Login| Sign Up| Help| Contact|

Patent Searching and Data


Matches 1 - 50 out of 150,369

Document Document Title
WO/2018/069788A1
The invention relates to the method of enhancement of cells' sensitivity to ultrasound or other, direct or indirect, mechanical stimulus. The method includes spontaneously assembled genetically encoded gas vesicle forming proteins expres...  
WO/2018/069343A1
The present invention relates to nucleic acids encoding for proteins correlated with the resistance of the Sm1 locus in wheat and uses of these nucleic acids, in particular for conferring or improving resistance to orange wheat blossom m...  
WO/2018/070942A1
The present disclosure relates to a method of manufacturing a protein film comprising a patterned nanostructure, wherein the protein is a self-assembling protein, the method comprising: (a) applying a protein solution to a template shape...  
WO/2018/069700A1
The present invention relates to the purification of recombinant blood coagulation factor VIII (FVIII) from in vitro culture employing chromatography techniques.  
WO/2018/071528A1
Provided herein is a recombinant protein including an agonist domain and an anti-inflammatory domain. In one embodiment, the agonist domain has a glucagon-like peptide-1 (GLP-1) receptor agonist activity, the anti-inflammatory domain has...  
WO/2018/069927A1
Modified cells comprising a transmembrane polypeptide comprising at least one extracellular target receptor-binding domain, a transmembrane domain and an intracellular domain, wherein said intracellular domain is not capable of transduci...  
WO/2018/069295A1
The present invention relates to a method of preparing a lysine side-chain modified peptide by solid phase peptide synthesis.  
WO/2018/071918A1
The present disclosure is directed to bispecific heterodimeric Fc fusion proteins comprising an IL-15/IL-15Rα Fc-fusion protein and a PD-1 antibody fragment-Fc fusion protein.  
WO/2018/070521A1
In one embodiment, the present invention addresses the problem of: providing an agent for inhibiting a lectin pathway and an alternative pathway; and others. In one embodiment, the present invention relates to: a fusion polypeptide conta...  
WO/2018/068132A1
The present disclosure provides immunogenic compositions comprising: a) hepatitis C virus (HCV) E1E2 heterodimers, HCV E2, or HCV E1; and b) an adjuvant, where the adjuvant is a cyclic dinucleotide or an archaeosome. The present disclosu...  
WO/2018/070069A1
The present invention provides a medicine comprising: a Toll-like receptor agonist; and LAG-3 protein, a variant thereof, or a derivative thereof.  
WO/2018/070850A1
According to an aspect, provided are: a guide RNA; a vector comprising the same; a composition for removing a nucleic acid sequence encoding a KRAS polypeptide in the genome of a cell, containing the same; a composition for preventing or...  
WO/2018/069471A1
The present invention provides novel uses and methods for T cell based immunotherapies. Specifically, the invention relates to novel ligands, targets and nucleic acids and vectors encoding said targets that are useful for modulating T ce...  
WO/2018/071324A1
Pesticidal proteins exhibiting toxic activity against Lepidopteran pest species are disclosed, and include, but are not limited to, TIC4472, TIC4472PL, TIC1425, TIC2613, and TIC2613PL. DNA constructs are provided which contain a recombin...  
WO/2018/071831A1
The disclosure in some aspects relates to recombinant adeno-associated viruses having distinct tissue targeting capabilities. In some aspects, the disclosure relates to gene transfer methods using the recombinant adeno-associated viruses...  
WO/2018/068756A1
Genetically modified non-human animals that express a human or chimeric (e.g., humanized) B-and T-Lymphocyte-Associated Protein (BTLA or CD272), and methods of use thereof are provided.  
WO/2018/069279A1
The present invention relates to a plant or plant cell being capable to produce polysialylated glycoproteins comprising at least one recombinant nucleic acid sequence operably linked to a promoter, said recombinant nucleic acid sequence ...  
WO/2018/071668A1
A method of treating a subject having a cancer comprising administering a tumor suppressor therapy, such as a TUSC2 therapy, in conjunction with an immune checkpoint inhibitor. Kits and reagents for use in cancer therapy are also provided.  
WO/2018/069467A1
This invention relates to an immunoconjugate comprising interleukin-4 (IL4) and two antibody molecules which bind an extra-cellular matrix component associated with neoplastic growth, angiogenesis, and/or tissue remodelling, such as the ...  
WO/2018/069442A1
Provided herewith are peptide dual agonists of at least the GIPR (glucose-dependent insulinotropic polypeptide receptor) and the GLP2R (glucagon-like peptide-2 receptor), and their use for treatment of bone disorders such as osteoporosis.  
WO/2018/071871A1
Disclosed herein are non-myeloablative antibody-toxin conjugates and compositions that target cell surface markers and related methods of their use to effectively conditioning a subject's tissues (e.g., bone marrow tissue) prior to engra...  
WO/2018/069640A2
The present invention relates in particular to polyclonal antibodies directed against peptides, particularly derivatives of the propeptide of sequence QDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFPRGGRWRR (SEQ ID NO 1). The present invention also...  
WO/2018/071892A1
Methods and compositions for improving the specificity of genome-editing nucleases (e.g., RNA-guided CRISPR-Cas nucleases or engineered zinc finger nucleases) and customizable DNA-binding domain fusion proteins (e.g., RNA-guided dead-Cas...  
WO/2018/071911A1
This disclosure relates to nanoparticles comprising a surface molecule that binds or blocks PD-L1. In certain embodiments, the disclosure relates to methods of using peptides or nanoparticles disclosed herein for the treatment of cancer....  
WO/2018/071817A1
The invention provides methods for the production of recombinant adeno-associated virus vectors (rAAV), comprising culturing producer cells in media with increased osmolality. Also provided are methods for decreasing the production of he...  
WO/2018/069764A1
Provided are peptide nucleic acid derivatives targeting a part of the human HIF-1α pre-mRNA. The peptide nucleic acid derivatives potently induce exon skipping to yield splice variants of HIF-1α mRNA in cells, and are useful to treat i...  
WO/2018/068766A1
Disclosed are an optimised chimeric antigen receptor, a gene and a recombinant expression vector thereof, an engineered CD19-targeted T cell, and an application thereof. The chimeric antigen receptor is made up of CD19ScFv, the hinge dom...  
WO/2018/071216A1
The present disclosure provides CAPN5 substrates and CAPN5 inhibitors, nucleic acids encoding CAPN5 substrates or CAPN5 inhibitors, methods to deliver CAPN5 substrate or CAPN5 inhibitor agents to the eye, and methods of identifying inhib...  
WO/2018/071405A1
The present invention provides an expression vector, host cells, methods and kits for the treatment or prevention of a flavivirus infection in a subject.  
WO/2018/071919A1
The present disclosure is directed to several IL15/IL15Rα heterodimeric Fc fusion proteins.  
WO/2018/071564A1
Disclosed herein are methods and compositions for the production of L-3,4- dihydroxyphenylalanine from a bacteria.  
WO/2018/068347A1
Provided are recombinant plasmids containing the heterodimeric snake venom protein Agkisacutacin A chain gene and Agkisacutacin B chain gene, respectively, cell strains containing the recombinant plasmids, and a method for expressing the...  
WO/2018/069641A1
The present invention relates to new peptides derived from the neurotensin receptor 3 (NTSR3), and to their use, particularly in the treatment of various diseases, especially depression.  
WO/2018/068135A1
The present description relates to methods for delivering polypeptide cargos from an extracellular space to the cytosol and/or nucleus of a target eukaryotic cell. The methods involve contacting the cell with the polypeptide cargo in the...  
WO/2018/069886A1
A therapeutic agent comprising a bacteria which expresses an inhibitor of MYC activity or a extract or product obtainable therefrom, for use in for use in the prevention or treatment o disease wherein MYC levels are elevated, such as can...  
WO/2018/069878A1
The present invention relates to a method for producing a recombinant HIV glycoprotein polypeptide in a plant and to trimeric complexes of the recombinant, plant-produced HIV glycoprotein polypeptide which mimic the native HIV Env comple...  
WO/2018/071465A1
A fusion protein is described, comprising a first N-terminal signal peptide sequence, a second peptide sequence C-terminal to the signal peptide sequence, and a third peptide sequence C-terminal to the second peptide sequence; wherein on...  
WO/2018/067075A1
The present invention relates to methods and compositions that provide an environment that promotes enhanced protein expressing and/or folding. More particularly, the present invention provides engineered thermostable ferritin assemblies...  
WO/2018/065931A1
HRV VP2 proteins useful as components of immunogenic compositions for the induction of cross-reactive cell-mediated immunity against human rhinovirus infection; nucleic acid constructs encoding such HRV VP2 proteins.  
WO/2018/067361A1
This disclosure relates to synthetic ligands for detecting PD-L1 in a sample or subject. The ligand can be labeled with a variety of detectable labels allowing of visualization and quantification. The ligand provides an alternative PD-L1...  
WO/2018/067599A1
Certain embodiments of the disclosure are directed to variant filamentous fungal cells, compositions thereof and methods thereof for increased production of one or more proteins of interest. More particularly, in certain embodiments, the...  
WO/2018/067991A1
Dysfunctional or exhausted T cells arise in chronic diseases including chronic viral infections and cancer, and express high levels of co-inhibitory receptors. Therapeutic blockade of these receptors has clinical efficacy in the treatmen...  
WO/2018/067461A1
The present disclosure provides variant viral coat proteins. The present disclosure provides conjugates comprising variant viral coat protein to which an agent is conjugated; the conjugates can self-assemble into disks which facilitate t...  
WO/2018/066558A1
Disclosed is a method for purifying a recombinant protein from a recombinant cell in which a target recombinant protein is expressed within the cell as an insoluble body, said method characterized in that said recombinant cell is treated...  
WO/2018/067618A1
Provided are binding molecules, such as TCRs or antigen binding fragments thereof and antibodies and antigen-binding fragments thereof, such as those that recognize or bind human papilloma virus (HPV) 16, including HPV 16 E6 and HPV 16 E...  
WO/2018/065538A1
A preparation comprising peptides from natural allergens for use in the prevention of development of allergy.  
WO/2018/067869A1
Provided herein are tumor-antigen VGLL1 specific peptides. Also provided herein are methods of generating VGLL1-specific T cells and their use for the treatment of cancer. In addition, the VGLL1-specific peptides may be used as a vaccine.  
WO/2018/067580A1
The invention is directed to methods to identify improbable mutations in the heavy or light chain variable domain of an antibody, methods to identify antigens which bind to antibodies comprising such improbable mutations, and methods of ...  
WO/2018/067460A1
Provided herein are ERFE fusion polypeptides, compositions and methods of use for treatment, for example in treatment of iron metabolism disorders.  
WO/2018/067455A1
A polypeptide having a sequence at least 60% identical to SEQ ID NO: 1 (WFEWPYWEMNVPDVWN) is provided. The polypeptide includes no more than 100 total amino acid residues.  

Matches 1 - 50 out of 150,369