₈ is a non-polar amino acid, X9 is a basic amino acid or absent, X10 is a non-polar amino acid or absent, and X11 is a non-polar amino acid or absent; or a pharmaceutically acceptable salt thereof.

[00173] In some embodiments, an antimicrobial peptide comprises an amino acid sequence of XiX ₂ X ₃ X ₄ X ₅ X ₆ RKKX ₇ KKLX ₈ KKLSPVIPLLX ₉ XioXii (SEQ ID NO: 24), wherein Xi is G or absent, X ₂ is R or absent, X ₃ is F, A, or absent, X ₄ is K or absent, X5 is R or absent, X ₆ is F or L, X ₇ is F or L, X ₈ is F or A, X9 is H, K, or absent, X10 is L or absent, and X11 is G or absent, provided that when X ₇ is F, X ₆ is L; or a pharmaceutically salt thereof.

[00174] In some embodiments, an antimicrobial peptide comprises an amino acid sequence of X ₆ RKKX ₇ KKLX ₈ KKLSPVIPLLX ₉ Xi ₀ Xii (SEQ ID NO: 22), wherein X ₆ is a non-polar amino acid, X ₇ is a non-polar amino acid, X ₈ is a non-polar amino acid, X9 is a basic amino acid, X10 is a non-polar amino acid, and Xn is a non-polar amino acid; or a pharmaceutically acceptable salt thereof.

[00175] In some embodiments, an antimicrobial peptide comprises an amino acid sequence of X ₆ RKKX ₇ KKLX ₈ KKLSPVIPLLX ₉ XioXii (SEQ ID NO: 25), wherein X ₆ is F or L, X ₇ is F or L, X ₈ is F or A, X9 is H or K, X10 is L, and Xn is G, provided that when X ₇ is F, X ₆ is L; or a pharmaceutically salt thereof.

[00176] In some embodiments, an antimicrobial peptide comprises an amino acid sequence of XiX ₂ X ₃ X ₄ X ₅ X ₆ RKKX ₇ KKLX ₈ KKLSPVIPLL (SEQ ID NO: 23), wherein Xi is a non-polar amino acid, X ₂ is a basic amino acid, X ₃ is a non-polar amino acid, X ₄ is a basic amino acid, X5 is a basic amino acid, X ₆ is a non-polar amino acid, X ₇ is a non-polar amino acid, and X ₈ is a non-polar amino acid; or a pharmaceutically acceptable salt thereof.

[00177] In some embodiments, an antimicrobial peptide comprises an amino acid sequence of XiX ₂ X ₃ X ₄ X ₅ X ₆ RKKX ₇ KKLX ₈ KKLSPVIPLL (SEQ ID NO: 26), wherein Xi is G, X ₂ is R, X ₃ is F or A, X ₄ is K, X5 is R, X ₆ is F or L, X ₇ is F or L, and X ₈ is F or A, provided that when X ₇ is F, X ₆ is L; or a pharmaceutically salt thereof. [00178] In some embodiments, an antimicrobial peptide comprises an amino acid sequence of RGLRRLGRKIAHG VKKX 1 ₂ GPT VLRIIRIAGX i ₃ (SEQ ID NO: 21), wherein Xi ₂ is a polar amino acid or a non-polar amino acid and X is a polar amino acid or absent; or a pharmaceutically acceptable salt thereof.

[00179] In some embodiments, an antimicrobial peptide comprises an amino acid sequence of RGLRRLGRKIAHG VKKX 1 ₂ GPT VLRIIRIAGX i ₃ (SEQ ID NO: 27), wherein Xi ₂ is Y, C, or L and Xi ₃ is C or absent, provided that when Xi ₂ is Y, Xi ₃ is C; or a pharmaceutically acceptable salt thereof.

[00180] In some embodiments, an antimicrobial peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, and a combination thereof.

[00181] Cathelicidin-related antimicrobial peptides are a family of peptides produced by macrophages and polymorphonuclear leukocytes (PMNs), and epithelial cells such as keratinocytes. cathelicidins serve a critical role in mammalian innate immune defense against invasive bacterial infection. The peptides of cathelicidin family are classified as

antimicrobial peptides.

[00182] Antimicrobial peptides are produced by organisms in all three kingdoms of life on earth to decrease the establishment of other microbes. Cathelicidins are a class of peptides typically of -25-40 amino acids in length that have a high frequency of basic amino acids. They interact with the membranes of susceptible bacteria, form higher order structures to cause leakage of ions and the death of the bacteria. Cathelicidins could also bind bacterial cell wall materials, including lipopoly saccharide (LPS) molecules that are potent inducers of the inflammatory responses. These properties have made antimicrobial peptides attractive molecules to replace antibiotics.

[00183] LL-37 is the only cathelicidin antimicrobial peptide produced by humans. The

37-residue LL-37 is generated by proteolytic cleavage of the C-terminal portion of the hCAP- 18 protein. As is the case with antimicrobial peptides, LL-37 has a large array of biological activities. For example, in addition to suppressing bacterial infection and suppressing the pro-inflammatory responses, LL-37 can promote wound healing and decreasing fibrosis.

[00184] Cathelicidin peptides have been isolated from many different species of mammals, including but not limited to humans, monkeys, mice, rats, rabbits, guinea pigs, pandas, pigs, cattle, frogs, sheep, goats, chickens, and horses. Some species produce more than one Cathelicidins. Illustratively, cathelicidins are enriched for positively-charged amino acids, but the sequences for the cathelicidins produced by different animals vary.

[00185] Currently identified cathelicidins include but not limited to the following:

• Human: hCAP-18/LL-37

• Rhesus Monkey: RL-37

• Mice: CRAMP, (Cathelicidin-related Antimicrobial Peptide)

• Rats: rCRAMP

• Rabbits: CAP- 18

• Guinea Pig: CAP- 11

• Pigs: PR-39, Prophenin, PMAP-23,36,37

• Cattle: BMAP-27 ,28,34 (Bovine Myeloid Antimicrobial Peptides); Bac5, Bac7

• Horses: eCATH-1, eCATH-2, eCATH-3

• Frogs: cathelicidin-AL (found in Amolops loloensis)

• Sheep: SMAP-29

• Chickens: Four cathelicidins, fowlicidins 1,2,3 and cathelicidin Beta-1

[00186] Previous studies have shown a consensus of how to engineer some of the known peptides in nature into a more potent bacteria-killing agent, yet reduce the human cell toxicity caused by their respective natural products. A detailed description and list of such engineered peptides are found in the PCT International Application No. PCT/US 16/63612, filed on November 23, 2016, the disclosure of which is hereby incorporated by reference in its entirety.

[00187] Vibrio is a genus of Gram-negative bacteria, possessing a curved-rod shape

(comma shape), several species of which can cause foodborne infection, usually associated with eating undercooked seafood.

[00188] Several species of Vibrio are human pathogens. Most disease-causing strains are associated with gastroenteritis, but can also infect open wounds and cause septicemia. They can be carried by numerous marine animals, such as crabs or prawns, and have been known to cause fatal infections in humans during exposure. Pathogenic Vibrio species include V. cholerae (the causative agent of cholera), V. parahaemolyticus, and V. vulnificus. V. cholerae is generally transmitted by contaminated water. Pathogenic Vibrio species can cause foodborne illness (infection), usually associated with eating undercooked seafood. The pathogenic features can be linked to quorum sensing where bacteria are able to express their virulence factor via their signaling molecules. [00189] Foodborne Vibrio infections are most often associated with eating raw shellfish. V. vulnificus is an extremely virulent pathogen found in marine environments. V. vulnificus outbreaks commonly occur in warm climates and small, generally lethal, outbreaks occur regularly. An outbreak occurred in New Orleans after Hurricane Katrina, and several lethal cases occur most years in Florida. V. vulnificus can cause gastroenteritis when ingested in oysters, septicemia in undercooked shellfish, and necrotic wounds are found with 25% mortality, 50% with septicemia.

[00190] Currently, infection with V. vulnificus is treated with antibiotics such as

Cephalosporin and a Tetracycline (Ceftriaxone and doxycycline).

[00191] V. parahaemolyticusis also associated with the Kanagawa phenomenon, in which strains isolated from human hosts (clinical isolates) are hemolytic on blood agar plates, while those isolated from nonhuman sources are not hemolytic.

[00192] Many Vibrio species are also zoonotic. Illustratively, many Vibrio can cause disease in fish and shellfish and are common causes of mortality among domestic marine life.

[00193] Several antimicrobial peptides have been identified and tested as described herein. Antimicrobial peptides in accordance with the present disclosure are efficient at killing a number of foodborne Gram-negative bacteria. In some embodiments, the Gram- negative bacteria are particularly those found in the Vibrio genus. In some embodiments, the antimicrobial peptide has reduced cytotoxicity for human cells. For example, a very low concentration of an antimicrobial peptide in accordance with the present disclosure is required to effectively kill various Gram-negative bacteria. When selective peptides such as the SMAP-29 variants or the BMAP-27 variants are tested for their bacterial killing effects, the colony forming units for various Gram-negative bacteria, including E. cloacae 4080, E. coli IU 342, K. pneumonia 8893, and K. pneumonia C-2 were reduced dramatically within minutes of the antimicrobial peptide application. The fold change can be from hundreds to thousands folds reduction (See Figs. 6A-B). Further, various vibrio species are highly sensitive to these selective peptides, such as SMAP-29 variants and BMAP-27 variants. In some embodiments, SMAP-29D and BMAP-27B efficiently kill V. angustum, V. fischeri, and V. vulnificus as shown in Figures 8-11.

[00194] In some embodiments, antimicrobial peptides in accordance with the present have reduced cytotoxicity to human cells. In some embodiments, the induction of red blood cell lysis is decreased compared to other similar peptides, such as LL-37. In some

embodiments, the TLR3/FLPR-1 mediated autoimmune response is reduced when IL-6 production was assessed in the presence of double-stranded RNA and these peptides. In some embodiments, toxin-related inflammation is inhibited by the presence of these selective antimicrobial peptides. In some embodiments, the cell metabolism rate in the presence and absence of these antimicrobial peptides are not distinguishable, as shown for example, in Figures 4C and 5C.

[00195] As one skilled in the art will appreciate, in some embodiments the

antimicrobial peptides are degradable to become non-toxic amino acids. It is contemplated that these antimicrobial peptides can be used to treat raw seafood that is infected by a Gram- negative bacterium.

[00196] In some embodiments, the antimicrobial peptides may be used to treat aquaculture. As the effective killer of the fish pathogen Vibrios, these antimicrobial peptides can also be used in the fish pond to prevent or cure infections in farm-raised fish or shellfish, etc. One advantage of such use is that the peptides do not need to be removed after the treatment since it can be degraded into non-toxic amino acid. Thus the application of these identified antimicrobial peptides (or the variants thereof that possess the similar bacterial killing effect) can become a useful tool in the food processing industry. For example, Vibrios associated with uncooked shellfish and fish have had particularly significant consequences on foodborne illness. The peptides produced in this disclosure can be used to decrease the bacterial load and render uncooked shellfish and fish safer for consumption.

[00197] In some embodiments, antimicrobial peptides in accordance with the present disclosure can be used to treat farm-harvested or wild-caught seafood. Illustratively, the seafood may be a fish or a shellfish. Illustrative shellfish include crabs, prawns, oysters, and clams.

[00198] In some embodiments, antimicrobial peptides in accordance with the present disclosure can be used to treat an infection in a subject. In some embodiments, the infection is in a wound. In some embodiments, the infected wound may be treated by contacting the infected wound with a composition comprising an antimicrobial peptide or a

pharmaceutically acceptable salt thereof.

[00199] As described herein, the antimicrobial peptides and variants thereof kill Gram- negative bacteria within minutes and effectively (with several orders of magnitude reduction in viable bacterial numbers). The mechanism of action is likely due to perforation of the bacterial membrane. The reduction in viable bacterial number will decrease the infection of the aquaculture product and potential consumers of the aquaculture product. Application of these anti-microbial peptides in seafood preparation and aquafarming is contemplated within this disclosure. [00200] Antimicrobial peptides and variants thereof may comprise polar amino acids.

In some embodiments, polar amino acids are selected from the group consisting of asparagine (Asn, N), cysteine (Cys, C), glutamine (Gin, Q), serine (Ser, S), threonine (Thr, T), and tyrosine (Tyr, Y). It should be understood that acceptable polar amino acid variants include D-amino acids, peptoids, synthetic peptides, and any suitable alternative thereof.

[00201] Antimicrobial peptides and variants thereof may comprise non-polar amino acids. In some embodiments, the non-polar amino acids are selected from the group consisting of alanine (Ala, A), glycine (Gly, G), isoleucine (He, I), leucine (Leu, L), methionine (Met, M), phenylalanine (Phe, F), proline (Pro, P), tryptophan (Trp, W), and valine (Val, V). It should be understood that acceptable non-polar amino acid variants include D-amino acids, peptoids, synthetic peptides, and any suitable alternative thereof.

[00202] Antimicrobial peptides and variants thereof may comprise basic amino acids.

In some embodiments, the basic amino acids are selected from the group consisting of arginine (Arg, R), lysine (Lys, K), and histidine (His, H). In some embodiments, the basic amino acids comprise functional groups capable of being positively charged at physiological pH. Representative basic functional groups include amines, guanidines, and heteroaromatic rings capable of being ionized at physiological pH. It should be understood that acceptable basic amino acid variants include D-amino acids, peptoids, synthetic peptides, and any suitable alternative thereof.

[00203] Antimicrobial peptides and variants thereof may comprise acidic amino acids.

In some embodiments, acidic amino acids are selected from aspartic acid (Asp, D) glutamic acid (Glu, E), and derivatives thereof. In some embodiments, acidic amino acids comprise carboxylates or any other common functional group that is negatively charged at

physiological pH. It should be understood that acceptable acidic amino acid variants include D-amino acids, peptoids, synthetic peptides, and any suitable alternative thereof.

[00204] In some embodiments, peptides, sometimes called antimicrobial peptides, kill

Gram-negative bacteria. In some embodiments, the Gram-negative bacteria are selected from the group consisting of Vibrios genus, an Escherichia coli, an Enterobacter cloacae, an Enter ococcus faecalis, & Klebsiella pneumoniae, a Serratia marcescens, a Pseudomonas aeruginosa, and a mixture thereof. In some embodiments, the Gram-negative bacteria are selected from the group consisting of Vibrios genus, an Escherichia coli, a Klebsiella pneumoniae, a Pseudomonas aeruginosa, and a mixture thereof. In some embodiments, the Gram- negative bacteria is from the Vibrios genus. In some embodiments, the Gram- negative bacteria is an Escherichia coli. In some embodiments, the Gram-negative bacteria is an Enterobacter cloacae. In some embodiments, the Gram-negative bacteria is an Enterococcus faecalis. In some embodiments, the Gram-negative bacteria is a Klebsiella pneumoniae. In some embodiments, the Gram-negative bacteria is a a Serratia marcescens. In some embodiments, the Gram-negative bacteria is a Pseudomonas aeruginosa. fischeri

[00205] In some embodiments, the Vibrios is selected from the group consisting of V. parahaemolyticus, V. vulnificus, V. fischeri. and V. harveyi. In some embodiments, the Vibrios is selected from the group consisting of V. parahaemolyticus, V. vulnificus, and V. fischeri. In some embodiments, the Vibrios is V. parahaemolyticus. In some embodiments, the Vibrios is V. vulnificus. In some embodiments, the Vibrios is V. fischeri. In some embodiments, the Vibrios is V. harveyi.

[00206] In other embodiments of the methods described herein, pharmaceutically acceptable salts of the compositions described herein are provided. Pharmaceutically acceptable salts of compositions described herein include acid addition and base salts thereof.

[00207] Suitable acid addition salts of the compositions described herein are formed from acids which form non-toxic salts. Illustrative examples include the acetate, aspartate, benzoate, besylate, bicarbonate/carbonate, bisulphate/sulphate, borate, camsylate, citrate, edisylate, esylate, formate, fumarate, gluceptate, gluconate, glucuronate,

hexafluorophosphate, hibenzate, hydrochloride/chloride, hydrobromide/bromide,

hydroiodide/iodide, isethionate, lactate, malate, maleate, malonate, mesylate, methylsulphate, naphthylate, 2-napsylate, nicotinate, nitrate, orotate, oxalate, palmitate, pamoate,

phosphate/hydrogen phosphate/dihydrogen phosphate, saccharate, stearate, succinate, tartrate, tosylate and trifluoroacetate salts.

[00208] Suitable base salts of the compositions described herein are formed from bases which form non-toxic salts. Illustrative examples include the arginine, benzathine, calcium, choline, diethylamine, diolamine, glycine, lysine, magnesium, meglumine, olamine, potassium, sodium, tromethamine and zinc salts. Hemisalts of acids and bases may also be formed, for example, hemisulphate and hemicalcium salts.

[00209] In yet other embodiments, pharmaceutical formulations are provided.

Illustratively, a pharmaceutical formulation comprises a peptide, sometimes called an antimicrobial peptide, described in accordance with the present disclosure. In one illustrative embodiment, the pharmaceutical formulation comprises any of the pharmaceutical compositions described herein. The previously described embodiments of the pharmaceutical compositions are applicable to the pharmaceutical formulations described herein. [00210] The type of formulation employed for the administration of the compounds, sometimes called a peptide or an antimicrobial peptide, may be dictated by the particular compounds employed, the type of pharmacokinetic profile desired from the route of administration and the compound(s), and the state of the patient. The peptides may be formulated as pharmaceutical compositions for systemic administration. Such

pharmaceutical compositions and processes for making the same are known in the art for both humans and non-human mammals. See, e.g., Remington: The Science and Practice of Pharmacy, (A. Gennaro, et ah, eds., 19 ^th ed., Mack Publishing Co., 1995).

[00211] In some embodiments, the pharmaceutical formulations described herein further comprise a pharmaceutically acceptable carrier. In some embodiments, the pharmaceutical formulations described herein further comprise a pharmaceutically acceptable diluent. Diluent or carrier ingredients used in the pharmaceutical compositions containing peptides can be selected so that they do not diminish the desired effects of the peptide.

Examples of suitable dosage forms include aqueous solutions of the peptides, for example, a solution in isotonic saline, 5% glucose or other well-known pharmaceutically acceptable liquid carriers such as alcohols, glycols, esters, and amides.

[00212] As used herein, "carrier" refers to any ingredient other than the active component(s) in a formulation. Pharmaceutically acceptable carriers are determined in part by the particular composition being administered, as well as by the particular method used to administer the composition {see, e.g., Remington's Pharmaceutical Sciences, 17th ed. (1985)). The choice of carrier will to a large extent depend on factors such as the particular mode of administration, the effect of the carrier on solubility and stability, and the nature of the dosage form. In one illustrative aspect, the carrier is a liquid carrier.

[00213] As used herein, the term "pharmaceutically acceptable" includes "veterinarily acceptable", and thus includes both human and animal applications independently. For example, a "patient" as referred to herein can be a human patient or a veterinary patient, such as a domesticated animal {e.g., a pet) or a food animal.

[00214] In some embodiments, the pharmaceutical formulations described herein optionally include one or more other therapeutic ingredients. As used herein, the term "active ingredient" or "therapeutic ingredient" refers to a therapeutically active compound, as well as any prodrugs thereof and pharmaceutically acceptable salts, hydrates, and solvates of the compound and the prodrugs. Other active ingredients may be combined with the described peptides and may be either administered separately or in the same pharmaceutical formulation. The amount of other active ingredients to be given may be readily determined by one skilled in the art based upon therapy with described peptides.

[00215] In some embodiments, the pharmaceutical formulations described herein are a single unit dose. As used herein, the term "unit dose" is a discrete amount of the composition comprising a predetermined amount of the described peptides. The amount of the described peptides is generally equal to the dosage of the described peptides which would be

administered to an animal or a convenient fraction of such a dosage such as, for example, one-half or one-third of such a dosage.

[00216] In one illustrative aspect, parenteral formulations may be suitably formulated as a sterile non-aqueous solution or as a dried form to be used in conjunction with a suitable vehicle such as sterile, pyrogen-free water. The preparation of parenteral formulations under sterile conditions, for example, by lyophilization, may readily be accomplished using standard pharmaceutical techniques well known to those skilled in the art.

[00217] The aqueous preparations according to the invention can be used to produce lyophilisates by conventional lyophilization or powders. The preparations according to the invention are obtained again by dissolving the lyophilisates in water or other aqueous solutions. The term "lyophilization," also known as freeze-drying, is a commonly employed technique for presenting proteins which serves to remove water from the protein preparation of interest. Lyophilization is a process by which the material to be dried is first frozen and then the ice or frozen solvent is removed by sublimation in a vacuum environment. An excipient may be included in pre-lyophilized formulations to enhance stability during the freeze-drying process and/or to improve the stability of the lyophilized product upon storage. For example, see Pikal, M. Biopharm. 3(9)26-30 (1990) and Arakawa et ah, Pharm. Res., 8(3):285-291 (1991).

[00218] In some embodiments, the peptides in accordance with the present disclosure are described as antimicrobial peptides. In one embodiment, the solubility of the

antimicrobial peptides used in the preparation of a parenteral formulation may be increased by the use of appropriate formulation techniques, such as the incorporation of solubility- enhancing agents.

[00219] In various embodiments, formulations for parenteral administration may be formulated to be for immediate and/or modified release. Modified release formulations include delayed, sustained, pulsed, controlled, targeted and programmed release formulations. Thus, a peptide may be formulated as a solid, semi-solid, or thixotropic liquid for

administration as an implanted depot providing modified release of the active compound. [00220] In other various embodiments, the administration according to the described methods is performed as a single dose administration. In other embodiments, the

administration according to the described methods is performed as a multiple dose

administration.

[00221] The formulations can be presented in unit-dose or multi-dose sealed containers, such as ampules and vials. The formulations can also be presented in syringes, such as prefilled syringes.

[00222] In various embodiments, the dosages of the antimicrobial peptides can vary significantly depending on the patient condition and the severity of the disease to be treated. The effective amount to be administered to a patient is based on body surface area, patient weight or mass, and physician assessment of patient condition.

[00223] As used herein, the term "effective amount" refers to an amount of an antimicrobial peptide, peptide, drug, or pharmaceutical agent that elicits the biological or medicinal response in a subject (i.e. a tissue system, animal or human) that is being sought by a researcher, veterinarian, medical doctor or other clinician, which includes, but is not limited to, alleviation of the symptoms of the disease or disorder being treated. In one aspect, the effective amount is that amount of an active which may treat or alleviate the disease or symptoms of the disease at a reasonable benefit/risk ratio applicable to any medical treatment. In another aspect, the effective amount is that amount of an inactive prodrug which when converted through normal metabolic processes to produce an amount of active drug capable of eliciting the biological or medicinal response in a subject that is being sought.

[00224] It is also appreciated that the dose, whether referring to monotherapy or combination therapy, is advantageously selected with reference to any toxicity, or other undesirable side effects, that might occur during administration of one or more of the antimicrobial peptides described herein. Further, it is appreciated that the co-therapies described herein may allow for the administration of lower doses of antimicrobial peptides that show such toxicity, or other undesirable side effects, where those lower doses are below thresholds of toxicity or lower in the therapeutic window than would otherwise be

administered in the absence of a co-therapy.

[00225] As used herein, "administering" includes all means of introducing the antimicrobial peptides and compositions described herein to the host animal, including, but are not limited to, oral (po), intravenous (iv), intramuscular (im), subcutaneous (sc), transdermal, inhalation, buccal, ocular, sublingual, vaginal, rectal, and the like. The antimicrobial peptides and compositions described herein may be administered in unit dosage forms and/or formulations containing conventional nontoxic pharmaceutically-acceptable carriers, adjuvants, and/or vehicles.

[00226] As used herein "pharmaceutical composition" or "composition" refers to a mixture of one or more of the antimicrobial peptides described herein, or pharmaceutically acceptable salts, solvates, hydrates thereof, with other chemical components, such as pharmaceutically acceptable excipients. The purpose of a pharmaceutical composition is to facilitate administration of an antimicrobial peptide to a subject. Pharmaceutical

compositions suitable for the delivery of antimicrobial peptides described and methods for their preparation will be readily apparent to those skilled in the art. Such compositions and methods for their preparation may be found, for example, in 'Remington's Pharmaceutical Sciences', 19th Edition (Mack Publishing Company, 1995).

[00227] Suitable dosages of the antimicrobial peptides can be determined by standard methods, for example by establishing dose-response curves in laboratory animal models or in humans in clinical trials. Illustratively, suitable dosages of antimicrobial peptides

(administered in a single bolus or over time) include from about 1 pg/kg to about 10 μg/kg, from about 1 pg/kg to about 1 μg/kg, from about 100 pg/kg to about 500 ng/kg, from about 1 pg/kg to about 1 ng/kg, from about 1 pg/kg to about 500 pg/kg, from about 100 pg/kg to about 500 ng/kg, from about 100 pg/kg to about 100 ng/kg, from about 1 ng/kg to about 10 mg/kg, from about 1 ng/kg to 1 mg/kg, from about 1 ng/kg to about 1 μg/kg, from about 1 ng/kg to about 500 ng/kg, from about 100 ng/kg to about 500 μg/kg, from about 100 ng/kg to about 100 μg/kg, from about 1 μg/kg to about 500 μg/kg, or from about 1 μg/kg to about 100 μg/kg. In each of these embodiments, dose/kg refers to the dose per kilogram of a patient's or animal's mass or body weight.

[00228] The make and use of these peptides to sterilize raw fish and shellfish for food consumption are within the scope of the protection.

[00229] This disclosure identifies effective compositions for killing bacteria. In some embodiments, the bacteria is a foodborne bacteria. In some embodiments, the bacteria is a foodborne bacteria found in seafood. In some embodiments, these compositions are selected from the peptides group consisting of SEQ ID NO: 11 (BMAP-27A), SEQ ID NO: 12 (BMAP- 27B), SEQ ID NO: 13 (BMAP-27C), SEQ ID NO: 15 (SMAP-29B), SEQ ID NO: 16 (SMAP- 29C), SEQ ID NO: 17 (SMAP-29D), SEQ ID NO: 18 (BMAP-24), and SEQ ID NO: 19 (B22).

[00230] Material and Method

[00231] Cells and reagents - The BEAS-2B cell line was from the American Type

Culture Collection and cultured in BEGM media with its supplements (11; Lonza). Peptides without or with covalently attached fluorophores were custom synthesized (Karybaybio) and purified to at least 95% purity. siRNAs specific to FPRL1 (sc-40123), EGFR (sc-29301), or a nonspecific control siRNA (sc-37007) were from Santa Cruz Biotechnology.

[00232] Quantification ofIL-6 - IL-6 production was quantified by ELISA using the

OptEIA™ kit (BD Biosciences). A typical assay used 2 x 10 ⁴ BEAS-2B cells/well grown for

24 h in flat-bottom 96-well plates. Poly(LC) was added to a final concentration of 0.13 μg/ml.

[00233] MIC determination - Antimicrobial activity was determined using the broth microdilution method based on the general recommendation of the Clinical and Laboratory Standards Institute. Bacteria were grown in Mueller-Hinton broth at 37 °C until OD ₆ 25 reached 0.06, and then bacteria were further diluted into 1:20 for later use. Peptides were diluted in Mueller-Hinton broth at concentrations of 1, 2, 4, 8, 16, and 32 μg/ml. 10 microliter (μί) of diluted bacteria was mixed with 90 μΐ _^ of peptides at varying

concentrations followed by incubation at 37 °C for 16-18 hours. The MIC is the lowest peptide concentration at which visible growth was inhibited. The MIC value was determined at least twice in independent experiments and typically in 3-4 assays.

[00234] Hemolytic activity - The hemolytic activities of peptides were determined using human red blood cells (hRBCs) (Innovative Research, Inc., cat. # IPLA-WB3-18103). The hRBCs were washed three times with PBS and then resuspended in PBS. The hRBCs solution was mixed with serial dilutions of the peptides in PBS buffer. The reaction mixtures were incubated for 45 min at 37 °C. After centrifugation at 94 x g for 10 min, the intact RBCs were pelleted and the hemoglobin released from RBCs was monitored by measuring the absorbance of the supernatant at 415 nm. The background level of absorbance was measured in sampled incubated with only PBS buffer. 100% hemolysis was determined in sampled incubated with water. The percentage of hemolysis was calculated according to the following equation.

[00235] Percentage of hemolysis= [(A _sam pie-A _b iank)/A water]* 100%

[00236] Vibrios killing activity - Vibrios bacteria such as V. angustum or Vfischeri were cultured in LM at 30 °C. The V. angustum culture was 200x diluted, V. fischeri culture was 40x diluted. For V. angustum culture, peptides SMAP-29 C and BMAP-27B at concentrations of 0.1 μΜ, 0.5 μΜ, and 1 μΜ were prepared. For V. fischeri culture, peptides SMAP-29 C and BMAP-27B at concentrations of 0.5 μΜ, 1 μΜ, and 2 μΜ were prepared. The peptides were incubated with the bacteria for 1 hour at 30 °C before plated into the bacteria culture (100 μΐ _^ peptides and 20 μΐ _^ mock). The culture and peptides were incubated overnight and Colony Forming Units (CFUs) were counted.

[00237] Selective antimicrobial peptides have effective activity against various species of Gram-negative bacterium, particularly to fish/human pathogens from Vibrios genus, as will be exemplified below.

[00238] The high efficiency of bacterial killing and the low toxicity of these peptides provide insights to alternative solutions to serve food processing industry and aquafarming, which is of great value to the entire consumer industry.

[00239] EXAMPLES

[00240] The following examples present features, aspects and advantages of the present invention. They are for illustrative purposes only. Any and all changes and modifications that come within the spirit of the disclosure are desired to be protected.

[00241] EXAMPLE 1

[00242] Selective antimicrobial peptides against 19 Gram-Negative Strains of Bacteria

[00243] Various antimicrobial peptides required minimal inhibitory concentrations against 19 Gram-negative strains bacteria. Table 1 shows that SMAP 29 and BMAP 27 variants have low concentration requirement (16 μg/ml) to effectively inhibit almost all or at least majority of Gram-negative strains of bacteria. For example, BMAP-27, BMAP-27A, and BMAP-27B were able to completely inhibit all tested strains at or below 16μg/ml of peptide. SMAP-29, SMAP-29B, and SMAP-29D were able to inhibit 16/19 strains tested at or below 16 μg/ml of peptide. This provides an opportunity to use SMAP-29 and BMAP-27 variants to contain infection by the Gram- negative bacteria in applicable situations. For Gram-positive bacteria, little inhibitory effects were observed. Thus, the peptides can be considered to have a more narrow spectrum of bacterial killing (Table 2).

[00244] Table 1. Minimal inhibitory concentrations of select antimicrobial peptides against 19 Gram-negative strains Table 1. Minimal inhibitory concentrations of select antimicrobial peptides against 19 Gram-negative strains

[00245] EXAMPLE 2

[00246] Antimicrobial peptides are not potent inhibitors of Gram-positive bacteria

[00247] As described in Example 1, the prepared non-natural BMAP-27 and SMAP-29 variants did not show efficacy against Gram-positive bacteria as shown in Table 2.

[00248] Table 2. MIC of select peptides to four Gram-positive bacteria.

[00249] This example shows in Table 2 that the peptides that are effective killing or inhibiting Gram-negative bacteria are not potent inhibitors of Gram-Positive strains, as the minimum required concentration is or larger than 16μg/ml, as compared to the Gram- negative bacteria MIC shown in Table 1.

[00250] EXAMPLE 3

[00251] SMAP-29 variants have efficient bacterial killing and reduced cytotoxicity

[00252] SMAP-29 and its non-natural variants SMAP-29B and SMAP-29D were able to kill various strains of Gram-negative bacteria efficiently with reduced cytotoxicity to the human cells (see Figures 4A-E and its legend).

[00253] As described above in Figures 4A-E, SMAP-29 and its non-natural variants

SMAP-29B and SMAP-29D were able to inhibit majority of tested Gram- negative strains. However, the cytotoxicity of these peptides was reduced, or at least not worse than the control that causes cytotoxicity, as measured by red blood cell lysis, double-strand RNA induced IL-6 production (pro-inflammation), the inhibitory effect to LPS induced cytokine production, and cell metabolism rate of MTT assay. [00254] EXAMPLE 4.

[00255] The non-natural SMAP-27 variants have efficient bacterial killing and reduced cytotoxicity

[00256] BMAP-27 and its variants BMAP-27B and BMAP-27D were able to kill various strains of Gram-negative bacteria efficiently with reduced cytotoxicity to the human cells (see Figures 5A-E and its legend).

[00257] As described above in Figures 5A-E, BMAP-27 and its variants BMAP-27A,

B and C were able to inhibit all of tested Gram- negative strains. However, the cytotoxicity of these peptides was reduced, as measured by red blood cell lysis, double strand RNA-induced IL-6 production (pro-inflammation), the inhibitory effect to LPS induced cytokine production, and cell metabolism rate of MTT assay.

[00258] EXAMPLE 5

[00259] SMAP-29D and BMAP-27B have very rapid bacterial killing

[00260] Variants SMAP-29D and BMAP-27B have more efficient bacterial killing ability as compared to the antibiotics, such as Kanamycin (See Figure 6A). The rate of bacterial killing or these peptides are measured in terms of minutes, reflected by the colony forming unit reduction within 5 minutes. The bacterial fold reduction for various Gram- negative strains ranges from hundreds to thousands within 5 minutes and by 3 hours of application, the visible colonies are down to tens for most of the bacterial strains tested. (See Figure 6B).

[00261] EXAMPLE 6

[00262] Multiple Vibrio Species are highly sensitive to SMAP-29C

[00263] Bacteria within Vibrio genus are highly sensitive to the SMAP-29C peptide.

Various strains of Vibrio were treated with increasing concentrations of SMAP-29C (See Figure 7). V. angustum, V. fischeri, and V. harveyi all showed growth reduction correlation to the concentration of SMAP-29C. This indicates that SMAP-29C is killing vibrio bacteria in a dose dependent manner.

[00264] EXAMPLE 7

[00265] SMAP-29D and BMAP-27B killing of V angustum

[00266] A fold reduction of V. angustum in the bacteria cultures with SMAP-29D or

BMAP-27B was measured, indicating that V. angustum is highly sensitive to these two antimicrobial peptide variants. See Figure 8. The fold change compared to mock controls are tens of thousands of folds. This indicates that SMAP-29D and BMAP-27B can be effective in treating a raw fish product that is infected by V. angustum.

[00267] EXAMPLE 8

[00268] SMAP-29D and BMAP-27B killing of V. fischeri

[00269] A fold reduction of V. fischeri in the bacteria cultures with SMAP-29D or

BMAP-27B was measured, indicating that V. fischeri is highly sensitive to these two antimicrobial peptide variants. See Figure 9. The fold change compared to mock controls are tens of thousands of folds. These results indicate that SMAP-29D and BMAP-27B can be effective in treating a raw fish product that is infected by V. fischeri.

[00270] EXAMPLE 9

[00271] V. vulnificus growth curve YJ106 is greatly reduced by BMAP-27B or SMAP-

29D

[00272] V. vulnificus growth measured by OD600 was inhibited in a dose-dependent manner, especially by BMAP-27B at 1 μΜ concentration. The nearly complete inhibition by BMAP-27B to V. vulnificus at 1 μΜ suggests that the peptide can be an efficient tool to sterilize a raw fish product.

[00273] EXAMPLE 10

[00274] Mechanism of action for bacterial killing by the cathelicidins

[00275] Illustratively, BMAP-27B and SMAP-29D may interact with the Gram- negative membrane and cause the loss of the integrity of the cellular content. To confirm that this is the case, phase contrast fluorescence microscopy with V. vulnificus treated for 5 min was performed with 4 μΜ Fluorescein-labeled SMAP-29D (Figure 11). The FAM-labeled SMAP-29D had comparable bactericidal activity as SMAP-29D. The V. vulnificus cells treated with FAM-SMAP-29D all exhibited a bulge in the membrane that typically located close to the midpoint of the cells, the site expected for bacterial binary fission to take place. Within the membrane, it is clear that FAM-SMAP-29D is concentrated. When stained with DAPI to localize the V. vulnificus chromosome, the bacterial chromosome appears to be partially displaced into the membrane-encased bulge. These results suggest the SMAP-29D interacts with the cytoplasmic membrane of the bacteria, weakens its ability to withstand osmolysis that then cause a relocation of the bacterial chromosomal DNA. [00276] EXAMPLE 11

[00277] BMAP-27B and SMAP-29D can kill colistin-resistant bacteria.

[00278] Recently, plasmid-mediated polymyxin resistance encoded by the mcr-1 gene was found in multiple Gram-negative bacteria first in Southeastern China, then in many other countries including the United States. Whether BMAP-27B and SMAP-29D could kill the E. coli strain harboring the mcr-1 gene on a plasmid named pHNSHP45 in southern China named pHNSHP45 was examined. E. coli Top 10 harboring pHNSHP45 (Topl0pHNSHP45) was resistant to colistin, as expected, but killed by 2 μΜ BMAP-27B and SMAP-29D with only a 5 minute incubation (Figure 12A). Top 10 lacking the mcr-1 plasmid was sensitive to all three antibiotics. BMAP-27D and SMAP-29C reduced Topl0pHNSHP45 colony formation by several logs with only a 5 minute incubation while colistin had little effect (Figure 12B). BMAP-27 and SMAP-29D had comparable MICs for ToplO and

Topl0pHNSHP45. These results show that Topl0pHNSHP45 apparently does not confer cross-resistance to BMAP-27B or SMAP-29D. Furthermore, BMAP-27B and SMAP-29D could effectively kill colistin-resistant bacteria.

[00279] EXAMPLE 12

[00280] Identification of B22 and BMAP-24

[00281] Bactericidal peptides shorter than BMAP-27B or SMAP-29D that retain the activities of these peptides were generated. The reduced length should decrease the cost of synthesis and increase the efficiency of synthesis. The sequence of BMAP-27B was used to generate a series of truncated peptides. A number of the peptides with truncations, amino acids substitutions were generated and tested for the killing of colistin-resistant E. coli, Topl0pHNSHP45. Two peptides were found to have improved bactericidal activity relative to BMAP-27B (Figure 13). BMAP-24 that contains residues 1-24 of BMAP-27B and B22, which lacks 5 residues at the N-terminal region of BMAP-27B, reduced the number of viable colonies relative to BMAP27B. Both BMAP-24 and B22 had improved MIC against the majority of the 19 strains of Gram- negative bacteria used to select for effective cathelicidins (Table 3). Similar to BMAP-27B, BMAP-24, and B22 had higher MICs against the majority of Serratia marcescens strains. The lengths and bactericidal activities of BMAP-24 and B22 were selected for additional characterizations. [00282] Table 3. Summary of the minimal inhibitory concentrations (MIC) of B22 and BMAP-24 against 19 strains of Gram-negative bacteria. The MIC of BMAP-27 is provided as a comparator.

[00283] BMAP-24 and B22, like BMAP-27B, remain less able to inhibit Gram- positive bacteria. The MICs for two strains of S. aureus were higher than or equal to 64 μΜ. With two strains of Enterococcus fecalis, the MICs were comparable or worse than the MIC for BMAP-27B (Table 4). These results show that B22 and BMAP-24 have reduced ability to kill Gram-positive bacteria; they are more specific to Gram-negative bacteria.

[00284] Table 4. Minimal inhibitor concentration (MIC) of peptides BMAP-24 and

B22 against Gram-positive bacteria. BMAP-24

Species Strain (μΜ) B22 (μΜ) BMAP-27B (μΜ)

Escherichia coli ATCC 25922 2 2 3

Staphylococcus aureus 29213 >64 >64 >64

Staphylococcus aureus 25923 >64 >64 >64

Enterococcus faecalis 51299 4 >32 8

Enterococcus faecalis 29212 4 >32 4

[00285] Clinical isolates of K. pneumoniae from healthcare facilities from Indiana healthcare facilities that have been identified to be carbapenem resistance were obtained. Of these, two have been identified to have the NDM1 gene. In a screen for colistin-resistance, three strains were also found to have high MICs for colistin sulfate (Table 5). B22 and BMAP-24 had MICs of 4 μΜ or lower with the carbapenem-resistant K. pneumoniae. These results show that B22 and BMAP-24 can inhibit colistin-resistant and carbapenem-resistant bacteria. BMAP-27B was also demonstrated to inhibit colistin-resistant and carbapenem- resistant bacteria. Thus, B22 and BMAP-24 retained these two important activities.

[00286] Table 5. Minimal inhibitor concentration (MIC) of peptides BMAP-24 and

B22 on bacteria resistance to Colistin sulfate and carbapenems.

[00287] EXAMPLE 13

[00288] B22 has reduced activation of Toll-like receptor 3 in vitro

[00289] Previous analysis has shown that BMAP-27B and SMAP-29D have reduced activation of proinflammatory response when compared to that of the human cathelicidin LL- 37 (Figure 4). Given that B22 and BMAP-24 have improved bactericidal activities compared to BMAP-27B, the production of the cytokine interleukin 6 (IL-6) and Interleukin 8 (IL-8) in response to the presence of poly(LC), a potent agonist of Toll-like receptor 3 that could activate the production of proinflammatory cytokines was measured. The lung epithelial BEAS-2B cells were used and B22 and BMAP-27B at 2 μΜ had only minimal production of both IL-6 and IL-8 (Figures 14A, B). B22 and BMAP-24 are not activators of

proinflammatory activity.

[00290] Another potential source of cytotoxicity for antimicrobial peptides is the lysis of human cells. To examine this, B22 and BMAP-24 were tested for the lysis of human red blood cells (hRBCs). A range of concentrations from 2 to 8 μΜ were examined. LL-37, which has previously demonstrated hRBC lysis activity, lysed hRBC when present at 4 or 8 μΜ (Figure 15). BMAP-24 also was able to lyse hRBC and in a concentration-dependent manner. B22, however, had only minimal hRBC lysis at concentrations up to 8 μΜ (Figure 15).

[00291] EXAMPLE 14

[00292] B22 can prevent lethal sepsis in mice

[00293] The efficacy of B22 as a bacteriocide of Gram-negative bacteria and its inability to activate proinflammatory cytokines and reduced lysis of human red blood cells prompted us to examine its efficacy in an animal-bacterial infection model. A lethal sepsis model from Vibrio vulnificus infection of CD-I mice was selected. V. vulnificus has an LD ₅₀ of 10 cfu in this model and 300 cfu was introduced to a surgical incision in the back of the mice. Cages of 5 mice were monitored every 2 h. Mice treated with the media for V.

vulnificus and with B22 alone exhibited no symptom throughout the experiment (Figure 16). Mice inoculated with V. vulnificus but not treated with B22 all succumbed to the infection within 24h. Mice that had 10 μΐ, of B22 at 5 μΜ 1 h added to the surgical incision 1 h after the introduction of V. vulnificus had 4 micethat exhibited no symptoms and 1 that had to be euthanized. These results show that B22 added at 1 h after the inoculation of the highly lethal pathogen V. vulnificus could prevent sepsis induced by V. vulnificus.

[00294] While the disclosure has been illustrated and described in detail in the foregoing figures and description, the same is to be considered as exemplary and not restrictive in character, it being understood that only illustrative embodiments thereof have been shown and described and that all changes and modifications that come within the spirit of the disclosure are desired to be protected. References

[00295] Nguyen, L.T. et al., "The expanding scope of antimicrobial peptide structures and their modes of action," Trends in Biotechnology, 2011, 9, 464-472.

[00296] Zasloff, M. "Defending the epithelium," Nature Medicine, 2006, 12, 607-608.

[00297] Wang, G. "Structures of Human Host Defense Cathelicidin LL-37 and Its

Smallest Antimicrobial Peptide KR-12 in Lipid Micelles," J. Biol. Chem., 2008, 283, 32637-

32643.

[00298] Zanetti, M., "Cathelicidins, multifunctional peptides of the innate immunity,"

J. of Leukocyte Biology, 2004, 75, 39-48.

[00299] Liu YY et al, "Emergence of plasmid-mediated colistin resistance mechanism

MCR- 1 in animals and human beings in China: a microbiological and molecular biological study," Lancet Inf Dis, 2016, 16, 161-168.

[00300] Rhouma M et al., "Colistin in pig production: chemistry, mechanism of antibacterial action, microbial resistance, and one health perspectives," Fron. Microb., 2016, 7, 1789, 22 pages.

[00301] Mediavilla J. R., et al., "Colistin and carbapenem-resistance Escherichia coli harboring mcr-1 and bla NDM-5 causing a complicated urinary tract infection in a patient in the United States," mBio, 2016, 7(4), eOl 191-16, 4 pages.

[00302] Li H., Estabrook M., Jacoby G.A. Nichols W.W., Testa R. T. Bush K. 2015. In vitro susceptibility of characterized b-lactamase-producing strains tested with Avibactam combinations. Antimicro. Agents Chemother. 59: 1789-1793.

[00303] Starks AM et al, "Pathogenesis of infection by clinical and environmental strains of Vibrio vulnificus in iron-dextran-treated mice," Infection and Immunity, 2000; 68:5785-5793.

[00304] Clinical and Laboratory Standards Institute. 2015. Performance standards for antimicrobial susceptibility testing, 24th informational supplement. CLSI document M100- S25. Clinical and Laboratory Standards Institute, Wayne, PA.